optional Stadt:
Ort ›

Berlin › Kreisfreie Stadt Berlin › Berlin

Branchenbuch Berlin 10785 Berlin

Kreisfreie Stadt Berlin

Kostenloses Buch Tipps & Tricks für Arbeitswelt & Leben:

Erhalten Sie Ihr Buch "Tipps und Tricks für Arbeitswelt und Leben"
kostenlos per E-Mail als .pdf Datei:


1 Digitale Beratung Digitalagentur
13359
Berlin
Erreichen Sie Ihre Kunden zielgenau im Internet: Wir optimieren und vermarkten Ihre Webpräsenz und machen Sie sichtbar...
digitaleberatung.com Kunden Digitale Mittelstand Beratung Agentur Leistungen Unternehmen Blog
2 A . Müller Umzug Berlin günstiger Umzüge
10117
Berlin
A . Müller ist Ihre Umzugsfirma, Umzugsunternehmen zum Umzugskosten sparen bei Umzug nach Berlin , bei Umzug...
tesu-umzug.berlin Umzug Berlin Lager München Packmaterial Hamburg Irland Frankfurt
3 Erfahrungen24.eu Bewertungen
13403
Berlin
Erfahrungen24 bietet ein intuitives System zum Lesen und Abgeben von Bewertungen für Online Shops, Dienstleister, Produkte und...
erfahrungen24.eu/ Test Erfahrungen Erfahrung Reviews Erfahrungsberichte Shops Bewertungen Preisvergleich
4 THE BRETTINGHAMS GmbH Internetagentur
10629
Berlin
Internetagentur für digitale Lösungen aus Berlin. Full-Service Digitalagentur für Strategie, Webdesign, TYPO3 Programmierung und Online Marketing....
brettingham.de Internetagentur Berlin Services Marketing Unternehmen Agentur Brettinghams Marken

Kostenloses Buch Tipps & Tricks für Arbeitswelt & Leben:

Erhalten Sie Ihr Buch "Tipps und Tricks für Arbeitswelt und Leben"
kostenlos per E-Mail als .pdf Datei:


5 Dudelsack Unterricht in Berlin Musikunterricht
10247
Berlin
Dudelsack Unterricht für Totalanfänger bis Fortgeschrittene, für Kinder (ab 10 Jahre), Jugendliche und Erwachsene in Berlin. > Professioneller...
dudelsackunterricht.jimdo.com Unterricht Berlin Dudelsack Info Z
6 Alex Entrümpelung Berlin Entrümpelung
10243
Berlin - Friedrichshain
Entrümpelung Berlin Die Entrümpelungs-Profis von Alex Entrümpelung Berlin helfen Ihnen schnell und unkompliziert bei Ihrer Entrümpelung in Berlin....
alex-entruempelung.de Berlin Entrümpelung Leistungen Ankauf Gartenpflege Wohnungsauflösung Uns Zuverlässig
7 CAPLAN & GREEN Executive-Search
13627
Berlin
Caplan & Green ist das Talent Management und Executive Search Unternehmen mit der größten Marktbreite. Unsere Berater unterstützen nationale...
caplangreen.com Executive Green Caplan Talent | Geht Partner Nächsten
8 CAPLAN & GREEN Talent Management
13627
Berlin
Caplan & Green ist das Talent Management und Executive Search Unternehmen mit der größten Marktbreite. Unsere Berater unterstützen nationale...
caplangreen.com Green Executive Caplan | Talent Geht Fach Managers
9 PRESTIGE Kosmetikakademie Kosmetikschule
10713
Berlin
Wir sind eine DEKRA zertifizierte Bildungsakademie und Mitglied beim BfD Bundesverband der Fachkosmetiker/-innen in Deutschland. Mit der DEKRA-...
prestige-akad.de Prestige Ausbildung Kosmetikakademie Wellness Dozenten Kosmetik Bildung Schulung
10 Apple Reparatur Berlin Apple Service
10707
Berlin
Ihr Mac oder iPhone macht mal wieder nicht das, was es soll? - Kein Problem, wir von...
apple-reparatur-berlin24.de/ Reparatur Berlin Apple Bewertungen Rufen Agb Joomla Falls
11 PC und Notebook Reparatur Berlin Pc und
10707
Berlin
Sie suchen einen kompetenten, kundenorientierten Service, der dazu noch preiswert ist? Dann sind wir, PC-Reparatur-Berlin24, Ihr Ansprechpartner...
pc-reparatur-berlin24.de/ Pc Reparatur Berlin Fachmann Hilfe Potsdam | Mac
12 Videoüberwachung Einbau Berlin & Umland Videoüberwachung
10707
Berlin
Wollen Sie wissen, wer ein- und ausgeht oder bei Ihnen klingelt? Wollen Sie von überall auf der...
xn--videoberwachung-berlin24-zsc.de/ Videoüberwachung Berlin Umland überwachungssysteme Ama Essen Kameraüberwachung Düsseldorf

Kostenloses Buch Tipps & Tricks für Arbeitswelt & Leben:

Erhalten Sie Ihr Buch "Tipps und Tricks für Arbeitswelt und Leben"
kostenlos per E-Mail als .pdf Datei:


13 DJ Sascha B DJ

Berlin
professioneller DJ Service in ganz Deutschland...
dj-sascha-b.de Sascha Dj | Professioneller Hochzeiten Events Anfrage Hochzeit
14 iSpodBerlin Webdesign
12349
Berlin
Professionelle und aktuelle Websites sind ein Muss für Gründer, Startups, Selbstständige und Unternehmen Ihre Web-, Blog - ...
ispod-webagentur.de/
15 iSpodBerlin Webdesign
12349
Berlin
Professionelle und aktuelle Websites sind ein Muss für Gründer, Startups, Selbstständige und Unternehmen Ihre Web-, Blog - ...
ispod-webagentur.de/ | Erstellen Website Webagentur Webdesign Websitescontent Firmenwebsite Socialmedia
16 Ratenkredits-Vergleiche Finanzen
13086
Berlin
Wir stellen unterschiedliche Anbieter von Darlehen und Krediten vor. So können Kreditnehmer das tatsächliche Leistungsniveau erkennen. Alle...
ratenkredits-vergleiche.de/ Vergleich Ratenkredit Vergleichen Aktuell Unserem Vergleichsportal Angebot Angebote
17 Waschmaschine Abholung Berlin Entrümpelung
10117
Berlin
Sperrmüll Abholung in Berlin Komplett Service Entrümpelungen aller Art sofort Möbel Sperrholz Waschmaschine Abholung Berlin Keller Entrümpelung...
xn--sperrmllabholung-berlin-hpc.org
18 Hochzeitsfotograf in Berlin - Fotos eurer
12101
Berlin
Fotos Eurer Hochzeit – Euer Hochzeitsfotograf in Berlin für gefühlvolle Hochzeitsfotografie und emotionale Hochzeitsreportagen. Traumhafte Hochzeitsreportagen in Berlin...
fotos-eurer-hochzeit.de Hochzeitsreportage Berlin Hochzeitsfotograf Trauung Boudoir Euch Preise Begleitung
19 Detektei AC online Detekteien
14057
Berlin
Ihr professionellen IT-Dienstleister - Detektei AC Lösungen für Verbesserungen Konkrete Lösungen zum einem erfolgreichen IT-Sicherheitsmanagement und Verbesserungen anzubieten, würde...
detektei-ac.de
20 Detektei AC online Detekteien
14057
Berlin
Ihr professionellen IT-Dienstleister - Detektei AC Lösungen für Verbesserungen Konkrete Lösungen zum einem erfolgreichen IT-Sicherheitsmanagement und Verbesserungen anzubieten, würde...
detektei-ac.de
21 Detektei AC online Detekteien
14057
Berlin
Ihr professionellen IT-Dienstleister - Detektei AC Lösungen für Verbesserungen Konkrete Lösungen zum einem erfolgreichen IT-Sicherheitsmanagement und Verbesserungen anzubieten, würde...
detektei-ac.de
22 Detektei AC online Detekteien
14057
Berlin
Ihr professionellen IT-Dienstleister - Detektei AC Lösungen für Verbesserungen Konkrete Lösungen zum einem erfolgreichen IT-Sicherheitsmanagement und Verbesserungen anzubieten, würde...
detektei-ac.de
23 Detektei AC online Detekteien
14057
Berlin
Ihr professionellen IT-Dienstleister - Detektei AC Lösungen für Verbesserungen Konkrete Lösungen zum einem erfolgreichen IT-Sicherheitsmanagement und Verbesserungen anzubieten, würde...
detektei-ac.de
24 Detektei AC online Detekteien
14057
Berlin
Ihr professionellen IT-Dienstleister - Detektei AC Lösungen für Verbesserungen Konkrete Lösungen zum einem erfolgreichen IT-Sicherheitsmanagement und Verbesserungen anzubieten, würde...
detektei-ac.de
25 Detektei AC online Detekteien
14057
Berlin
Ihr professionellen IT-Dienstleister - Detektei AC Lösungen für Verbesserungen Konkrete Lösungen zum einem erfolgreichen IT-Sicherheitsmanagement und Verbesserungen anzubieten, würde...
detektei-ac.de
26 Histavino Wein
10997
Berlin
Die Seite Histavino ist für Menschen interessant, die trotz ihrer Histaminintoleranz nicht auf einen guten Tropfen Wein...
histavino.com
27 Zahnarzt für Zahnimplantate Berlin Mitte Zahnarzt Oralchirurgie
10785
Berlin
Zahnarzt für Zahnimplantate in Berlin Das Zahnarztzentrum am Potsdamer Platz in Berlin Mitte besteht aus einem erfahrenen Team...
zahnarzt-am-potsdamer-platz.de/
28 KOR7 MEDIA Marketing
10587
Berlin
KOR7 MEDIA ist eine Agentur für digitales Marketing und Content Produktion. Wir steigern Ihren Unternehmens- und Markenwert...
kor7media.de Instagram Marketing Influencer Media Social Content Agentur Produktion
29 BU Sinnvollschutz Versicherung
13086
Berlin
Unsere Firma erklärt genau, ob und wann eine private Berufsunfähigekeitsversicherung sinnvoll ist. Wir stellen die Stärken und...
berufsunfaehigkeitsversicherungen-sinnvollschutz.de/ Berufsunfähigkeitsversicherung Sinnvoll Angebot Zum Sinnvollschutz Wann News Polizisten
30 Neue Dusch Oase an einem Tag Sanitär
10709
Berlin
Die Berliner Preis Revolution : Umbau Wanne zu Dusche - an einem Tag Preiswert und Fachgerecht :...
flache-dusche.de Z Y
31 Öltank-Service Tobias Obermann Tankentsorgung
13509
Berlin
Tankreinigung und Tankentsorgung zum Festpreis. Sauber, Schnell und Zuverlässig durch den Familienbetrieb aus Berlin. Mit Modernsten Maschinen...
oeltank-service.eu Demontage Preise Leistung öltank Tankdemontage Heizöltank Tobias Berlin
32 Entsorgo Containerdienst Entsorgung
12049
Berlin
Buche Deine Entsorgung oder Entrümpelung jetzt online! Bei Entsorgo.de kannst Du innerhalb von nur 3 Minuten die Kosten...
entsorgo.de/
33 Schmuckankauf Berlin Lichterfelde Juwelier Haeger Juwelier
12207
Berlin
Möchten Sie Ihr Altgold verkaufen? Sind Sie im Besitz von altem Schmuck, Zahngold oder Industriegold? Dann überlegen...
juwelier-haeger.de/berlin Schmuck Gold Geschenke Diamanten Berlin Rolex Modi Vertrauen
34 Schmuckankauf Berlin Juwelier Haeger Juwelier
10711
Berlin
Sie möchten Platinschmuck veräußern? Sie wollen einen Ring verkaufen? Ihr alter Silberschmuck entspricht nicht mehr Ihrem Geschmack?...
juwelier-haeger.de/berlin Schmuck Gold Geschenke Diamanten Berlin Markenschmuck Freundschaftsringe Schmückendes
35 Schah Sedi und Schah Sedi Rechtsanwälte Rechtsanwalt
10719
Berlin
Schah Sedi und Schah Sedi ist eine der in Deutschland führenden Kanzleien auf dem Gebiet des Personenschadensrechts....
schah-sedi.de/ Schah Sedi Schmerzensgeld Büro Anfrage Navigation Kostenlose Rechtsanwälte
36 Fenster Reparaturen für Berlin und Brandenburg Fenster und
13403
Berlin Reinickendorf
Ihr Berliner Servicepartner für Fenster Reparaturen/Umbau/Neubau/Wartungen für den gesamten Berliner Raum und Brandenburg. Seit nunmehr über 20...
fensterdurchblick.com Berlin Fenster Reparatur Fensterbau Tren Sonnenschutz Markisen Montage
37 Entrümpelung Berlin Entrümpelung
13089
Berlin
Entrümpelung vornehmen lassen – Ihr Ansprechpartner in Berlin Wir übernehmen sogar die Entrümpelung Ihres Grundstücks und sind jederzeit...
aflex.berlin Berlin Entrümpelung Aflex Entsorgung Wohnungsauflösung Dachboden Wohnung Sperrmüll
38 Antiquitäten Schmuck und Altgold Ankauf Berlin Antiquitäten
12207
Berlin
Antique Galerie: Hier können Sie Antiquitäten, Altgold, Schmuck und Diamanten in Berlin Lichterfelde verkaufen. Der Schmuckankauf der...
antiquegalerie.de/standorte/antiquitaeten-berlin-lichterfelde Antiquitäten Kurfürstendamm Berlin Händler Verkauf Ankauf Info@antiquegaleriede Finden
39 Antiquitäten Schmuck und Altgold Ankauf Berlin Antiquitäten
10711
Berlin
Antique Galerie: Hier können Sie Antiquitäten, Altgold, Schmuck und Diamanten in Berlin am Kurfürstendamm verkaufen. Der Schmuckankauf...
antiquegalerie.de/standorte/antiquitaeten-berlin Z Y
40 Pia Gabel Beratung Unternehmensberatung
14974
Ludwigsfelde (Berlin)
Generalist unter den Beratern: Strategie, Organisation und Marketing. Beratungsthemen richten sich auf Wachstum, Innovation und Unternehmensgründung, Corporate...
piagabel.com Strategie Marketing News Interim Kundenfokussierte Beratung Innovation Vertrieb
41 Naturheilpraxis Anke Bentler Heilpraktikerin
10555
Berlin
Schöne Naturheilpraxis im Westphälischen Viertel von Moabit, in der Nähe vom Hansaplatz. Seit 2010 biete ich Akupunktur...
ahk-berlin.de Bentler Anke Naturheilpraxis Berlin Kynotherapie Homopathie Akupunktur Homöopathie
42 Vergleichs-Berichte Versicherung
13086
Berlin
Wir stellen auf dieser Seite unterschiedliche Vergleichs-Berichte und Tests von Versicherungen und Policen vor. Alle Tests können...
vergleichs-berichte.de/ Berichte Rente Vergleichs Gewerbe Riester Baufinanzierung Berufshaftpflicht Versicherungsvergleich
43 Augencremes-Testsieger Beauty
13086
Berlin
Wir stellen unterschiedliche Cremes von Hersteller für die Region der Augen vor. Erkennen Sie, welche Leistungsvariationen bestehen....
augencremes-testsieger.de/ Augencreme Anti Cream Augen Platz Augenpflege Falten Eye
44 Heiko Nusche Bauausführung GmbH Baugewerbe
12557
Berlin
Meisterbetrieb für Betonbau-, Maurer-, und Fliesenlegerarbeiten im Südosten der Hauptstadt Berlin. Ob Neubau, Umbau, Instandsetzung oder Modernisierung...
bauausfuehrung-berlin.de Berlin Bauausführungen Betonbauarbeiten Maurerarbeiten Bauausführung Fliesenlegerarbeiten Maurer Maurermeister
45 Container online sicher und günstig bestellen Containerservice
10315
Berlin
Containerdienst.de ist Ihr zuverlässiger Containerdienst und Containerservice zum Container mieten und Container bestellen bundesweit. Hier finden Sie...
containerdienst.de Container Entsorgen Holz Bauschutt Erdaushub Entsorgung Dachpappe Verpackungen
46 ml seodesign - mobile seo website Webdesign Mobile
13469
Berlin
Prof. Webdesign, Mobile SEO Website in Responsive Design, Google PageSpeed Test auf Mobile SEO-Optimierung für Mobilgeräte, Website Relaunch -...
mobile-seo.website/ Mobileseo Website Webdesign Oben Optimierung Seo Responsive Design
47 Saubere Tankreinigung und Demontage von Heizöltanks Tankschutz
13509
Berlin
Tankreinigung und Demontagen zum Festpreis. Sauber, Schnell und Zuverlässig durch den Familienbetrieb aus Berlin. Mit Modernsten Maschinen...
oeltank-service.eu Preise Leistung Tankdemontage Ablauf öltankreinigung Tankreinigung Demontage Tobias
48 der weg zur wunschyacht Beratung
88662
überlingen
Mit der richtigen Anwendung der Kybernetik finden sie ihren persönlichen weg zur passenden Yacht auch ohne Vorkenntnisse....
segelyacht-auswahl-berater.de Weg Yacht Code Wunschyacht Navigation Personal Rom Ermittelt
49 Sightseeing Point GmbH Stadtführungen
10117
Berlin
Es werden über 60 Stadtführungen zu Fuß, per Bus, Rad und Schiff in Berlin und Potsdam angeboten....
sightseeing-point-berlin.de
50 Fach- und Rechtsanwältin Gabriele Brandenburg Fach- und Rechtsanwältin Gabriele Brandenburg Rechtsanwalt
12161
Berlin
Anwaltskanzlei für Arbeitsrecht, Sozialversicherungsrecht, Steuerrecht und Gesellschaftsrecht in Berlin Friedenau-Steglitz direkt am U-Bahnhof Walther Schreiber-Platz. Rechtsanwältin Gabriele...
rabrandenburg.de Arbeitsrecht Sozialrecht Gesellschaftsrecht Steuerrecht Rechtsgebiete Unfallrecht Rechtsanwalt Brandenburg
51 Vollnarkose Zahnbehandlung Zahnklinik Zahnarzt
10117
Berlin
BERLIN-KLINIK ist ein staatlich zugelassenes Berliner Krankenhaus für die Fachbereiche MKG Mund- Kiefer- Gesichtschirurgie und Plastische Operationen....
berlin-klinik.de Berlin Klinik Master Implantologie Zahnarzt Gesellschaft Spezialist Klinik®
52 Eventschiff für Feier Party Incentive Tagung Schiffahrt
12161
Berlin
Berlin : Sightseeing | Feiern | Party | Tagung auf dem Wasser ! Herzlich willkommen an Bord zu...
eventschiff.eu Berlin Potsdam Bord Ahoi Boot Yachting Wasser Feier
53 argo.berlin Werbeagentur
10439
Berlin
Wir entwickeln mit Ihnen gemeinsam günstige Werbung für Ihr Unternehmen, die wirklich funktioniert. Facebookwerbung ...
werbung.argo.berlin/werbeagentur
54 Diamanten Ankauf Haeger Berlin Lichterfelde Juwelier
12207
Berlin
diamanten-haeger.de/diamantenankauf-berlin-lichterfelde Diamanten Ankauf Haeger Ertes Formular Leben Wie Schönen
55 Diamanten Ankauf Haeger Berlin Kurfürstendamm Juwelier
10711
Berlin
diamanten-haeger.de/diamantenankauf-berlin-kurfuerstendamm Diamanten Ankauf Haeger Edelmetalle Familie Diamantengroßhandel Wie Generationen
56 Versicherung 24 7 Finance
12045
Berlin
KFZ-Versicherung-Vergleich: Alle Angebote auf einen Blick Ihre jetzige Versicherung kostet Ihnen zuviel und bietet Ihnen nicht die Versicherungs-Leistungen...
versicherung-online-vergleich.net/ Versicherungen Garantieversicherung Grundsicherung Rente Versicherung Neuwagen Kfz Beiträge
57 Physiotherapie Myoreflextherapie Lymphdrainage Rückenschule Schwindeltherapie Atlastherapie Physiotherapie Krankengymnastik
12309
Berlin
Ich habe mich als Physiotherapeut selbstständig gemacht um mir Zeit für Sie zu nehmen. Mit einem individuell...
praxis-minarski.de Inhalte Seiten Gesundheit Daten Johannes Minarski Betreiber Behandlung
58 Fahrrad Flöckner am Alex - Cube Fahrradhandel
10178
Berlin
fahrrad-flöckner.de
59 Haeger GmbH Goldankauf Berlin Lichterfelde Goldankauf
12207
Berlin
Die beiden Filialen von Goldankauf Haeger in der Hauptstadt stehen Ihnen jederzeit offen, wenn Sie Barren aus...
goldankauf-haeger.de/berlin Z Y
60 Franziska Oehler - DirektSEO Online Marketing
10119
Berlin
Bei DirektSEO in Berlin berate ich Sie individuell zu den Themen Suchmaschinenoptimierung (SEO), Suchmaschinenmarketing (SEM), zur Gestaltung...
direktseo.de/ Suchmaschinenoptimierung Marketing Social Media Suchmaschinenwerbung Analyse Beratung Webseite
61 Franziska Oehler - DirektSEO Online Marketing
10119
Berlin-Mitte
Bei DirektSEO in Berlin berate ich Sie individuell zu den Themen Suchmaschinenoptimierung (SEO), Suchmaschinenmarketing (SEM), zur Gestaltung...
direktseo.de/ Suchmaschinenoptimierung Marketing Media Social Suchmaschinenwerbung Beratung Analyse Design
62 MANZEL Unternehmensentwicklung GmbH Unternehmensberatung
10629
Berlin
Die MANZEL Unternehmensentwicklung GmbH berät, begleitet und unterstützt aktiv mittelständische Unternehmen bei Gründung, bei Wachstum, strategischer Neuausrichtung...
manzel.de/ Berlin Unternehmensentwicklung Seminare Unternehmen Manzel Personalentwicklung Trainings Unternehmensberatung
63 F + S Software GmbH Software
10707
Berlin
Die F + S Software GmbH gilt als Spezialist für die Softwareentwicklung im Bereich Werkzeugverwaltung, Werkzeugmanagement und...
f-s.de/ Software Werkzeugverwaltung Lagerverwaltung Mobile Lösungen Werkzeugmanagement Logistik Management
64 Detektei
13509
Berlin
Detektei für den Raum Berlin....
detektei-aplus.de/dependancen/detektei-berlin.htm Berlin Detektei Plus Detektiv Detektive Ermittlungen Wirtschaftsdetektei Einsatzort
65 Messi Wohnung entrümpeln Entrümpelungen
10117
Berlin
Messi Wohnung entrümpeln lassen in Berlin Messie Haushaltsauflösungen sofort Räumungen Entrümpelungen....
whgreumung.de/ Berlin Wohnung Entrümpelung Messi Möbel Sperrmüll Preis Entrümpeln
66 Produktfotografie Berlin Fotografie
13187
Berlin
Photos4shops ist eine Full Service Foto Agentur in Berlin. Hier erhalten Unternehmen für Ihre Onlinepräsentation und für...
photos4shops.com Produktfotografie Glasware Chromware Lesen Packshot Legeware Berlin Agentur
67 Zauberkünstler Berlin Zauberer
12247
Berlin
Zauberei für Groß und Klein bietet der Zauberkünstler Fabian Schneekind aus Berlin. Der Zauberkünstler kann für folgendes gebucht...
fabianschneekind.de Google Website Berlin Analytics Erfassung Ip Daten Zauberer
68 DYWAG Projekt- u. Wohnungsbauverwaltungsgesellschaft mbH & DYWAG Projekt- u. Wohnungsbauverwaltungsgesellschaft mbH & Bauunternehmen
10117
Berlin
Wir bieten Ihnen einen zuverlässigen Baupartner Service im Neubau, in der Sanierung, im Bestand und in der...
dywag.de Bauunternehmen Wohnungsbau
69 beleuchtungdirekt.de Leuchtmittel Onlinehandel
10969
Berlin
Wenn man hochwertige und energiesparende LED Leuchtmittel benötigt, sollte man zuerst im Onlineshop von beleuchtungdirekt.de nachsehen. Wir...
beleuchtungdirekt.de/ Lampen Philips Leuchtstofflampen Lieferung Osram Email Energiesparlampen Led
70 Produktfotografie Berlin Fotografie
13187
Berlin
Photos4shops Berlin bietet deutschlandweit professionelle Produktfotografie für diverse Unternehmen im Bereich E-Commerce. Hier erhalten Sie qualitativ hochwertige...
photos4shops.com Packshot Glasware Berlin Hollow Agentur Produktfotografie Kleider Legeware
71 George & Partner mbB Rechtsanwälte Gesellschaftsrecht Rechtsanwalt
10623
Berlin
Die Kanzlei George&Partner ist Ihr Partner für Gesellschaftsrecht. Wir stehen Ihnen mit Rat und Tat zur Seite...
georgepartner.de/ Kanzlei George Gesellschaftsrecht = Fachanwalt Klienten Berlin Niels
72 Auto Ankauf und Export Berlin Auto Ankauf und Export Berlin Auto
12045
Berlin
Autoexport Berlin und Bundesweit Bei uns sind Sie auf der richtigen und sicheren Seite! Sie wollen Ihr...
ps-autoexport.de Auto Verkaufen Autoexport Ankauf Fahrzeuge Berlin Anbieten Probiere
73 Landsiedel NLP Training Berlin Bildung
10405
Berlin
NLP Ausbildung in Berlin, Weiterbildung, Erwachsenenbildung, Seminare zum Thema Persönlichkeitsentwicklung und Kommunikation mit NLP...
landsiedel-seminare.de/nlp/nlp-in-berlin.html Nlp Coach Tage Berlin Ausbildung Coaching Trainer Master
74 Hochzeitsfotograf in Berlin - Fotos eurer Hochzeitsfotograf in Berlin - Fotos eurer Hochzeitsfotograf
12101
Berlin
Hochzeitsfotograf in Berlin – Fotos Eurer Hochzeit Fotos Eurer Hochzeit – Der Hochzeitsfotograf in Berlin für gefühlvolle Hochzeitsfotos...
fotos-eurer-hochzeit.de Berlin Hochzeitsfotograf Hochzeit Galerie Preise Leistungen Hochzeitsblog Fotos
75 Pilch Dachbau GmbH Dachdeckerei
13435
Berlin
PILCH DACHBAU Ihr Dachdecker-Meisterbetrieb aus Berlin Wir lieben Dächer, wir lieben unsere Arbeit. Und so machen wir sie auch....
pilch-dachbau.de Berlin Einblasdämmung Pilch Dachdecker Dachbau Dachdeckerei Flachdachabdichtung Dachbegrünung
76 Heiraten in Dänemark — leicht und Hochzeitsplannung
10965
Berlin
Agentur Konstannta begleitet Kunden auf dem Weg zur schönen Heirat in Dänemark. Wir bieten schnelle Termine und...
konstannta.de/ Dänemark Heiraten Schnell Leicht Anerkennung Standesamt Legalisierung Deutschland
77 ATI Umzüge Umzugsunternehmen Berlin Umzugsfirma Berlin
13357
Berlin
ATI Umzüge Umzugsunternehmen aus Berlin. Wir führen kostengünstige Umzüge europaweit durch. Unsere Umzugsfirma bietet Ihnen faire Festpreisangebote...
ati-umzuege.de Berlin Info@ati Umzuegede Umzugsmaterial Halteverbot Zahlung Bestellen Entsorgung
78 Umzugshelfer Berlin | Das Original Umzug
10715
Berlin
Die Umzugshelfer Berlin sind Ihre familiengeführte und zuverlässige Umzugsfirma aus Berlin-Charlottenburg. Wir führen private und gewerbliche Umzüge...
umzugshelfer-berlin.de/ Berlin Umzugshelfer Umzugshilfe Seit ✔ ♥ Professionelles Rufen
79 Kristall Umzüge Berlin - Umzugsfirma Berlin Umzug
13409
Berlin
Sie benötigen ein professionelles Umzugsunternehmen in Berlin, welches sich rund um den Umzug, Lagerung und Entrümpelung in...
kristall-umzuege.de Berlin Umzug Umzüge Umzugsmaterial Wohnungsauflösung Umzugshelfer % Umzugsunternehmen
80 Ipilum Websolutions E- Commerce
10247
Berlin
Unser Kerngeschäftsfeld ist seit über 14 Jahren die Entwicklung unseres modularen Ipilum Shop Systems anhand der Bedürfnisse...
ipilum.com Commerce Shopsystem Ipilum Webdesign Hosting Re Solutions Folgen
81 Sperrmüllabholung Entrümpelungen Haushaltsauflösungen
10117
Berlin
Sperrmüllabholungen Recycling Dienst Lemt sofort Entsorgunsdienst Eilservice Müll Entrümpelungen Haushaltsauflösungen....
lemt.de/ Recycling Entrümpelung Lemt Berlin Müll Eilservice Sperrmüllabholung Keller
82 BellaVital Kosmetikstudio Berlin Kosmetikstudio
10707
Berlin
Kosmetikstudio Berlin: Unweit vom Kurfürstendamm werden Sie von Kopf bis Fuß verwöhnt. Bei BellaVital, dem Kosmetikstudio in...
bellavital.de Laser Kosmetikstudio Berlin Wellness Kosmetik Bellavital Kudamm Termin
83 Anwalt Familienrecht Berlin - Schulz & Anwalt Familienrecht
10247
Berlin
Anwalt Familienrecht Berlin - Schulz & Deutschmann: Rechtsberatung bei Scheidung, Sorgerecht und Unterhaltszahlungen! Sie haben einen Notfall...
anwalt-scheidung-familienrecht.de Familienrecht Anwalt Berlin Scheidung Sozialrecht Sorgerecht Kostenlose Scheidung Rechtsgebietefamilienrecht
84 EMS-Training in der fitbox Weissensee Personal Training
13088
Berlin
Die fitbox Weissensee ist der Partner den du gesucht hast. Direkt an der Tram Haltestelle Albertinenstraße. kannst...
fitbox.de Training Ems Artikel Personal Vorverkauf Trainer Fragen Trainingsablauf
85 Flink Umzüge und Lagerung Umzugsunternehen
10827
Berlin
Flink Umzüge aus Berlin ist für Sie zur Stelle, ob beim Umzug oder Transport von und nach...
flink-umzuege.de/ Umzüge Umzug Umzugsunternehmen Umzugshelfer Entrümpelung Umzugsmaterial Einlagerung Entsorgung
86 Heilpraktiker Marzahn-Hellersdorf Heilpraktiker
12619
Berlin
Die Heilpraktikerin Sabrina Pfützner sogrt wieder für Wohlbefinden durch alternative Behandlungsmöglichkeiten: Autoimmunerkrankungen, Burn-Out Symptomatiken, rheumatische Erkrankungen, Magen-Darm-Erkrankungen und...
gesundes-menschenleben.de Behandlung Naturheilpraxis Ernährung Homöopathie Sabrina Nns Pfützner Miasmatik
87 Steuerkanzlei Merla Steuerberater
10789
Berlin
Ihr Steuerberater in Berlin Charlottenburg-Wilmdersdorf - Steuerliche Beratung von Unternehmen - Steuerliche Beratung von Privatpersonen - Internationales Steuerrecht - Existenzgründerberatung...
steuerkanzlei-merla.de Berlin Steuerberater Merla Steuerkanzlei Charlottenburg Kanzlei Wilmersdorf Wilmdersdorf
88 Schachshop in Berlin Schach und
12101
Berlin
Seit 1980 von Heide Ketterling geführtes Spezialgeschäft für Schachbedarf, Schachfiguren, Schachbretter, Schachbücher, Schachcomputer, Schachprogramme, Schachsoftware...
elektroschach.de Elektroschach Schachuhren Eröffnung Mittelspiel Endspiel Schachcomputer Alte Neuheiten
89 Schachshop in Berlin Schach und
12101
Berlin
Seit 1980 von Heide Ketterling geführtes Spezialgeschäft für Schachbedarf, Schachfiguren, Schachbretter, Schachbücher, Schachcomputer, Schachprogramme, Schachsoftware...
elektroschach.de Elektroschach Endspiel Schachuhren Mittelspiel Eröffnung Pokale Literatur Pc
90 BW Bestwert Immobilien GmbH Immobilienmakler
10719
Berlin
Die BW Bestwert Immobilien GmbH ist Ihr kompetenter Partner in Sachen Denkmalimmobilien. Wir bieten Ihnen das volle...
bestwert.de Vertriebspartner Bestwertde Kapitalanlage Denkmalimmobilien Uns Lukrativen Bestwert Objekte
91 Steuerkanzlei Merla Steuerberater
10789
Berlin
Ihr Steuerberater in Berlin Charlottenburg Sie suchen einen Steuerberater in Berlin zur Unterstützung bei Ihrer Buchhaltung, Ihrer Steuererklärung...
steuerkanzlei-merla.de Berlin Steuerberater Merla Steuerkanzlei Kanzlei Charlottenburg Steuerberatung Erstgespräch
92 Zäune aus Polen Garten

Berlin
Die Firma Ampanel gehört zu den erfahrensten polnischen Herstellern von hochwertigen Zäunen jeder Art. Seit mehreren Jahren...
ampanel.de Panel Zaun Moderne Zaunsysteme Zaunfelder Zäune Preisen Schreiben
93 Goldankauf Berlin Goldankauf Haeger GmbH Goldankauf
10711
Berlin
Der Goldankauf in Berlin: In vielen Haushalten schlummern Werte, die ihren Besitzern gar nicht bekannt sind. Möglich...
goldankauf-haeger.de/berlin Berlin Ankauf Goldmünzen Goldankauf Kaufen Verkaufen Anfahrt Goldbarren
94 Haushaltsauflösung und Entrümpelung Berlin Haushaltsauflösung
12619
Berlin
Entsorgungen und Wohnungsauflösungen mit der Haushaltsauflösung und Entrümpelung Berlin. Faire Preise und eine hohe Kompetenz zeichnet das...
haushaltsaufloesung-entruempelung-berlin.de Berlin Haushaltsauflösung Entrümpelung Zeit Entsorgung Denn Berlin * Berg
95 Jakob Bauer Infomarketing GbR DROHNE ZERFETZT
10785
Berlin
Jetzt Drohnen Versicherung abschliessen ➜ 100% Versicherungs-Schutz nach dt. Luftfahrt Gesetzgebung. JETZT Drohne oder Quadrocopter versichern....
versicherungdrohne.de/ Drohne Drohnen Versicherung Versichertedrohnede Haftpflichtversicherung Kaufen Nutzung Schaden
96 MOBIX mobile Diskothek Diskjockey
12279
Berlin
Mobix mobile Diskothek ist die mobile Disco mit professionellem DJ für jeden Anlass in Berlin und Brandenburg....
mobix-diskothek.de Berlin Dj Mobile Hochzeit Disco Diskothek Party Hochzeits
97 Dudelsack Unterricht in Berlin Musikunterricht
10247
Berlin
Dudelsack Unterricht für Totalanfänger bis Fortgeschrittene, für Kinder (ab 10 Jahre), Jugendliche und Erwachsene in Berlin Friedrichshain -...
facebook.com/dudelsackunterricht.berlin Erstellen Karriere Seiten Uns Registrieren Werbeanzeige Orte Lite
98 Mit Videocoaching IHK Wirtschaftsfachwirt werden Wirtschaftsfachwirt
10245
Berlin
Willkommen bei den Onlinelehrvideos von Dr. Marius Ebert - Mit effektiven Schnell-Lern-Systeme Prüfungen besser bestehen. Wir bieten...
wirtschaftsfachwirt-in-ihk.de Wirtschaftsfachwirt Lehrgang Wirtschaftsfachwirtin Geprüfter Videos Staatlich Ihk Prfung
99 KOSMETIK STUDIO CARISMA Kosmetik
10717
Berlin
Kosmetik Behandlungen mit wertvollen Wirkstoffen zur Hautbildverbesserung für Damen & Herren abgestimmt auf Ihre hautspezifischen Bedürfnisse....
kosmetik-institut-berlin.com Kosmetik Carisma Preise Maniküre Kosmetikbehandlungen Salon Fußpflege Kosmetikprodukte
100 Travestie Show Berlin Alleinunterhalter Partyservice

Berlin
Sie möchten Ihre Gäste gekonnt unterhalten? Sie suchen das Besondere? Damit Ihre Veranstaltung ein voller Erfolg wird...
travestie-berlin.com/ Travestiekünstler Veranstaltung Moderation Izora Montaniere Live De Travestie
101 Velonest c o TenMedia UG (haftungsbeschränkt) Fahrrad
25
Berlin
Velonest bietet einen Marktplatz für Fahrradfreunde. Auf dem Portal können Händler und Privatpersonen ihre Fahrräder kostenfrei inserieren....
velonest.com Fahrrad Fahrräder Gebrauchte Forum Gebraucht Markt Kaufen Hilfe
102 iPhone Handy Reparatur Berlin IPhone Handy
13089
Berlin
Möchten Sie Ihr iPhone reparieren lassen? Wir bieten Ihnen eine schnelle und zuverlässige Handy Reparatur. Günstig reparieren...
handy-reparatur-berlin.com Apple Iphone Samsung Galaxy Ipad Reparatur Sony Xperia
103 Autoreinigung Noack Autoreinigung
13089
Berlin
Möchten Sie Ihren PKW reinigen oder pflegen lassen? Wir bieten Ihnen die günstige Autoreinigung in Berlin. Unser...
autoreinigung-noack.de Berlin Nanoversiegelung Autopflege Fahrzeugaufbereitung Autoreinigung Noack Scheibenversiegelung Innenreinigung
104 Ausbildung Berlin Ausbildung Weiterbildung
10365
Berlin
Berufliche Veränderung gefällig? Wir bieten Ihnen Ausbildung, Weiterbildung und Umschulung, die unter anderem auch gefördert werden kann. In...
dub-berlin.de Berlin Ausbildung Bildung Umschulung Sozialassistent Uhr Frau Einzelhandel
105 Sperrmüll Berlin Entrümpelung
13409
Berlin
Benötigen Sie eine Entrümpelung und Entsorgung von Sperrmüll? Wir übernehmen die Entrümpelung aus Büro, Keller, Wohnungen und...
sperrmuell-entsorgung-entruempelung.de Berlin Sperrmüll Entrümpelung Entsorgung Messi Möbeltaxi Keller Firma
106 Sperrmüll Berlin Entrümpelung
13409
Berlin
Preiswert Sperrmüll in Berlin. Benötigen Sie eine Entrümpelung und Entsorgung von Sperrmüll? Wir übernehmen die Entrümpelung aus...
preiswert-sperrmuell-berlin.de Berlin Sperrmüll Entrümpelung Entsorgung Sperrmüllentsorgung Firma Kellerauflösung Sperrmüllabholung
107 Möbeltaxi Berlin Möbeltaxi
13409
Berlin
Ihr Möbeltaxi in Berlin für Möbeltransporte jeder Art. Die Firma Flitzer-Möbeltaxi steht Ihnen für Kleintransporte, Möbeltransporte, Miniumzüge...
moebeltaxi-moebeltransport-berlin.com Berlin Möbeltaxi Flitzer Möbeltransport Entrümpelung Entsorgung Möbeltransporte Kleintransporte
108 Möbeltaxi Berlin Möbeltaxi
10719
Berlin
Ihr Möbeltaxi in Berlin für Möbeltransporte jeder Art. Die Firma Flitzer-Möbeltaxi steht Ihnen für Kleintransporte, Möbeltransporte, Miniumzüge...
moebeltaxi-moebeltransport-berlin.com Berlin Möbeltaxi Flitzer Entrümpelung Möbeltransport Entsorgung Transport Kleintransporte
109 Kinderarzt Berlin Gesundheit
10719
Berlin
Der Kinderarzt Dr.Zia steht unseren jungen Patienten mit Kompetenz und Erfahrung zur Seite. Impfungen, Grippe, Vorsorge. Der...
kinderarzt-berlin-zia.de Berlin Kinderarztpraxis Kinderarzt Charlottenburg Jahre Monate Wilmersdorf Impfung
110 Kinderarzt Berlin Gesundheit
10719
Berlin
Der Kinderarzt Dr.Zia steht unseren jungen Patienten mit Kompetenz und Erfahrung zur Seite. Impfungen, Grippe, Vorsorge. Der...
kinderarzt-berlin-zia.de Berlin Kinderarztpraxis Kinderarzt Charlottenburg Jahre Monate Navigation Impfung
111 X Parking Flugreisen
13405
Berlin
Wer eine Flugreise von Berlin Tegel aus plant und einen Parkplatz benötigt, ist bei der Firma X...
flughafen-berlin-parkplatz.de Tegel Flughafen Parkplatz Berlin Parken Airport Reservierung Preise
112 United Leonidas Objektschutz &
13347
Berlin
Das Sicherheitsunternehmen aus Berlin, steht Ihnen für Ihren Objektschutz gerne zu Ihrer Verfügung. Ob Hotel, Gebäude, Ladenflächen...
security-objektschutz.com Objektschutz Berlin Sicherheitsunternehmen Brandschutz Erfüllt Objektschutzaufgaben Stunden Professionell
113 AGAS Hotel Berlin Hotel Berlin
12681
Berlin
Das Agashotel in Berlin, hat seinen Sitz in Berlin - Lichtenberg. Das Hotel verfügt über komfortable Hotelzimmer...
agashotel.de Berlin Hotel Agas Hauptstadt Buchen Urlaub Lichtenberg Aufenthalt
114 Steuerberater Berlin Steuerberater
10179
Berlin
Der Steuerberater in Berlin Lars Franke, ist ein zuverlässiger Steuerberater für Ihr Unternehmen. Ob Existenzgründer, Einzelunternehmen oder...
stb-franke.de Steuerberater Berlin Steuerbüro Steuerberatung Buchführung Steuerrecht Veranstaltungen Charlottenburg
115 Tempo Umzüge Berlin Umzugsfirma
13587
Berlin
Das Umzugsunternehmen Tempo Umzüge aus Berlin, ist ein kleines, noch junges, dennoch professionelles Umzugsunternehmen für Umzüge und...
tempo-umzuege.de Umzug Umzüge Berlin Deutschland Möbeltransporte Umzugsunternehmen Kleintransporte Büroumzug
116 Umzugsfirma Berlin Stark Umzüge
12059
Berlin
Stark Umzüge Berlin. Wer einen Umzug plant, oder durchführen lassen möchte, kann sich auf Stark Umzüge Berlin...
umzugsfirma-stark.de Umzug Berlin Uns Umzugsunternehmen Selbstverständlich Dass Blog Umzugsdecken
117 Lotjonn Transporte Düsseldorf Umzug &
40239
Berlin
Lotjonn Transporte in Düsseldorf, ist Ihr zuverlässiges Umzugsunternehmen, wenn Sie einen Umzug nach Düsseldorf, aus Düsseldorf nach...
lotjonn-transporte.de Umzug Unternehmensauflösungen Direkt Antiquitätentransporte Ihr Firmenumzug Gartenentsorgungen Wohnungsauflösungen
118 Igel Umzüge Berlin Umzugsfirma
13409
Berlin
Igel Umzüge Berlin. Die Umzugsfirma aus Berlin, verfügt über einen professionellen Umzugsservice. Für Umzüge jeder Art, ist...
igel-umzuege.de Umzüge Berlin Umzug Uns Besuchen Umzugsunternehmen Entsorgung Info@igel
119 Umzugsunternehmen Berlin Umzugsfirma
13409
Berlin
Wichtel Umzüge Berlin, ist ein professionelles Umzugsunternehmen in Berlin. Mit gutem Umzugsservie und freundlichen Umzugshelfern, steht Ihnen...
wichtel-umzuege.de Berlin Umzug Umzüge Umzugsunternehmen Umzugshelfer Umzugsfirma Umzugsanfrage Entrümpelung
120 Restaurierung am Oberbaum GmbH Resaurator
10997
Berlin
Die Kernbereiche der Tätigkeiten von RAO (Restaurierung am Oberbaum GmbH) liegen in der Denkmalpflege, der musealen und...
rao-berlin.de Restaurierung Restauratoren Englisch | Deutsch English Berlin Rao
121 Detektei AC Online Detektei
14057
Berlin
Wirtschaftsdetektei und Privatdetektei. Privatdetektive ermitteln Wir bietet Ihnen ein globales Netzwerk an unterschiedlichen Privatdetektei Organisationen. Wobei die Schwerpunkte...
detektei ac online
122 Essen und Trinken Restaurant
13585
Berlin
Das Restaurant „Spandau Diner“ mit amerikanischer, deutscher und vegetarischer Küche zieht durch sein vielfältiges Angebot viele...
spandau-diner.de Spandau Angebote Karte Burger Feiern Diner Mittagsangebot Events
123 Bowling Zubehör Bowling
13585
Berlin
Sie finden im Bowling Pro Shop nicht nur alle gängigen Artikel Bowlingkugeln oder vieles rund um...
bowling pro shop
124 Bowling Bowlingbahn
13585
Berlin
Die Bowlingbahn ist ein lebendiger und beliebter Treffpunkt für Freizeitsportler, Sportbowler, Senioren, Familien- und Freundesrunden, welche überzeugte...
bowlingarena-spandau.de Bowling Spandau Arena Ergebnisse Shop Bowlingbahn Anfahrt Weihnachtsfeier
125 Immobilien3 Immobilienmakler
12683
Berlin
Immobilien3 - Ihr Immobilienunternehmen für Marzahn - Hellersdorf, Biesdorf, Mahlsdorf, Kaulsdorf, Köpenick & Pankow. Sie möchten sich verändern...
immobilien3.de Berlin Immobilien Mahlsdorf Pankow Immobilie Hellersdorf Biesdorf Eigentümer
126 Smoke & Soul Band - Hochzeitsband Partyband
12045
Berlin
Wir bieten Ihnen die passende musikalische Umrahmung für Ihre Veranstaltung, ob Hochzeit, Party oder Firmenevent. Die Smoje &...
smokeandsoulband.de/ Band Live Berlin Hochzeitsband Partyband Soul Musik Professionelle
127 Franchiseverband Franchiseberatung
10117
Berlin
Der Deutsche Franchise-Verband e. V. (DFV) ist der Spitzenverband der deutschen Franchise-Wirtschaft. Der DFV wurde 1978 gegründet...
franchiseverband.com/ Franchise Verband Dfv Selbstständig Systemfinder Systemaufbau Mitglied Erfolgreicher
128 Sperrmüllabholung Berlin Haushaltsauflösung Entrümpelung
10117
Berlin
Sperrmüll Abholungen in Berlin Recycling Eildienst Sperrmüllabholungen Haushaltsauflösungen Service....
lumk.de/ Lumk Berlin Sperrmüll Sperrmüllabholung Entrümpelungen Pauschal Holz Recycling
129 Ganzjahresreifen Testsieger Auto
13086
Berlin
Auf dieser Seite stellen wir euch Ganzjahresreifen vor. Weiterhin werden die aktuellen Testsieger von Stiftung Warentest und...
ganzjahresreifen-testsieger.de/ Ganzjahresreifen Test Reifen Kumho Doch Stiftung Tests Goodyear
130 Ergotherapeutische Praxis für Entwicklungsförderung Johanna Kalarus Ergotherapie
13187
Berlin
In der Praxis werden Kinder und Jugendliche ganzheitlich behandelt und somit in ihrer Entwicklung unterstützt und gefördert....
ergotherapie-kalarus.de Kalarus Praxis Johanna Ergotherapeutische Ergotherapie Pankowkindern Ausgebildet Fachergotherapeutin
131 Physiofit-Praxis für Physiotherapie und myofasziale Schmerztherapie Physiotherapie Gesundheitswesen
14167
Berlin
Seit über 13 Jahren besteht die Praxis Physiofit in den Räumen einer Stadtvilla im Süden Zehlendorfs. Schwerpunkt dieser...
physiofit-berlin.de Schmerzen Chronische Praxis Physiotherapie Berlin Hilfe Akute Selbsthilfe
132 HELJO INDUSTRIES Wartungsservice
10961
Berlin
INDUSTRIELLE INSPEKTIONEN MIT DROHNEN Präzise & Hocheffektiv HELJO INDUSTRIES ist eine Inspektionsfirma, die sich auf den Einsatz von moderner...
heljo.industries/ Z Y
133 time2cross AG Online-Agentur
10365
Berlin
Wir sind einer Internetagentur mit umfangreichem Leistungsangebot rund um das Internet. Dies umfasst insbesondere Webentwicklung, Webdesign, Online...
time2cross.de/ Marketing Content Social Media Onlineshops Module Leistungen Design
134 Spree Gerüstbau GmbH Gerüstbau
12277
Berlin
Ihr perfekter Partner für den Gerüstbau sind wir von der Spreegerüstbau GmbH. Seit November 2006 sind wir...
spreegeruestbau.de/standorte/berlin/ Berlin Gerüstbau Spree Luckau Mail Gerüste Standorte Denn
135 Kfz- Sachverständiger Kfz- Sachverständiger
13599
Berlin
Für mich steht an erster Stelle, den gesamten Schadensumfang für den Geschädigten genau festzustellen und Ihn bei der...
kfz-unfall-gutachten-berlin.de Gutachten Kfz Berlin | Regulierung Prüfungen Unfall Direkt
136 Voslamber Praxis für Kieferorthopädie Kieferorthopäde
10717
Berlin
Die Kieferorthopädin, Dr. Christine Voslamber, bietet in Ihrer Praxis u. a. die Behandlung von Zahn- und Kieferfehlstellungen...
kieferorthopaede-in-berlin.de/ Invisalign Voslamber Berlin Behandlung Teen Kieferorthopädie Christine Kieferorthopäde
137 Lohndata Gehaltsabrechnung
10787
Berlin
Lohndata ist seit 1981 spezialisierter Dienstleister für das Outsourcing der Lohnabrechnung im Vollservice. Unser Lohnbüro im Herzen...
lohndata.de Navigation Lohndata Lohn Unternehmen Lohnbüro überspringen Gehaltsabrechnung Lösung
138 Schlüsseldienst Marzahn Schlüsseldienst
12679
Berlin
Sofortige Hilfe bei zugezogener Tür bietet der Schlüsseldienst Marzahn an. 24Std. Service- Rund um die Uhr sind...
schluesseldienst-marzahn-24std.de Schlüsseldienst Marzahn Berlin Schloss Türen Türöffnungen Montagen Schlüsselnotdienst
139 Haushaltsauflösung Berlin Reinickendorf Haus Wohnung
10715
Berlin
Haushaltsauflösung Berlin Reinickendorf Sperrmüllservice Eildienst Auflösungen von Keller Wohnung sofort Recycling Dienst....
berlin-eildienst.bplaced.net/ Haushaltsauflösung Berlin Reinickendorf Sperrmüll Pauschal Dienst Entrümpelung Entrümpelungsdienst
140 Haushaltsauflösung Berlin Reinickendorf Haus Garten
10715
Berlin
Haushaltsauflösung Berlin Reinickendorf Sperrmüllabholungen Eildienst Pauschal Service Wohnung Keller Entrümpelungen....
berlin-eildienst.bplaced.net/ Haushaltsauflösung Berlin Reinickendorf Dienst Entrümpelung Pauschal Sperrmüll Hotline
141 Fotostudio Uhlandpassage Heinz-Werner Schawe Fotograf
10719
Berlin
Wir begrüßen Sie im Fotostudio vom Photograph Hans-Werner Schawe - hier bekommen Sie professionelle Bewerbungsfotos und Businessfotos...
fotograf-charlottenburg-wilmersdorf.de Berlin Charlottenburg Fotostudio Fotograf Bewerbungsfotos Wilmersdorf Businessfotos Uhlandpassage
142 Ganzjahresfeuerwerksladen Pyro Thron GmbH in Berlin Feuerwerk
12555
Berlin
1. und einziger Ganzjahresfeuerwerksladen Deutschland Pyro Thron GmbH Bahnhofstrasse 05 12555 Berlin Köpenick. Hier erhält man alles was...
pyrothron.com/ Artikel Jorge Feuerwerk Schuss Solas Abreißzünder Handlichtfackel Weiß
143 Silent Disco Kopfhörer Events
12055
Berlin
Silent Disco Kopfhörer party ALLES, WAS IHR BRAUCHT, UM EINE SILENT DISCO DURCHZUFÜHREN Silent Disco Berlin Vermietet und Verkauft...
silentdiscotheque.com/ Disco Silent Kopfhörer Kaufen Musik Sender Party Mieten
144 Rechtsanwalt Berlin anwalt-artiisik.de Rechtsanwälte
10551
Berlin
Die Kanzlei Anwalt-Artiisik.de mit Sitz in Berlin-Tiergarten (Moabit) betreut schwerpunktmäßig Mandanten im Bereich Verkehrsrecht, Verkehrsstrafrecht und Allgemeines...
anwalt-artiisik.de Verkehrsrecht Berlin Kanzlei Rechtsanwalt Strafrecht Bußgeld Steuer Ersteinschätzung
145 Film und Serien Produktionsstudio Medienproduktion
14167
Berlin
Hallo und Herzlich Willkommen bei Jerome Fisher Film und Serien Produktion , Wir sind ein...
jerome-fisher-filmstudio.de Z Y
146 FARAWAYHOME - Wohnen auf Zeit Wohnen Auf
10439
Berlin
#1 für möblierte Wohnungen & Serviced Apartments in Berlin. Mieten Sie eine von über 1.300 ausgewählten und...
farawayhome.de Apartments Log Berlin Verified Temporary Farawayhomede Living Offer
147 Mixer Tests Shop
10117
Berlin
In unserem Laden bekommen Sie eine intensive Beratung zum Thema Mixgeräte. Unter anderem gibt es bei uns...
mixertests.com Mixer Shop Leistung _ Verarbeitung Handhabung Preis _amazon_ Tests Verarbeitung _ Zubehör Stromverbrauch Bedienung _amazon_ Funktion Verarbeitung Geräte
148 Dr. med. Henning Frhr. v. Gregory Chirurgie
10719
Berlin
Praxis für Plastische, Ästhetische und Rekonstruktive Nasen- und Gesichtschirurgie...
drvongregory.de/ Op Berlin Gregory Notice Undefined Chirurgie Henning Plastische
149 Ing. Meinhard Böhm Sachverständiger für Holzschutz Sachverständiger Holzschutz
15834
Rangsdorf bei Berlin
Wir untersuchen als Sachverständige für Holzschutz, Holztechnik und Schimmelpilzbewertung Holzkonstruktionen, Dachstühle und Holzbalkendecken und erstellen Holzschutzgutachten. Dei...
holzingenieur-boehm.de Holzgutachter Berlin Holzschutzgutachten Holzschutz Anhalt Brandenburg Holzschutzsachverständiger Sachsen
150 Hör Autoankauf Berlin24
13057
Berlin
Seit nun mehr als 25 Jahren ist unser Unternehmen im Bereich Gebrauchtwagen Ankauf tätig. Wir sind bundesweit...
autoankaufberlin24.de/ Berlin Ankauf Autoankauf Autoentsorgung Autoexport Unfallwagen Auto Lkw
151 Stadtführungen in Berlin Stadtführer
10587
Berlin
Stadtführer für standardisierte oder individuelle Stadtführungen, Stadtrundfahrten und Stadtrundgänge in Berlin Stadtführungen bereits ab zwei Personen! Ideal...
tourguideme-berlin.com Berlin Stadtführung Tour Stadtführer Stunden Ihrem Gruppen Sehenswürdigkeiten
152 Ganzjahresfeuerwerksladen Pyro Thron GmbH in Berlin Feuerwerk Pyrotechnik
12555
Berlin
Ganzjahresfeuerwerksladen Pyro Thron GmbH in Berlin – Köpenick Bahnhofstrasse 05 12555 Berlin PyroThron GmbH hat sich auf den...
pyrothron.com/ Artikel Feuerwerk Abreißzünder Jorge Solas Handlichtfackel Bengal Berlin
153 Hypnose Berlin Hypnose
10117
Berlin
Hypnose | Hypnocoaching: Gewichtsreduktion, Raucherentwöhnung, Lampenfieber, Sporthypnose, Liebeskummer, Flugangsthypnose, Entspannung....
coaching-place.de Hypnose Raucherentwöhnung Schlafen Sporthypnose Besser Entspannung Gewichtsreduktion Selbstvertrauen
154 Schlüsseldienst Marzahn Schlüsseldienst
12679
Berlin
Schlüsseldienst Marzahn - der Ansprechpartner für Notöffnungen zu jeder Tageszeit. Wir sind 24 Stunden an 365 Tagen...
schluesseldienst-marzahn-24std.de Marzahn Schlüsseldienst Berlin Schloss Türöffnungen Türen Wartungen Montagen
155 IMMOFIX Berlin - Immobilienmakler Immobilienmakler
10961
Berlin
IMMOFIX Berlin ihr Immobilienmakler für Exclusive Immobilien in Berlin & Brandenburg - überzeugen Sie sich von unserem...
immofix.berlin Berlin Einfamilienhaus Eigentumswohnung Verkaufen Immofix Brandenburg Immobilie Immobilienmakler
156 Wedding Planer Veranstaltungsservice
13357
Berlin
Wir bieten ihnen einen Komplett Service für ihre Veranstaltungen an. Ob vom kleinen Geburtstag bis hin zur Großen...
promore-event.com Webseite Technischen Störung Zurzeit Nichterreichbar   ____               links Nichterreichbar Unser Aufgrundstartseite *
157 Dachdecker Berlin Dachdecker
10969
Berlin
Ewald Rohde Bedachungs GmbH führender Anbieter in Berlin und Falkensee. Das Unternehmen Dachdecker Berlin Ewald Rohde hat jahrelange...
dachdecker-dachklempner.de Dachdecker Rohde Angebot Sanierung Betrieb Dachklempner Dächer Dachsanierung
158 IMMOFIX Berlin - Immobilienmakler Immobilienmakler
10961
Berlin
IMMOFIX Berlin ihr Immobilienmakler für Exclusive Immobilien in Berlin & Brandenburg - überzeugen Sie sich von unserem...
immofix.berlin Berlin Einfamilienhaus Immobilien Kaufen Immobilienmakler Brandenburg Immofix Ihr
159 Nolten - Die Studien- und Berufsberater Beratung
10623
Berlin
Studienberatung und Berufsberatung in Berlin Nolten - Die Studien- und Berufsberater bieten individuelle und professionelle Beratung für Personen...
nolten.de Berufsbild Berufsbilder Master Gallery Permalink Aktivitäten Wahl Ausland
160 WGBG Hausverwaltung Berlin Hausverwaltung
10715
Berlin
Ihre Hausverwaltung aus Berlin Einer starke Genossenschaft für die Entwicklung Ihrer Immobilien Unter dem Motto: Erfahrung, Wissen und Visionen...
wgbg.de Wgbg Hausverwaltung Sachbearbeitung Berlin Genossenschaft Vorstand Berliner Wirtschafts
161 Interviewer in verschiedenen Sprachen gesucht Marktforschung
10789
Berlin
Sie sprechen deutsch oder türkisch oder russisch oder polnisch? Dann melden Sie sich bei uns. Für unsere laufenden...
data4u-online.de Deutschland Migranten Türkische Deutsch Türken Türkischen Integriert Gut
162 Hunde & Katzensalon BLACK & WHITE Hundesalon Katzensalon
12555
Berlin
Hier wird wirklich noch professionell von Hand getrimmt! Das althandwerkliche Know-how macht aus jedem Vierbeiner wieder...
hund-e.de/ Black Hundesalon Dogs Coiffeur White Berlin Professionelle Köpenick
163 Bali Reisen Reisen
12683
Berlin
Bali Reisen zuverlässig buchen über Albatros. Das Experten - Team berät Sie ausführlich und erstellt die Urlaubsplanung....
balispezi.de Bali Resort Nächte Beach Tage € Ab Urlaub
164 Schütthaar im Test Kosmetik

Berlin
Streuhaar / Schütthaar - ein Mehrwert schaffendes Produkt - leider noch wenig bekannt in Deutschland. Wenn Sie unter...
165 Haarausfall stoppen Gesundheit
10115
Berlin
Arten, Ursachen, Mittel und Erfahrungen mit Haarausfall kombiniert mit Experteninterviews mit den besten deutschen Haarmedizinern. Dieser Blog...
haarausfallen.de Haarausfall Erfahren Tun Erfahrungen Haare Deine Gesunde Nährstoffe
166 Gebrauchte Fahrräder in Berlin Fahrradladen
10967
Berlin
Wir haben ständig mehr als 100 gebrauchte Fahrräder im Angebot in unserem Fahrradladen in Berlin Kreuzberg. Unsere...
gebrauchtfahrradberlin.de Fahrräder Fahrrad Fahrradladen Gebrauchte Mobilcenter Berlin Fahrradfahren Thailand
167 Klempner Berlin Klempner
13357
Berlin
Klempner Berlin Notdienst - Rohrbruch, Wasserschaden, Verstopfung. Beseitigung jeglicher Verstopfung. Beseitigung und Trocknung von Wasserschäden, Abflussreinigung, Rohrreinigung...
klempner-berlin-24.de Klempner Verstopfung Bezirke Berlin Rohrbruch Notdienst Rohrreinigung
168 Schweisser Berlin Schweisser
12167
Berlin
Wir schweissen für Industrie, Gastronomie aber auch kleine Sachen im privaten Haushalt. Auch gerne kommen wir in...
schweisser-berlin.de • Berlin Schnell Edelstahlverarbeitung Schweissen Handwerksdienstleistungen Mobiles Geräte
169 AgenturWebfox GmbH Internet Typo3
10587
Berlin
AgenturWebfox ist Ihr Partner für die Realisierung von neuen Webseiten un Optimierung bestehender Internetpräsenzen. Als Full-Service Agentur...
webfox01.de Marketing Design Agentur Typo Konzeption Strategie Berlin Entwicklung
170 Freiberuflich Ihr Leiterplattenlayout mit Altium Designer Leiterplattendesign
10555
Berlin
Freiberufliche Unterstützung für Ihre Leiterplattenentwicklung: mit einer aktuellen Altium Designer Lizenz, eigener PC Ausrüstung und Fachwissen. EMV gerechte...
4pcb.de/ Altium Designer Leiterplatten Leiterplattendesign Erstellung Pcb Layout Dienstleistung
171 Kreditangebot kostenlos in 72h Service
1227
Berlin
Kreditangebot kostenlos in 72h   ein Banker von Beruf und arbeitet derzeit im Bereich der Makro- und Mikrokredite, habe...
172 Marens Ratgeber E-Bookshop
13189
Berlin
Ratgeber E-Books für die verschiedensten Probleme des täglichen Lebens. Ratgeber rund ums Geld verdienen im Internet, Ratgeber für...
hilf-dir-selbst.berlin Ebooks Geld Ratgeber Ebook Artikel Marens Download Flirt
173 Besuche meinen Shop und kaufe Preiswert OnlieneShop
12169
Berlin
Besuche meinen Shop und kaufe Preiswert ein Preisvergleiche mit über 3 Millionen Produkten Zehntausende von Marken von Tausenden marktführender...
neumie.buyezee.net/visit-my-shop Fragen Häufig Gestellte Registrierung Packages Marktplatz Marken Uns
174 Black Label Properties Ltd. - Berlin Immobilienmakler
10587
Berlin
Immobilien in Berlin verkaufen oder vermieten. Wir vermitteln als einer der führenden Immobilienmakler für Berlin Wohnungen, Häuser...
blacklabelimmobilien.com/ Berlin Immobilienmakler Immobilie Immobilien Kauf Label Black Vermittlung
175 Praxis für Ergotherapie Paul Tomaszewski Ergotherapie
13585
Berlin
in zentraler Lage in Altstadtnähe in Berlin - Spandau, mit günstiger Verkehrsanbindung S – U – Bahn...
ergotherapie-in-spandau.de/ Praxis Therapien Paul Anfahrt Spandau Ergotherapie Tomaszewski Kontakt
176 FairPlay SEO Berlin SEO Agentur
10179
Berlin
FairPlay SEO Berlin berät Firmen und Freiberufler in allen Fragen des Onlinemarketings. Wir erstellen und optimieren Ihre...
fairplayseo.de Adwords Seo Berlin Local Fairplay Agentur Optimierung Google
177 lohnzettel-berlin.de - Rechtsberater für Ihr Arbeitsleben Rechtsberatung
12359
Berlin
Lohnzettel-Berlin ist der Berater für ihr Arbeitsleben. Erfahrene und auf das Arbeitsrecht spezialisierte Rechtsanwälte von goadvo.de beraten...
lohnzettel-berlin.de/ Lohnzettel Berlinde Mail Rechtsberater Arbeitsleben Berlin Verantwortlicher Diensteanbieter
178 Diplom- Kaufmann Meir Samuelsdorff stattlich geprüfter

12049 Berlin
Dolmetscher und Übersetzer Hebräisch- Deutsch Berlin...
dolmetscherhebraeisch.berlin/ Hebräisch Ivrit Dolmetscher Berlin Map Sitesgoogle Z
179 Immobilien-jobs.de Immobilien
10117
Berlin
immobilien-jobs.de ist eine branchenspezifische Stellenbörse für die Immobilienwirtschaft. Unsere aktuellen Job-Anzeigen beinhalten zum einen Fach- und Führungspositionen...
immobilien-jobs.de Warenkorb Tage Mwst Eur Jobs Immobilienmakler Stellenausschreibungen Blog
180 TopAsset Immobilien & Service GmbH Immobilienmakler
13597
Berlin
TopAsset Immobilien & Service GmbH ist ein seriöser Immobilienmakler mit Sitz in Berlin Spandau. Wir beschäftigen uns...
topasset-immo.berlin/ Immobilie Immobilien Berlin Verkauf Hohen Hausverkauf Neuendorf Parzelle
181 Webentwicklung | Webdesign | Code for Webentwicklung Webdesign
10963
Berlin
TenMedia ist seit 2011 auf die Webentwicklung in Berlin und das Betreiben von Webportalen spezialisiert. Dabei nutzen...
tenmedia.de Z Y
182 Arbeitsbühne oder Steiger mieten in Berlin Arbeitsbühnenvermietung
10409
Berlin
Willkommen bei PaDoRent Arbeitsbühnenvermietung! Wenn Sie eine Hebebühne, Arbeitsbühne oder einen Holzhäcksler in und um Berlin mieten wollen...
padorent.de Arbeitsbühnen Lkw Mieten Holzhäcksler Anhänger Arbeitsbühne Arbeitsbühnenvermietung Scheren
183 Werkzeugkoffer Informationen Handwerk
13439
Berlin
Testberichte und News über werkzeugkoffer für Profis oder Heimwerker. Verschiedene Testberichte und Erfahrungsberichte über einige Werkzeugkoffer. Pflege hinweise und...
werkzeugkofferkaufen.de Werkzeugkoffer Produktbeschreibung Rsaquo Mwst Mannesmann Proxxon Tlg Koffer
184 NICE Network for InterCultural Experiences Auslandspraktikum
10119
Berlin
NICE (Network for Intercultural Experiences) ist eine deutsch-argentinische Stiftung zur Förderung des internationalen Bildungs- und Kulturaustausches mit...
nice-network.org/de Argentinien Nice Erfahren Südamerika Auslandspraktikum Spanisch Freiwilligenarbeit Erlebe
185 NICE – Network for InterCultural Experiences Auslandspraktikum Spranischkurse
10119
Berlin
NICE (Network for Intercultural Experiences) ist eine deutsch-argentinische Stiftung zur Förderung des internationalen Bildungs- und Kulturaustausches mit...
nice-network.org/de Argentinien Nice Südamerika Spanisch Auslandspraktikum Praktikum Erfahren Spanischkurse
186 Elvis Stimmen-Imitator Berlin Elvis Stimmen-Imitator Berlin Musik

Berlin
Events in Berlin und Brandenburg, mit Elvis Presley Interpret Philipp Eberth, buchen können Sie mich...
philipp-eberth.jimdo.com/ Elvis Presley Eberth Zeit Berlin Imitator*** Show Imitator
187 Was sagt mein Sternzeichen eigentlich über Religion
10707
Berlin
Das Sternzeichen und der Aszendent sagen viel über die Persönlichkeit eines Menschen aus. Erfahren Sie jetzt mehr...
horoskopmekka.de/ Z Y
188 ExoSnacks - exotische Lebensmittel Online-Handel
12355
Berlin
ExoSnacks bietet Insekten zum menschlichen Verzehr (gefriergetrocknet) mit Rezeptvorschlägen und eine Auswahl an Superfood an. Insekten sind als...
exosnacks.de Insekten Salz Sonstiges Rezepte Grillen Heuschrecken Gewürze Mehlwürmer
189 Berwerbungscoaching Traumberuf finden Coaching
12107
Berlin
Sie möchten eine erfolgreiche Bewerbung verschicken und wissen nicht wie? Sie haben ein Vorstellungsgespräch vereibart und Sie...
beaterudolph.de Beruf Jobcoaching Lukas Leidenschaft Deinen Berufswahl Coaching Rudolph
190 JENS RICHARD GmbH Lifestyle
10707
Kurfürstendamm
Entdecken Sie bei uns auf dem Kurfürstendamm in Berlin oder in unserem Onlineshop schöne und exklusive Dinge...
jensrichard.de/ Berlin Jens Richard Jensen Geschenke Georg Hering Schmuck
191 Auto Ankauf Berlin Autoankauf
13409
Berlin
Wir sind der Partner wenn es um Ihr Fahrzeug geht. Für einen guten Ankauf Ihres Wagen bzw....
auto-ankauf-reinhold.berlin Berlin Auto Ankauf Verkauf Gebrauchtwagenhändler Angaben Reinhold Std
192 Trinkwasser-Systemerhaltung Trinkwassertechnik
12459
Berlin
Unser Unternehmen ist spezialisiert im Bereich der: - dauerhafte Systemerhaltung - Beseitigung von Biofilm, Korrosion und Ablagerungen - dauerhafter Schutz...
c-a-c.info Desinfektion Trinkwasser Reinigung Rohrinnenwänden Legionellen Minimierung Verhinderung Systemreinigung
193 Besuche meinen Shop und kaufe Preiswert Baby &
12169
Berlin
Baby & Kindergarten, Cmputer und Software, Haus und Möbel, Schuhe und Schuwerk, Lokale Angebote, Auto und Motorad...
neumie.buyezee.net/visit-my-shop Packages Fragen Gestellte Häufig Registrierung Marktplatz Shop Opportunity
194 Pumpenhandel und Service Pumpen und
13403
Berlin
Das Sortiment von Pumpenhandel und Service umfasst Pumpen jeden Formats und Anspruchs, ob die kleine Tauchpumpe oder...
pumpenhandel-service.de Versandkosten Zehnder Hebeanlagen Zubehör Pumpen Mein Drain Gartenpumpen
195 Trendio Fashion
10437
Berlin
Trendio - die besten Fashion Angebote in einer Übersicht. Ausgewählte Mode aus angesagten Online Shops zu guten...
trendio.eu Shirts Herrenausstatterde Boozt Fashion Sweater Jeans Anzüge Hosen
196 fashion davaa Mode Fashion

Berlin
Elegant, zeitlos, great! for every one!...
fashion davaa.de
197 Fach- und Rechtsanwältin Gabriele Brandenburg Rechtsanwälte
12161
Berlin
Die hochspezialisierte Anwaltskanzlei von Rechtsanwältin Gabriele Brandenburg mit Sitz in Berlin Friedenau-Steglitz hift Ihnen bei Problemen im...
rabrandenburg.de Sozialrecht Gesellschaftsrecht Arbeitsrecht Rechtsgebiete Steuerrecht Unfallrecht Rechtsanwalt Steglitz
198 AB-Detective Condor GmbH Detektei
13089
Berlin
Die AB-Detective Condor GmbH ist Ihr kompetenter Partner bei der Erbringung von Beweisen. Als seriöse, diskrete und...
detectivecondor.de/staedte/detektiv-in-berlin-im-einsatz.htm Detektei Berlin Detektive Condor Detekteien Ermittlungen Einsatz Jahrzehnten
199 Alarmanlagen Video-Türsprechsysteme Sicherheitstechnik
13509
Berlin
Sicherheitstechnik für privat und Geschäft. Funkalarmanlage Neostar, 2-Wege Technologie, Sicherheit ohne Kabelverlegung, bis zu 10% förderfähig, Video...
security-cctv-systeme.de Mein Video Neostar Shop Funk Full Alarmanlage Ip
200 Rohrreinigung Berlin Absolut Rohrreinigung Kanalreinigung
13359
Berlin
Firma Absolut Rohrreinigung Berlin ein Unternehmen mit jahrelanger Erfahrung in Branchen: Rohrreinigung, Kanalreinigung, Abflussreinigung so wie TV...
rohrreinigung-absolut.berlin/ Berlin Rohrreinigung Kanalreinigung Abflussreinigung Sanitär Rohruntersuchung Uns Renovierungen
201 A Plus Detective GmbH Detektei
13509
Berlin
Die A Plus Detective GmbH ist Ihr kompetenter Partner bei der Erbringung von Beweisen. Als seriöse, diskrete...
detektei-aplus.de/dependancen/detektei-berlin.htm Berlin Detektei Detektive Plus Detektiv Firma Einsatzort Wirtschaftsdetektei
202 Trauerrednerin Cornelia Gennrich Trauerrede
12247
Berlin
trauerrede-berlin.de/ Gennrich Trauerrednerin Trauerrede Trauerfeier Angehörigen Menschen Berlin Dolmetscherin
203 Snorflex® Die innovative Schnarchschiene Schnarchen
12587
Berlin
Die Produkte von Snorflex über Schnarchspange, Schnarchschiene bis zur Biblock-Orthese wurden von Spezialisten aus der Schlafforschung, HNO...
snorflex.de/ Schnarchen Snorflex® Snorflex Bestellen Hilfe Schnarchschiene übergewicht Dazu
204 Sensamax Natürliches Potenzmittel
10117
Berlin
Sensamax ist ein natürliches Potenzmittel, das rezeptfrei erhältlich ist. Es bekämpft erektile Dysfunktion, frühzeitigen Samenerguss und sonstige...
sensamax.de/ Sensamax Kaufen Erektionsstörungen Zusatzstoffe Einkaufswagen Produkte Kundenbereich Dysfunktion
205 ASLAN Ambulanter Pflegedienst GmbH Ambulanter Pflegedienst
12053
Berlin
ASLAN ambulanter Pflegedienst ist ein interkultureller Pflegedienst im Herzen von Berlin Neukölln. Wir bieten Pflege in deutscher und...
aslan-pflege.de Pflegedienst Aslan Leistungen Pflege Stellenangebote Ambulanter Pflegeleistungen Interkulturelle
206 Lida-Shop Gesundheit
13629
Berlin
Wie man Gewicht verlieren mit Diät mit Müsli Wenn Sie ein bestimmtes Produkt erwerben positive Aura, die Menschen...
lida-shop.org/ Lida Kapseln Konto Kaufen Warenkorb Deutschland Abmagerung Wunschzettel
207 TURBO-LIDA Diat
13629
Berlin
Diät für die faulen.Teil 1. Die schwachen in letzter Zeit möchten viele von uns, vor allem nach den...
turbo-lida.com/ Lida Extra Stark Formel Kapseln Alt Kaufen St
208 ShowAgenten Entertainment GmbH Eventagentur
13505
Berlin
Suchen Sie eine Eventagentur in Berlin? Mit jahrelanger Erfahrung in verschiedenen Bereichen? Dann sind sie bei uns richtig!...
showagenten.de/ Berlin Eventagentur Showagenten Bond Party Bands Events Show
209 Trauerrede Berlin Trauerrede
12247
Berlin
Wenn wir einen nahestehenden Menschen verlieren, wird unser Lebensfundament erschüttert. Als Trauerrednerin in Berlin helfe ich trauernden...
trauerrede-berlin.de/ Trauerrede Gennrich Cornelia Trauerfeier Dolmetscherin Trauerrednerin Angehörigen Menschen
210 Dipl.-Theol. Ferdinand Krieg, Berlin: Eheberatung, Paarberatung. Dipl.-Theol. Ferdinand Krieg, Berlin: Eheberatung, Paarberatung. Eheberatung Paartherapie
10437
Berlin
Dipl.-Theol. Ferdinand Krieg. Heilpraktiker beschränkt auf das Gebiet der Psychotherapie. Systemische Paartherapie (Paarberatung, Eheberatung). Ich bin Diplom-Theologe und...
einzelundpaartherapie.de Paartherapie Berlin Paarberatung Ferdinand Krieg Systemische Dipl Theol
211 Barthlomeyczik - Heizung & Bäder GmbH Heizung &
12099
Berlin
Die Firma Barthlomeyczik Heizungen und Bäder mit Haupt-Sitz in Berlin arbeitet seit 1991 erfolgreich bezüglich Montage, Wartung...
online-heizungen.de Heizung Wärmepumpe Brennwertkessel Gasheizung ölheizung Weishaupt Viessmann Buderus
212 Schlüsseldienst Berlin - Schlüsselnotdienst Schlüsseldienst
12619
Berlin
Ausgesperrt bei Nacht? Der schnelle Dienstleister Schlüsseldienst Berlin König öffnet Ihre Türen und Fenster. Geschultes Personal...
schluesseldienst-koenig.com Schlüsseldienst Berlin Kunden Team König Minuten Schlüssel Schlösser
213 Kuvertiermaschinen Lettershop Postbearbeitung Postbearbeitung
10623
Berlin
Frankonia aus Berlin Als kundenorientiertes Unternehmen bieten wir Lösungen und Optimierungsansätze für den gesamten Büro- und Poststellen-Bereich. Eine...
frankonia24.de Kuvertiermaschinen Frankiermaschinen | Falzmaschinen Direktadressierer Postaufkommen Elektrostempel Postbearbeitungssystemelettershop
214 Laptop und Apple MacBook Reparatur Service Computer-Service
10997
Berlin
Wir bieten Computerreparaturen, um genau zu sein, Laptop und Apple MacBook Reparaturen an. Die Diagnose ist kostenlos. In der...
notebookservice030.de Reparatur Laptop Macbook Apple Notebook Display Agb Pc
215 Socialcore Online-Marketing
12159
Berlin
Socialcore ist eine inhabergeführte Agentur für Content und Suchmaschinenmarketing mit Sitz in Berlin. Das Leistungsspektrum der Agentur...
socialcore.de/ Suchmaschinenoptimierung Marketing Content Google Socialcore Suchmaschinenwerbung Media Management
216 amh Absturzsicherungen Bau
14089
Berlin
Die Amh Flachdach-Sicherungs GmbH ist Spezialist für Flachdach- Absturzsicherungen. Das Unternehmen ging hervor aus der 1978 gegründeten...
amh-berlin.de/ Absturzsicherungen Berlin Fassaden Zertifizierung Amh Sicherheit Seilsicherungssystem Kollektivschutz
217 1A Versicherungsvergleich Versicherung
13086
Berlin
Bei uns können Sie sich über sämtliche Versicherungen und Policen informieren. Wir stellen für Sie neue News...
1aversicherungsvergleich.de/ Versicherungsvergleich Vergleichen En Angeboten Uns Besten Jeder Menu
218 Satinanda (Vihara) Buddhismus Berlin
12681
Berlin
Unsere Veranstaltungen und Angebote: Bitte rufen Sie bei Interesse zur Teilnahme an. • ...
satinanda.de Satinanda Lehrreden Nikaya Veranstaltungen Forum Meditation Dhamma Vortrag
219 Modelagentur Berlin Modelagentur Messehostess
10585
Berlin
Als Modelagentur Berlin vermitteln wir Models in und aus Berlin für Fotoshootings, Laufstegshows oder Media-Werbung. Zudem sind...
modelagentur-berlin.org Modelagentur Model Berlin Messehostessen Models Promotion Dresden Hostess
220 transparent-beraten.de Maklerservice UG (Versicherungsmakler Berlin) Versicherungsmakler
10961
Berlin
Wir sind ein junges und aufstrebendes Unternehmen mitten aus dem Herzen von Berlin. Gegründet wurde die transparent-beraten.de...
transparent-beraten.de/ Versicherungen Krankenshyversicherung Versicherung Betriebliche Transparent Rente Riester ✔
221 HilfedurchHypnose.Berlin Katrin Bätz Heilpraktikerin Für
10437
Berlin
Als Heilpraktikerin für Psychotherapie arbeite ich vorwiegend mit Hypnose. Was ist Hypnose? Hypnose ist ein Trancezustand. Hypnose ermöglicht...
hilfedurchhypnose.berlin Hypnose • Preise Berufliches Lebensentwurfsberatung Leistungssteigerung Hypnoreisen Seiten
222 Kosmetik Berlin Kosmetik
10719
Berlin
Kosmetik Studio in Berlin gesucht? Dann kommen Sie zu Kosmetik Berlin Luxury Beauty. Unsere erfahrenen Mitarbeiter haben...
luxury-beauty-berlin.de Berlin Permanent Kosmetik Augenbrauen Haut Mikrodermabrasion Kosmetikerin Kosmetikstudio
223 Wissenschaftscoaching Wissenschaftscoaching Wissenschaftsberatung

Berlin
DD|Coaching bietet kompetente Hilfe bei allen Fragen rund um wissenschaftliches Arbeiten für Studenten/Studentinnen und Schülerinnen/Schüler. Ich betreue...
dd-coaching.de Wissenschaftsberatung Arbeiten Coaching Studierende Schule Verständnis Leistungen Studiums
224 Dr. Martin Müller Steuerberater Steuerberater
10117
Berlin
Das Konzept was Du erhältst unterscheidet sich im Wesentlichen darin, dass es dir eine Schritt für Schritt...
startupandgrow.de Immobilien Steuen Kosten Aufzubauen Urteil Widerrufsbelehrung Teil Startupandgrowde
225 Acupuncturcentrum Japanische Akupunktur
10117
Berlin-Mitte
Elisabeth Vos Tel.: 28 38 43 68 Heilpraktikerin seit 1990. In eigener Praxis tätig mit den Schwerpunkten:...
akupunktur-berlin-vos.de Berlin Akupunktur Medizin Vos Elisabeth Chinesische Akupunkturzentrum Mitte
226 Acupuncturcentrum Akupunktur
10117
Berlin
Elisabeth Vos Tel.: 28 38 43 68 Heilpraktikerin seit 1990. In eigener Praxis tätig mit den Schwerpunkten:...
akupunktur-berlin-vos.de Berlin Akupunktur Medizin Vos Elisabeth Chinesische Akupunkturzentrum Pflanzenheilkunde
227 ONLINE WOHNBERATUNG Innenarchitektur
10719
Berlin
ONLINE WOHNBERATUNG Brauchen Sie mehr Stauraum, eine neue Farbe oder einen anderen Stil? Die Online Wohnberatung bietet...
die-raumgestalten.de Berlin Wohnberatung Einrichtungsberatung Projekte Innenarchitektin Onlineberatung Philosophie Kompetenzen
228 Betriebshaftpflichts Vergleiche Versicherung
13086
Berlin
Wir stellen aktuelle Anbieter und Tarife der Betriebshaftpflichtversicherungen vor. Durch die Vergleiche und Testergebnisse können schnell Vergleichstestsieger...
betriebshaftpflichts-vergleiche.de/ Internetpräsenz Entstehtz
229 NotebookService030 Computer-Service
10997
Berlin
Wir sind eine schnelles und zuverlässiges Team in Berlin-Kreuzberg. Wir reparieren Notebooks, Apple Macs und PCs. Folgende Dienstleistungen...
notebookservice030.de Reparatur Notebook Laptop Macbook Apple Berlin Display Ladebuchse
230 Chauvin ankerpharm GmbH Pharmacy
13581
Berlin
Chauvin ankerpharm GmbH ist eine billige Online-Apotheke. Die Apotheke liefert innerhalb Deutschland. Billig rezeptfrei Medikamente kaufen geht...
ankerpharm.de Migrane Kopfschmerzen Muskel Gelenkschmerz Menstruationsschmerzen Schmerzen Antibiotika Nervenschmerzen
231 Welches Fahrrad kaufen Shop
13086
Berlin
Auf dieser Seite können sich alle über die verschiedenen Modelle von Fahrrädern und Anbietern informieren. Wir geben...
welches-fahrrad-kaufen.de/ Fahrrad Kaufen News Rund En Dieser Bringen Copyright
232 comefashion.de Damenmode Online
13156
Berlin
Wir bitten Damenmode online. Bei uns kannst du ganz entspannt von zu Hause aus shoppen. Keine Öffnungszeiten...
comefashion.de Fillup Kleid New + Kategorie Versandkosten Blog Kleider
233 Ekstase Massagesalon Berlin Ekstase-Massage
10249
Berlin
lass Dich durch unser Massageangebot in die Welt der sinnlichen Erotik entführen! Wie heißt es so schön:...
ekstase-massage.de Massage Berlin Erotische Spätschicht Team Ekstase Massagen Frühschicht
234 Luftballonladen Luftballons Und
12163
Berlin
Wir lieben Luftballons ! Phoenixballons.de ist Ihr Spezialist für Ballondekorationen, Ballongas, und Luftballons. Fehlt...
phoenixballons.de Ballons Antworten Helium Mär Retweeten Berlin Geburtstag Favorisieren
235 foodspring | finest fitness food Sportnahrung
10115
Berlin
Mit foodspring möchten wir den Ansprüchen derer gerecht werden, für die Gesundheit und Fitness ein Statussymbol geworden...
foodspring.de Erfahren Fitness Muskelaufbau Abnehmen Ernährung Ernährungsplan Trainingsplan Agb
236 Hochzeitsfotograf in Berlin Hochzeitsfotograf
12101
Berlin
Hochzeitsfotograf in Berlin Als Euer erfahrener Hochzeitsfotograf halte ich die einmaligen Momente eurer Hochzeit für Euch fest. Ihr...
fotos-eurer-hochzeit.de Hochzeitsfotograf Berlin Hochzeit Leistungen Hochzeitsblog Galerie Preise Eure
237 PORTAS Fachbetrieb Tischlerei Nissen Tischlerei
13599
Berlin
PORTAS - Europas Renovierer Nr. 1 Perfekter Service und erstklassige Qualität seit über 35 Jahren. Tischlerei Nissen Berlin -...
nissen.portas.de/ Portas Informationen Nissen Detlef Bau Renovierungslsungen Aktionen Galerie
238 Gartenbau Berlin Gartenbau
13125
Berlin
Gartenbau Berlin - wenn es um die Pflege und Gestaltung von Gärten geht. Wir, die Straman GmbH...
straman.de Berlin Winterdienst Gebäudemanagement Landschaftsbau Brandenburg Gartenbau Straßenreinigung Garten
239 Physiotherapy-Codrington Gesundheit
13467
Berlin
physiotherapy-codrington.de Behandlungen Berlin Geobasis Hermsdorf Training Maps Google Kurse
240 Büroreinigung Berlin | Büro- Reinigungsfirma Berlin Reinigung In
13583
Berlin
R&Q Management Berlin ist ein Reinigungsunternehmen in Berlin. Als Reinigungsfirma Berlin bieten Wir Büroreinigung, Gebäudereingiung, Wohnungsreinigung, Praxisreinigung...
bueroreiniger-berlin.de Berlin Büroreinigung Reinigungsfirma Grundreinigung Praxisreinigung Wohnungsreinigung Unterhaltsreinigung Büro
241 Body Power Der Fitness Fachmarkt Sportnahrung
13595
Berlin
Der Fitness-Fachmarkt und Nutrition Shop für Fitness, Eiweiss und Supplemente in Berlin-Spandau Body Power ist der alteingesessene Sport-Profi...
bodypower-berlin-shop.de Vergleichen Tagen Artikel Nr Lagerlieferfrist Nutrition Protein Body
242 Berufskraftfahrer Aus- und Weiterbildung in Berlin Fahrschule
12587
Berlin
FAHRSCHULE allroad BERLIN Berufskraftfahrer Aus- & Weiterbildung Sie möchten sich beruflich verändern oder weiterbilden? Als renommierte Fahrschule entsprechen wir den...
kursnet.online Fahrschule Berlin Berufskraftfahrer Kursnet Lkw Bildung Grundqualifikation Module
243 Berufskraftfahrer Aus- und Weiterbildung in Berlin Fahrschule
12587
Berlin
FAHRSCHULE allroad BERLIN Berufskraftfahrer Aus- & Weiterbildung Sie möchten sich beruflich verändern oder weiterbilden? Als renommierte Fahrschule entsprechen wir den...
kursnet.online Fahrschule Berlin Berufskraftfahrer Kursnet Bildung Lkw Module Allroad
244 Berufskraftfahrer Aus- und Weiterbildung in Berlin Fahrschule
12587
Berlin
FAHRSCHULE allroad BERLIN Berufskraftfahrer Aus- & Weiterbildung Sie möchten sich beruflich verändern oder weiterbilden? Als renommierte Fahrschule entsprechen wir den...
kursnet.online Fahrschule Berlin Berufskraftfahrer Lkw Kursnet Bildung Beschl Träger
245 Upcycling Deluxe Upcycling -
12047
Berlin
Wenn aus vermeintlich unbrauchbaren Dingen durch kreative Verarbeitung neue und einzigartige Produkte entstehen, dann ist das Upcycling! Konkret...
upcycling-deluxe.com Kopfumfang Cm | Upcycling Taschen Kindermützen Deluxe Design
246 Flamenco Gitarrenunterricht in Kreuzberg Flamenco Gitarrenunterricht in Kreuzberg Gitarrenlehrer
10961
Berlin
Flamenco Gitarren Unterricht von erfahrenem Lehrer. Auf Wunsch Noten, Harmoniel. Improvisation etc. Anfänger und Fortgeschrittene, Unterrichtsort...
www.tottdi.com Flamenco Gitarre Berlin Tott Lebens Album Liefer Keyboard_
247 Gera-Nova Online-Apotheke Helfer Online Pharmacy
10969
Berlin
Gera-nova.de ist Ihre sichere, private und komfortable Quelle für FDA-zugelassene verschreibungspflichtige Medikamente. Wir sind ein online Treuhandservice...
gera-nova.de/ Gera Medikamente Nova Helfer Apotheke Novade Kunden
248 Vergleich auf Vergleich.org Vergleich
10405
Berlin
Vergleich.org versteht sich als Service für den Verbraucher: Wir möchten Kaufentscheidungen für Konsumenten vereinfachen. Unsere Stärke sehen...
vergleich.org Vergleich Gt Test Vergleichen Vergleichorg Angebot Fitness Bettdecken
249 Kanzlei Kanseas Rechtsanwalt
10719
Berlin
Wenn Sie eine kompetente Rechtsberatung in einer einladenden Atmosphäre suchen, haben Sie die richtige Kanzlei gefunden. Ich...
kanzlei-kanseas.de Portfound The Server Apache Found
250 DXN Vitalpilze Vitalprodukte
10707
Berlin
DXN ist weltweiter Marktführer im Vertrieb von Ganoderma Produkten, Reishi, Lingzhi, Hericium, Lions Mane, Cordyceps, Cordyceps Fruchtkörper...
dxn-berlin.de Ganoderma Kaffee Produkte Dxn Fb Lingzhi Coffee Malaysia
251 BellaDerma Fachzentrum
10719
Berlin
Für eine effektive und dauerhafte Haarentfernung in Berlin sollten Sie nur zum Spezialisten gehen. Das Fachzentum BellaDerma...
belladerma.de Haarentfernung Berlin Laser Dauerhafte Behandlung Ipl Belladerma Enthaarung
252 VS-Autolackiererei Berlin-Tegel Reinickendorf Autolackiererei
13509
Berlin
VS-Autolackiererei in Reinickendorf-Tegel. LACK: Wir lackieren für Sie Fahrzeuge aller Art und auch Industrieteile. Sowohl Teil- wie...
vs-autolackiererei.de Tegel Vs Kfz Autolackiererei Berlin Lackieren Reinickendorf Lkw
253 Jetztodernie GmbH Marketingberatung
10439
Berlin
Wir sind eine Marketingberatung und Kommunikationsagentur aus Berlin, die kleine und mittlere Unternehmen erfolgreicher macht. Dabei schätzen wir...
jetztodernie.berlin Filmproduktion Suchmaschinenoptimierung Beratung Seo Werbespot Agentur Design Berlin
254 Giorgio di Luca Musik Events Pianist VocalJazz
10623
Berlin
Giorgio di Luca Pianist/VocalJazz und DanceBand. G.di Luca bitet Ihnen die perfekte musikalische Begleitung für Veranstaltungen jeder Art.Darbietung: Classic...
giorgio-di-luca.de Luca Pianist Giorgio Jazz Adlon Diana Band Krall
255 DustlesService UG Gebäudereinigung
10963
Berlin
dustlesservice.de Z Y
256 Giorgio di Luca Musik Events Pianist VocalJazz
10623
Berlin
Giorgio di Luca Pianist / Band für Ihre kommenden Veranstaltungen. G. di Luca bietet Ihnen die perfekte musikalische...
giorgio-di-luca.de Luca Pianist Giorgio Jazz Band Adlon Krall Diana
257 DIQP Deutsches Institut für Qualitätsstandards und Institut
14199
Berlin
Das DIQP ist ein Institut welches sich mit der Entwicklung verschiedener Gütesiegel und Qualitätssiegel beschäftigt. Unternehmen haben...
diqp.eu Diqp Gütesiegel Qualitätssiegel Unternehmen Qualitätsstandandards Nichteinhaltung Prüfung Servicecheck
258 White Unicorn e.V.
12623
Berlin
white-unicorn.org Unicorn White Bilderdenken Kreativwerkstatt Verein Wahrnehmung Autist Ev
259 Onlineshop für E-Zigaretten Liquid und Zubehör Liquid
10713
Berlin
Ihr Shop für E-Zigaretten, Liquid und Zubehör. Mehr als 1.500 Produkte günstig Online bestellen. Liquid Made in...
rauchershop.eu/ Liquid Produkt Kangertech Joyetech Zigarette Eleaf Starterset Aspire
260 TradeMachines Suchmaschine Für
10961
Berlin
TradeMachines ist die globale Suchmaschine für gebrauchte Maschinen – vom Bagger bis zur Produktionsmaschine. Auf TradeMachines finden...
trademachines.de Altendorf Auktion Letzter Trademachines Gebrauchtmaschinen Maschinen Gebrauchte Kategorien
261 12 Autoankauf Berlin Autoankauf
12359
Berlin
Professioneller Autoankauf für Berlin und Potsdam mit mehr als 25 Jahren Erfahrung. Wir ermöglichen den seriösen Gebrauchtwagen-Ankauf...
12autoankauf-berlin.de/ Ankauf Autoankauf Auto Berlin Uhr Kfz Pkw Gebrauchtwagenankauf
262 Maxat Friseur Friseur
10115
Berlin
Herzlich willkommen bei Ihrem Friseur Berlin-Mitte! Wir wollen Ihren Kopf ... Aus rein beruflichen Gründen. Schließlich sind wir...
maxat-friseur.de Friseur Berlin Mitte Maxat News Info@maxat Friseurde Neuer
263 Gutsche + Schaub GbR Fenster Türen
14167
Berlin
Fenster, Türen, Rolltore, Parkett, Laminat, Bautischlerei, Rollladen, Markisen, Rollos, Vertikalanlagen, Jalousien, Plissees, Insektenschutz...
gutsche-schaub.de Schaub Gutsche Berlin Türen Fenster Markisen Handwerk Rollläden
264 KFZ-Sachverständiger B.Eng. Michael Foote KFZ-Sachverständiger
13589
Berlin
Ihr doppelt zertifizierter KFZ-Sachverständiger nach DIN EN ISO/IEC 17024 für Berlin und Umgebung, B.Eng. Michael Foote -...
kfz-unfallgutachten24.de Kfz Sachverständiger Sachverständigen Isoiec Kosten Beim Zertifizierter Ihres
265 Spree Gerüstbau GmbH Gerüstbau
14167
Berlin
Ihr perfekter Partner für den Gerüstbau sind wir von der Spreegerüstbau GmbH. Seit November 2006 sind wir...
spreegeruestbau.de/standorte/berlin/ Berlin Gerüstbau Spree Luckau Standorte Standort Leistungen Lehe
266 Schlüsseldienst Berlin Mitte Schlüsseldienst
13353
Berlin
Türöffnung oder Türabsicherung. Für beides sind wir Ihr richtiger Ansprechpartner. Rufen Sie uns an und lassen sich...
schlüsseldienst-mitte.de
267 Wolfgang Bruch
10827
Berlin
Ausdrucksstarke Übersetzungen und Lektorat in 70 Sprachen finden Kunden aus Wirtschaft und Finanzen bei dem Übersetzungsbüro ad...
ad-editum.de übersetzung Lektorat Deutsch English Sprachen Leistungen Business übersetzer
268 Profi Partner AG Immobilien
10179
Berlin
Unsere Maklerbüros in Berlin und München vermitteln in Kooperation mit unseren Vertriebspartnern Immobilen in ganz Deutschland. Unsere...
profi-partner.de/ News Ottilie Hansemann Team Berlin Wohnung Partner Profi
269 Gebäudereinigung Berlin Gebäudereinigung
13507
Berlin
Der richtige Partner ist die Gebäudereinigung Berlin Max GmbH wenn Ihre Anlagen komplett gereinigt und gesäubert werden...
max-blitzblank.de Gebäudereinigung Berlin Glasreinigung Max Baureinigung Winterdienst Kunden Unterhaltsreinigung
270 RC-Naturheilpraxis Gesundheit Heilpraktiker
10781
Berlin
Praxis für alternative Medizin und Naturheilkunde. In meinem ganzheitlichen Konzept habe ich mich der Synthese von Medizin und...
rc-naturheilpraxis.de Termin Beschwerden Cellsymbiosis Homöopathie Coaching Massage Tinnitus Berlin
271 Übersetzungsbüro Berlin - Cengolio Übersetzungsbüro
10711
Berlin
Normkonform · 1000 Zert. Übersetzer · 115 Übersetzungssprachen...
cengolio.com/uebersetzer-berlin Deutsch Berlin Jobcenter Türkisch Chinesisch Italienisch Arabisch
272 Li Funkfernbedienung
10115
Berlin
Funk Fernsteuerung, Funksender, Empfaenger, Funkschlater, Haus / Landwirtschaft / Industrie Automation, lange Reichweite und hohe Leistung Fernsteuerung...
fernkontrolle.com/ Kanal Funk Empfänger Radio Fernbedienung Serie Sender Motor
273 Autoexport Autoexport
12055
Berlin
Top Autoexport unser Name ist Pogramm den Wir bieten Top preise auch für Fahrzeuge die nicht mehr...
top-autoexport.de Autoexport Auto Export Fahrzeug Berlin Geld Bargeld Verkauf
274 Schlüsseldienst Frankfurt Schlüsseldienst
12487
Berlin
Schlüsseldienst Frankfurt bietet Sicherheitstechnik zu guten Konditionen. Der Schlüsseldienst Frankfurt hat folgenden Service: Türöffnungen aller Art, Schlüsselnotdienst...
schluesseldienst-helfer.de Schlüsseldienst Austausch Schließanlagen Schlüsselnotdienst Einbruchschutz Schlüssel Instandsetzung Beim
275 office-4-sale Büromöbel GmbH Büromöbel
13509
Berlin
Für die nachhaltige Büroeinrichtung ist man bei office-4-sale - Deutschlands Marktführer für berufserfahrene Büromöbel - genau richtig....
office-4-sale.de Büromöbel Büroposten Büroeinrichtung Office Bürostühle + Sale Schreibtische
276 Fotografie aus Berlin GRAND VISIONS Fotografie
10553
Berlin
GRAND VISIONS ist ein Fotostudio fuer Werbefotografie, dass europaweit fuer Unternehmen, Agenturen und Verbaende im Einsatz ist...
fotografberlin.eu Berlin Werbefotografie Fotografie Event Fotograf Messefotografie Business Portraits
277 Praxis Der Zuhörer - Steffen Zöhl Heilpraktiker Für
14059
Berlin Charlottenburg
Gesprächstherapie, Hypnose, Integrative Psychotherapie Ich bin Steffen Zöhl, geb. 1975, glücklich verheiratet und liebe es, Menschen zu motivieren...
derzuhoerer-berlin.de/ Hypnose Zuhörer Leben Geschichte Therapeutische Ziele Arbeit Praxis
278 PinkNail Nagelstudio Berlin PinkNail Nagelstudio Berlin Nagelstudio
12169
Berlin
PinkNail Nagelstudio Berlin Steglitz Nailart Nageldesign Maniküre Refill Verlängerung Steglitz Fingernägel künstliche Nails Nageldesign Nailart schöne Nägel...
pinknail.de Nail Pinknail Art Nailart Preise Meisterin Nagelstudio Hände
279 Dein Onlineshop für Poster und Bilder Wandbilder

Berlin
Häng Dir Schönes an die Wand mit Wandbildern von der POSTER agency. In unserem Onlineshop findest Du zahlreiche...
poster-agency.de Poster Versandkosten Zzgl Bilder Leinwandbilder Acrylglasbilder Hd Metal
280 Infos & Computer - Ecke Infos &
13359
Berlin
Infos und Hilfen zur Hompage und Software in der Gigitalen Cyber-Welt. Unterstüzung ist immer Willkommen....
studio69-sawig.de Studio Mario Sawig Welt Musik Forum Seiten Windows
281 RE Security Service Wach- Und
13405
Berlin Reinickendorf
RE Security Service Personenschutz & Sicherheitsdienst Ist ein junges Berliner Bewachungsunternehmen mit einem breit gefächerten Spektrum an Dienstleistungen....
re-security-service.de Security Personenschutz Streife City Partner + Sicherheitsdienst Re
282 Änderungsschneiderei Änderungsschneiderei
12305
Berlin
Bearbeitung von allen Kleiderarten sowie Pelz, Leder, Gardinen, Motorradbekleidung, Vollreinigung, spezziele Lederreinigung, Teppichreinigung, Schuhreparatur...
www.änderungsschneiderei-lichtenrade-berlin.de
283 Hochzeitsfotograf Berlin Fotograf

Berlin
Professioneller Hochzeitsfotograf, Hochzeitsreportage...
ahundoh.eu Berlin Hochzeitsfotograf Hochzeitsfotografie Jahren Zurück Preise Seiteninhalt Galerie
284 Öffentliche Handy Ladestation Ladestation
13129
Berlin
42 Zoll Werbestelen mit integrierten öffentlichen Handy Ladestation-...
chargomat.de Handy Ladestation Kunden Marketing Location Verweildauer Multimediale Hostel
285 Anwaltskanzlei Erika Schreiber Rechtsanwälte
10585
Berlin
Rechtsanwältin Schreiber ist Fachanwältin für Arbeitsrecht und Fachanwältin für Familienrecht. Die Kanzlei Schreiber vertritt Sie sowohl außergerichtlich...
kanzleischreiber.de Familienrecht Fachanwältin Arbeitsrecht Erika Berlin Anwaltskanzlei Schreiber Charlottenburg
286 Stiftungsberatung Dr. Kade KG Finanzen
13437
Berlin
Stiftungsberatung Dr. Kade KG vermittelt private Immobiliendarlehen von Stiftungen und Stiftungennahen Personen an Selbstständige, Rentner, Familien und...
stiftungskapital.com Z Y
287 Ausbildung-Arbeit-Weiterbildung Weiterbildung
12051
Berlin
aawberlin.de Aaw Barschule Barmeister Ausbildung Barkeeper Veranstaltung Barmixer Cocktails
288 FiGD Fachinstitut für Informatik und Grafikdesign Bildungseinrichtung Bildung
10407
Berlin
Wir sind ein bundesweit zertifizierter Bildungspartner für Fortbildungen und Intensiv-Qualifizierungen im Herzen Berlins – im Prenzlauer Berg....
figd.de überspringen Navigation Bildung Berlin Grafikdesign Figd Programmierung Coaching
289 Der Berliner Gastronomie
12051
Berlin
Inmitten des Neuköllner Kiezes - Der Berliner! Tagsüber Ausbildung im Gastronomiebereich - Abends bieten wir kleine Deutsche Küche...
der-berliner.net Berlinernet Httpder Gastronomieberliner Küchebar
290 Fotograf Berlin | H2N Photography Fotografie
10245
Berlin
Wir fotografieren Sie für Ihre Bewerbung und Ihre Hochzeit, wir erstellen klassische Portraits und Businessfotos. Ihr Fotograf...
fotograf-berlin.biz Z Y
291 Physiotherapie O. Lerch Physiotherapie
12681
Berlin
Physiotherapie in 12681 Berlin Marzahn...
physiotherapie-lerch.de/ Berlin Physiotherapie Leistungen Anfahrt Stellenangebote Praxen Marzahn Hellersdorf
292 Ergotherapie O. Lerch Ergotherapie
12681
Berlin
Ergotherapie in 12681 Berlin Marzahn...
ergotherapie-lerch.de/ Ergotherapie Leistungen Anfahrt Praxis Stellenangebote Berlin Marzahn Hellersdorf
293 Kredit-von-privat Kredit-von-privat
10999
Berlin
Kredit-von-privat...
kredit-von-privat
294 4Film | Filmproduktion Berlin Filmproduktion
10245
Berlin
Ein weitreichendes Netzwerk an Filmschaffenden und kreativen Köpfen ermöglicht uns, alle Elemente einer Filmproduktion, beginnend bei der...
4film.eu Z Y
295 Restaurierungen Antikwerk-Berlin Restaurator Und
12203
Berlin
Um ein museales Objekt mit besonderer Geschichte oder auch Ihr Möbelstück mit Erinnerungswert für die Zukunft unverfälscht...
antikwerk-berlin.de/ Berlin Restaurierung Steglitz Leistungen Antikwerk Seeger Restaurierungen Objekten
296 Stadtblumenkübel im Außenbereich Pflanzzubehör Und
15366
Hoppegarten bei Berlin
Atech liefert interessante Ideen für städtische Kleinarchitektur, indem sie Grün in die Städte einführen. Mithilfe von großen...
atech-de.eu Blumenkästen Atech Blumenampel Sifu® Extravase Jiflor® Hauptseite Hängende
297 Designer-Lampen und Designermöbel von Nuno’ni Dekoration Design
15366
Hoppegarten bei Berlin
Ein großes Angebot von hochmodernen Inspirationen für jede Wohnung, Designermöbel, Designer-Beleuchtung und Wohnaccessoires. Alltagsgegenstände verlassen die gewöhnlichen...
nunoni.de Lampy Donice Light Meble Aktualności Stojące Produkty Dekoracje
298 Blumentürme in der Stadt Landschaftsbau
15366
Hoppegarten bei Berlin
Große Erfahrung, hohe Qualität und interessante Ideen sind etwas, was Terra von anderen abhebt. Individuell entworfene Blumenkaskaden...
blumentuerme.de/de Woj Polen Modell Model Kaskadowe Zobacz Kwietnikowe Małopolskie
299 Widerstandsfähige Blumenkübel aus Corten und Polyethylen Pflanzzubehör
15366
Hoppegarten bei Berlin
TerraForm ist eine der größten Kollektionen großer trendy Blumentöpfe auf dem Markt. Die Kollektion umfasst auch beleuchtete...
terraformdesign.de Blumentöpfe Terraform Pot Produkte Stadtblumentöpfe Architekten Zubehör Beleuchtete
300 Weihnachtsstadt-Einrichtung mit Dekorationen von TerraChristmas Weihnachtsdekorationen
15366
Hoppegarten bei Berlin
Die Firma bietet Ihnen Weihnachtsschmuck aller Größen. Man kann zwischen verschiedenen Ausschmückung, z. B. Weihnachtsbaumberzügen und Ajour-Dekorationen...
terrachristmas.de Dekorationen Terra Städte Christmas Frage Beleuchtete Ajour Klassische

Kleinanzeigen, Kommentare und Mitfahrgelegenheit Berlin

+ Kommentar oder Kleinanzeige für Berlin eintragen!

301 Home Augenarztpraxis im
10783
Berlin
Augenarztpraxis im Ärzte Centrum Bülowstraße
aerzte-buelowstrasse.de
302 Albers DAS SPORTRESTAURANT Albers Wettboerse GmbH Albers
10783
Berlin
Großzügig konzipiert ist das Albers Sportrestaurant der Treffpunkt aller Besucher des Pferdesportparks BerlinKarlshorst. Der aufmerksame
albers-restaurant.de Albers Berlin Restaurant
303 Home
10783
Berlin
Kultur FREIES MUSEUM BERLIN
artfactory-berlin.de
304 Weihnachtsmarkt auf dem Winterfeldtplatz Berlin
10783
Berlin
Der traditionelle Weihnachtsmarkt auf dem Winterfeldtplatz ist einzigartig und an den Adventssonntagen geöffnet.
weihnachtsmarkt-winterfeldtplatz.de Berlin Weihnachtsmarkt Winterfeldtplatz
305 Formular.de Tipps Formular.de ist ein Angebot der Formblitz AG
10783
Berlin
Auf Formular.de finden Sie umfangreiche Informationen zu juristischen Themen wie Mietvertrag Arbeitsvertrag Patientenverfügung
formular.de
306 Cafe Peri Start
10783
Berlin
Homepage of Cafe Peri
cafe-peri.de
307 Czollek consult Willkommen! Leah
10783
Berlin
Diversity Dialoge Mediatorin Trainerin Dozentin Konflikte produktiv und zufriedenstellend lösen Kommunikation Dialog Unternehmen Kommunikationskultur
czollek-consult.de Leah Carola Czollek
308 PROFORMA Corporate Design Gesellschaft für Unternehmenskommunikation mbH & Co. KG Design
10783
Berlin
Corporate Design Agentur Berlin Agentur für Unternehmenskommunikation WebEntwicklungen und Beratung. Für Unternehmen
proforma.de Design Gestaltung Corporate
309 Business Development Germany German
10783
Berlin
We bring your business on the German market ? contact us today!
businessdevelopmentgermany.de German Companies German Marketing
310 DJ Frank DJService DJ
10783
Berlin
Dj Frank Berlin DJService für Partys Feste Hochzeiten ...
dj-frank-berlin-brandenburg.de DJ Berlin Brandenburg Party Hochzeit
311 Berlin Taekwondo Willkommen Berlinsan Taekwondo Sportverein e.V. Adnan
10783
Berlin
Olympic Sports Center Berlinsan Taekwondo e.V. Adnan Karabulut
berlintaekwondo.de Adnan Karabulut Taekwondo Berlin
312 Wohnungsauflösung Berlin 030 wohnungsauflösung
10783
Berlin
Wohnungsauflösung Berlin günstig und schnell von Complett Räumung 030 261 01 714
berlin-wohnungsaufloesung.de Wohnungsauflösung Berlin Wohnungsauflösungen Entrümpelung Entrümpelungen
313 RAe Böhm MeyerDulheuer §§
10783
Berlin
Rechtsanwälte Rechtsanwalt Matthias Böhm Notar Helmuth MeyerDulheuer RA RAe §
boehmmeyerdulheuer.de §§ § Rechtsanwälte
314 Astrid Elisabeth Stebich
10783
Berlin
Astrid Elisabeth Stebich Make up Artist Friseurmeisterin aus Berlin. Make up Haare
elice-beth.de
315 Home www.berlinevangelisch.de Gesellschaft für Unternehmenskommunikation mbH & Co. KG Abgeltungssteuer
10783
Berlin
www.berlinevangelisch.de ? Das ServicePortal der Evangelischen Kirche in Berlin.
berlin-evangelisch.de Abgeltungssteuer Advent Austritt Bach Berlin
316 Berlin Apartments Potsdamer Str Berlin
10783
Berlin
Apartments in Berlin nähe Potsdamer Platz für Gruppenreisen Gruppenunterkunft
berlin-aparts.de Berlin Apartments Berlin Gruppenreise
317 Bar Voyage barvoyages bar
10783
Berlin
Bar Café Kleinkunstbühne
barvoyage.de Bar Berlin Kleinkunst Berlin
318 Home ? Kunstsaele Berlin Kunstsaele
10783
Berlin
Die Kunstsaele Berlin verbinden Galerie Sammlung und Kulturprojekte an einem Ort. Neben den wechselnden
kunstsaele.de Kunstsaele Oehmen Bergmeier
319 WerbeartikelAgentur für Fahrradsattelbezüge
10783
Berlin
Kultkeks ist Ihr Partner für individuelle Werbemittel und Werbegeschenke. Unser Sortiment reicht von der Handysocke
kultkeks.de
320 TRIO PALMERA Salsa
10783
Berlin
Seit nunmehr 26 Jahren ist das TRIO PALMERA unterwegs um landesweit und über die Landesgrenzen
josefinol.de Salsa Cumbia Merengue
321 Home Labbow Personalleasing e.K.
10783
Berlin
Personalberatung und dienstleistungen
labbow-personalleasing.de
322 Marian Kiss Marian
10783
Berlin
Marian Kiss Film Berlin Filmemacherin Filmmaker Regiesseurin Director
mariankiss.de Marian Kiss Film
323 Marianne Rosenberg | RoseWeb Public Image GmbH Marianne
10783
Berlin
Die offizielle Website von Marianne Rosenberg mit aktuellen Infos SongDownloads Biografie Diskografie
rosenberg.de Marianne Rosenberg Pop
324 MännerMinne e.V. Erster schwuler choir
10783
Berlin
MännerMinne e.V. Erster schwuler Männerchor Berlin gegründet 1987 Mitglied im Berliner Sängerbund.
maennerminne.de Choir Chorus Gay
325 | MARTINA DOEHRING | c/o Formblitz AG Martina
10783
Berlin
Dies ist die offizielle Website der Sopranistin Martina Doehring
martinadoehring.de Martina Doehring Sängerin
326 EVA GmbH EVA GmbH
10783
Berlin
KFZ Reparatur oder Ausfuhrversicherung:sofort in unserem OnlineShop. Auch Gebrauchtwagengarantie und Finanzierung für Privatpersonen und Händler
eva-evb.de
327 Diversitygendertraining.de joomla
10783
Berlin
Joomla! dynamische PortalEngine und ContentManagementSystem
energydeal.de Joomla Joomla
328 :: Keding / ESS Keding / ESS Elektronische Sicherheitssysteme GmbH / Keding GmbH & Co. KG sicherheitssystem
10783
Berlin
ESS GMBH Planung Lieferung Montage Inbetriebnahme von elektronischen Signal und Anzeigeanlagen
ess-sicherheit.de Sicherheitssysteme Alarmanlagen Brandmeldetechnik Brandmelder Brandmeldeanl
329 Hauptstadtplan | interaktiver stadtplan Adler & Schmidt GmbH Bundeshauptstadt
10783
Berlin
Interaktiver häusergenauer Stadtplan der Berliner Innenstadt. Suchmöglichkeit nach den Kategorien Sehenswürdigkeiten Kultur Regierungsbauten
hauptstadtplan.de Bundeshauptstadt Berlin Hauptstadt Bundesregierung Reichstag
330 Home GmbH & Co. KG ML4
10783
Berlin
Personalleasing ML4 Personalmanagement GmbH Co.
ml4-dienstleistungen.de ML4 ML4Personalmanagement ML4
331 Keding GmbH Co.KG Integral
10783
Berlin
IntegralSecurity Integralsecurity Integral Security Integral Security Antennentechnik und Sicherheitstechnik Alarmanlagen Brandmeldeanlagen Einbruchmeldeanlagen Videoüberwachung und mehr)
keding.de Integral Security IntegralSecurity Integralsecutity Integral
332 Start Kauffeld und
10783
Berlin
Kauffeld und Jahn
kauffeldundjahn.de
333 Willkommen bei Pascha Grill joomla
10783
Berlin
Joomla! dynamische PortalEngine und ContentManagementSystem
pascha-grill.de Joomla Joomla
334 PartytechnikBerlin Verleih von Berlin
10783
Berlin
Partytechnik Berlin verleiht Lichttechnik und Tontechnik für Eure Party/Veranstaltung
partytechnik-verleih-berlin.de Berlin Partytechnik Verleih Party Verleih
335 Home
10783
Berlin
Tierärzte Tierarztpraxis Marianne Gass
petstation.de
336 Willkommen bei perko profundus! Perko
10783
Berlin
perko profundus
perko-profundus.de Perko Gudrun Profundus Wissenschaftscoach Education
337 Ludger Jungnitz Men's Maenner
10783
Berlin
Ludger Jungnitz Men's Care Men's Studies
mensstudies.de Maenner Lebensqualitaet Gesundheit
338 Berlin Apartments Potsdamer Str Berlin
10783
Berlin
Apartments in Berlin nähe Potsdamer Platz für Gruppenreisen Gruppenunterkunft
cityapartsberlin.de Berlin Apartments Berlin Gruppenreise
339 HumanistischSystemische Beratung Frank systemisch
10783
Berlin
Erkennen und Auflösen von Verstrickungen Familienstellen Psychodrama Gestaltherapie Trauma
frankstamer.de Systemisch Familienstellen Aufstellung
340 Flowers of life Flowers
10783
Berlin
Flowers of life richtet sich an alle Menschen die Begleitung Gesellschaft oder eine persönliche
flowers-of-life.de Flowers Of Life Brigitte
341 INTEGRAL SECURITY Sicherheitstechnik Keding GmbH & Co. KG IntegralSecurity
10783
Berlin
Sicherheitstechnik von Integral Security dem deutschlandweiten Firmenverbund für Sicherheitstechnik (Alarmanlagen Brandmeldeanlagen Einbruchmeldeanlagen
integralsecurity.de IntegralSecurity Sicherheitstechnik Integral
342 IJam.de ? mediendesign Webdesign
10783
Berlin
10 Schritte zur eigenen Website | iJam.de Mediendesign
ijam.de Webdesign Mediendesign Homepage
343 Startseite » Gesine Palmer » Herzlich Willkommen auf Gesine
10783
Berlin
Dr. Gesine Palmer leitet das Berliner Büro für besondere Texte. Die Religionsphilosophin bietet Kommunikationsberatung und
gesine-palmer.de Gesine Palmer Redenschreiben
344 Politikmanagement mit Gitta Stieber Politikmanagement
10783
BERLIN
Gitta Stieber Berlin Politikmanagement Qualifizierung und Weiterbildung die Sie in sozialen
gittastieber.de Politikmanagement Kommunikation SoftSkills
345 Gift Music Gift Music GmbH Weltmusik
10783
Berlin
Ein kleines Weltmusiklabel aus Berlin
giftmusic.de Weltmusik Label Berlin
346 GEAG Immobilienverwaltung Berlin:Wir verwalten GEAG Immobilienverwaltungs GmbH Wirtschaft
10783
Berlin
GEAG Immobilienverwaltungs GmbH: kompetente Verwaltung und Betreuung von Immobilien in Berlin Brandenburg Sachsen
geag-berlin.de Wirtschaft Immobilien Immobilienverwaltung
347 Business Development Germany German
10783
Berlin
We bring your business on the German market ? contact us today!
business-development-germany.de German Companies German Marketing
348 Moritz Tilman Achelis | rechtsanwalt
10783
Berlin
Rechtsanwalt Arbeitsrecht Achelis Baurecht Architektenrecht Grundstücksrecht Wohnungseigentumsrecht Medizinrecht
ra-achelis.de Rechtsanwalt Arbeitsrecht Achelis
349 RDM: Startseite Landesverband Berlin und Brandenburg e.V. rdm
10783
Berlin
RDM Ring Deutscher Makler Landesverband Berlin und Brandenburg e.V.
rdm-berlin-brandenburg.de Rdm Ring Deutscher
350 Startseite Willkommen
10783
Berlin
Willkommen:  
hd-computer24.de
351 Rita Leinenweber · Astrologie Astrologie
10783
Berlin
Ich freue mich Ihnen meine Kenntnisse in Astrologie Massage energetischen Heilweisen
ritaleinenweber.de Astrologie Horoskop Geburtshoroskop
352 GEAG Immobilienverwaltung Berlin:Wir verwalten GEAG Immobilienverwaltungs GmbH Wirtschaft
10783
Berlin
GEAG Immobilienverwaltungs GmbH: kompetente Verwaltung und Betreuung von Immobilien in Berlin Brandenburg Sachsen
sabinespehr.de Wirtschaft Immobilien Immobilienverwaltung
353 Rundum Ich Ihr massage
10783
Berlin
Massage Ernährungsberatung Fitness und Personal Training Hypnosetherapie in Berlin für Privatkunden
rundum-ich.de Massage Ernährung Hypnose
354 Astrologische Gesundheits und Lebensberatung Astrologie
10783
Berlin
Astrologische Gesundheits und Lebensberatung Yvonne v. Bechtolsheim: Astrologie Reiki Ernährungsberatung und Radionik in
schwarzer-second-hand-shop.de Astrologie Reiki Ernährungsberatung
355 Roger Thilo EDV Service Roger
10783
Berlin
Wir bieten ITLösungen im Businessbereich für alle Branchen und Unternehmensgrößen. innovativ zuverlässig
rthilo.de Roger Thilo EDV Service
356 PROBase easy PROFORMA GmbH & Co. KG CMS
10783
Berlin
Mit PROBase easy erstellen wir individuell hochwertige Webauftritte Sie brauchen nur noch die Texte
pro-base-easy.de CMS ContendManagemnetSystem Contend
357 Sm hope ick Kindermode
10783
berlin
Die Teilnahme am Wettbewerb ?Meine Heimat? auf der Kreativplattform Dawanda.de war Anlass Designs zu
smhope.de Kindermode
358 LOOK22 Home LOOK22 LOOK22
10783
Berlin
LOOK22 MediaService ~ zielgruppenoptimiertes Webdesign ~ aussagekräftige Fotografie ~ perfekte Grafik ~ treffsichere Texte ~
look22.de LOOK22 MediaService Internet Fotografie Grafik
359 Raumdesignerin .Silke Smida. kunst
10783
Berlin
Art by Silke Smida composed drawings find new places!
raumdesignerin.de Kunst Design Graffiti Wandtattoos Acryl
360 BEGINE Treffpunkt und Frauen
10783
Berlin
Interkulturelles Frauenkulturzentrum Künstlerinnenförderung Konzerte Ausstellungen Potsdamer Str. 139 BerlinSchöneberg
begine.de Frauen Lesben Frauencafé
361 Complett Räumung | Wohnungsauflösung wohnungsauflösung
10783
Berlin
Wohnungsauflösung Berlin günstig und schnell von Complett Räumung 030 261 01 714
complett-berlin.de Wohnungsauflösung Berlin Wohnungsauflösungen Entrümpelung Entrümpelungen
362 Contravision breaking news contra medienwerkstatt e.v. ContraVision
10783
berlin
short film festival in berlin germany march 20th to march 28th
contravision.de ContraVision Cinema Contra
363 Doktus.de Dokumente uploaden FORMBLITZ AG doktus
10783
Berlin
Hier findet man Dokumente zu allen Themen und kann Dokumente suchen verwalten
doktus.de Doktus
364 | MARTINA DOEHRING | c/o Formblitz AG Martina
10783
Berlin
Dies ist die offizielle Website der Sopranistin Martina Doehring
martina-doehring.de Martina Doehring Sängerin
365 Wolfgang Kommerell | kommerell.de Wolfgang
10783
Berlin
Website von Wolfgang Kommerell: Segeln Fotografie.
kommerell.de Wolfgang Kommerell Fotografie
366 Marianne Rosenberg | RoseWeb Public Image GmbH Marianne
10783
Berlin
Die offizielle Website von Marianne Rosenberg mit aktuellen Infos SongDownloads Biografie Diskografie
roseclub.de Marianne Rosenberg Pop
367 Linux auf CD/DVDR linux
10783
Berlin
LinuxDistributionen auf CDR und DVDR tuxpost.de Shop
tuxpost.de Linux Iso Shop
368 Home Texts and Birgit
10783
Berlin
Dr. Birgit Hollenbach brings language and science together. Her university studies of translation and biochemistry
textsandtranslations.de Birgit Hollenbach Translation
369 .:|Stadtrundfahrten|Originelle Alternative Stadtrundfahrt|Berliner Dialekt Berlin
10783
Berlin
| BerlinerSchnauze Stadtrundfahrten | Alternative Stadtrundfahrt im Berliner Dialekt | Mundart sehr Orginelles Geschenk
berliner-schnauze.de Berlin Stadtrundfahrt Stadtrundfahrten Information Private
370 Übersetzer Deutsch Rumänisch Rumänisch
10783
Berlin
Übersetzungen Deutsch Rumänisch Dolmetscher für Rumänisch in Berlin profesionelle Übersetzung kundenorientiert
turbatu-translations.de Rumänisch Übersetzer Deutsch Rumänisch
371 Home / tausendschwarz.de Angebot
10783
Berlin
HomepageTitel Berlin
tausendschwarz.de Angebot Kompetenz Beratung
372 Subversionen.de | praeludium
10783
Berlin
??? Beuys + Agnoli
subversionen.de
373 Betreutes Wohnen in Demenz betreutes
10783
Berlin
Der FAW e.V. begleitet und verwaltet ambulant betreute Wohngemeinschaften für Menschen mit Demenz.
verein-faw.de Betreutes Wohnen Demenz Wg
374 TRIO PALMERA Salsa
10783
Berlin
Seit nunmehr 26 Jahren ist das TRIO PALMERA unterwegs um landesweit und über die Landesgrenzen
trio-palmera.de Salsa Cumbia Merengue
375 Astrologische Gesundheits und Lebensberatung Astrologie
10783
Berlin
Astrologische Gesundheits und Lebensberatung Yvonne v. Bechtolsheim: Astrologie Reiki Ernährungsberatung und Radionik in
sternen-klar.de Astrologie Reiki Ernährungsberatung
376 Italienische Weine Online Weine
10783
Berlin
Vinila Weine aus Italien. Wer via eCommerce in Deutschland die besten italienischen Weine online
vinila.de Weine Wein Aus Italien
377 NAS Planung Baumanagement Nas Planung & Baumanagement GmbH & Co. KG Berlin
10783
Berlin
NAS Planung Baumanagement GmbH Co. KG Telefon +49 (0)30. 216 95 45
xn--nas-planungsbro-cwb.de Berlin Ahmet Nas
378 AllmendeKontor Gemeinschaftsgarten Allmende-Kontor e.V.
10783
Berlin
Allmende = Gemeingut = Commons: Berliner AllmendeKontor Gemeinschaftsgarten und eine der größten Hochbeetanlagen der
allmende-kontor.de
379 Beste Hunde: OnlineMagazin für
10783
Berlin
Das Online Hundemagazin mit aktuellen Artikeln zu Gesundheit Ernährung Erziehung und Verhalten
bestehunde.de
380 Berliner Schlagerfest 2012 berliner
10783
Berlin
Das Berliner Schlagerfest geht in die 2. Runde.
berliner-schlagerfest.de Berliner Schlagerfest 2012 Schlagerfest Berlinmitte
381 Birgit Schlieps Birgit
10783
Berlin
Urban Sculpture. Die Künstlerin Birgit Schlieps arbeitet mit dem urbanen Raum als Phantom Mythos
birgitschlieps.de Birgit Schlieps Kunst
382 Startseite Willkommen
10783
Berlin
Willkommen:  
ep-store.de
383 Business Development Germany German
10783
Berlin
We are the leading German Marketing Company bringing your business on the German market. Our
cockpit-germany.de German Companies German Marketing
384 Coworkingberlinsquarehaus.de coworkingberlinsquarehaus Webseite! Square Haus am Nollendorfplatz GmbH
10783
Berlin
SquareHaus work meet share collaborate coworking büros konferenzraum
coworking-berlin-squarehaus.de
385 Business Development Germany German
10783
Berlin
We are the leading German Marketing Company bringing your business on the German market. Our
dashboard-germany.de German Companies German Marketing
386 Herzlich Willkommen Willkommen Forner + Forner GbR
10783
Berlin
Als kreatives und innovatives Unternehmen für Beratung und Kommunikation möchten wir Sie als vertrauensvoller Partner
ff-beratung.de
387 Home SchwarzweißFotogr
10783
Berlin
Neue Wege Neue Sichten Neue Fotografien Du möchtest besser wahrnehmen und kreativ sein
fotografisch-sehen-lernen.de SchwarzweißFotografie Konzeptfotografie Fotografisch
388 Fotostudio Altman. Hochzeit Wettbewerb Studioalex.de
10783
Berlin
Suchen Sie einen professionellen Fotografen mit über 25 Jahre Erfahrung in der Fotografie? Dann sind
fotostudioalex.de Studioalex.de Hochzeit Wettbewerb Meine Traumhochzeit!
389 DIF | Dit is mirapodo ? operated by myToys.de GmbH
10783
Berlin
DAS Berliner Modeblog zu Fashiontrends und Modesünden Parties und Veranstaltern Designern und Kollektionen
dit-is-fashion.de
390 Heilpraxis Susanne Weis Heilpraxis
10783
Berlin
Heilpraxis Susanne Weis
heilpraxisweis.de Heilpraxis KLANGTHERAPIE HOMÖOSYNERGETIK AUSLEITUNG ERNÄRUNG
391 BAKUNAPOLI BakuNapoli
10783
Berlin
BAKUNAPOLI.Aserbaidschanische und italienische Küche.
baku-napoli.de BakuNapoli Restaurant Berlin Aserbaidschanische Küche
392 Kristina Jacoby Startseite Ghostwriter
10783
Berlin
Kristina Jacoby unterstützt Autoren bei der Erstellung ihrer Bücher
kristinajacoby.de Ghostwriter Ghostwriting Wissenschaftliches
393 Startseite Klinisches Krebsregister Klinisches Krebsregister für Brandenburg und Berlin gGmbH Klinisches
10783
Berlin
Informationen zur klinischen Krebsregistrierung in Brandenburg
kkrbb.de Klinisches Krebsregister Brandenburg
394 Kniggeinberlin.de Willkommen bei Knigge
10783
Berlin
Gesellschaftlicher Schliff selbstsicheres und stilvolles Auftreten ist heute wichtiger denn je. Jeder kann Benehmen
knigge-in-berlin.de Knigge Seminare KniggeSeminare Benehmen Benimmkurse
395 PROJECT318 photography
10783
Berlin
Homepage für die Vernissage / Ausstellung PROJECT318 der SRH Hochschule der populären Künste (hdpk).
project318.de Photography Design Motion
396 Ludger Jungnitz Prozessbegleitung Prozessbegleitung
10783
Berlin
Prozessbegleitung Berlin Ludger Jungnitz
prozessbegleitung-berlin.de Prozessbegleitung Coaching Projekte
397 SPAM Magazin SPAM
10783
Berlin
SPAM Magazin Ausgabe 01
spam-music.de SPAM; Magazin Musik
398 Text Julia Richter
10783
Berlin
Erstklassige Unternehmenskommunikation Texte und Konzepte in Berlin
text-juliarichter.de
399 ReBuy der einfache An reBuy reCommerce GmbH gebraucht
10783
Berlin
An und Verkauf für gebrauchte Handys Tablets Videopiele Filme CDs
rebuy.de Gebraucht Kaufen Gebraucht Verkaufen
400 Pasta e Più Startseite Frische
10783
Berlin
Frische Pasta in Berlin
pasta-e-piu.de Frische Pasta Berlin Raviolli Ghnochi
401 Aktuelles Bürgerinitiative
10783
Berlin
Stadtplanung von unten Stadtentwicklung TempelhofSchoeneberg Berlin
stadtplanung-von-unten.de Bürgerinitiative Bürgerbegehren Bürgerentscheid Anwohnerversammlung Gleisdr
402 Taxi Bildungscenter Berlin Treffpunkt Bildung GmbH Taxischein
10783
Berlin
Wir schulen seit 18 Jahren erfolgreich auf die Ortskundeprüfung mit eigenem ständig aktuellem
taxi-bildungscenter.de Taxischein PSchein Taxifahrer Fahrgastbeförderung Ortskundeprüfung
403 Studio NiMa Produktion Mode Kauffeld und Jahn GbR
10783
Berlin
Vom Entwurf bis zur Produktion. Mode und Textil. Studio NiMa ist in der Bekleidungsindustrie
studionima.de
404 Schuhe Online Shop myToys, mirapodo und ambellis - Shops der myToys.de GmbH
10783
Berlin
Schöner Schuhe shoppen ? riesige Auswahl für Damenschuhe ? Herrenschuhe ? und Kinderschuhe ? Bestellen
mirapodo.de
405 Yoga in Kreuzberg Yoga
10783
Berlin
Yoga in Berlin an Ihrem Arbeitsplatz oder besuchen Sie YogaKurse in Berlin Kreuzberg mit
yoga-und-massage.de Yoga Am Arbeitsplatz Yoga
406 MyToys | Alles für myToys, mirapodo und ambellis - Shops der myToys.de GmbH
10783
Berlin
myToys Ihr OnlineShop für Spielzeug Kindermode Babyausstattung und vieles mehr. Über 100.000
mytoys.de
407 Werbung auf dem Sattelschoner|
10783
Berlin
Sattelschützer als Werbemittel: Bedrucken Sie Sattelbezüge mit Ihrem Logo. Individuelle Gestaltungsmöglichkeiten Lieferung nach drei
kultsattel.de
408 Finest Whisky Shop Whisky
10781
Berlin
Unsere Philosophie ist es hochwertige seltene und alte Flaschen der verschiedensten Destillen und Abfüller
finestwhisky.de Whisky Verkauf Berlin
409 Black meadow music production Martin Klein und Christian Kociolek GbR
10781
Berlin
black meadow music production is a label situated in Berlin.
black-meadow.de
410 Immocollect.de by Portal Financecollect Immocollect.de by Portal Financecollect GmbH Immocollect.de
10781
Berlin
Immobilienangebote von Immocollect.de by Portal Financecollect GmbH
immocollect.de Immocollect.de By Portal Financecollect GmbH
411 Simply : pr + simply
10781
Berlin
simply : die PR und Marketing Agentur für erklärungsbedürftige Produkte! fon +49 (0) 30. 21
agentur-simply.de Simply Public Relation
412 Ashtanga Yoga Schule Berlin Ashtanga
10781
Berlin
Ashtanga Yoga Schule in Berlin Schöneberg am Winterfeldtplatz Pallasstr. 89 10781 Berlin
ashtangayogaschoeneberg.de Ashtanga Yoga Berlin Schöneberg
413 Rosenscharf und Edelsüß Catering ZOE
10781
Berlin
Restaurant ZOE Berlin. Asiatische und mediterrane Küche zwischen Hackeschem Markt und Alexanderplatz in Berlin Mitte.
aromamanufaktur.de ZOE Restaurant Lounge
414 Online Marketing: Wissen
10781
Berlin
Endlich von Online Marketing profitieren. Portal Ratgeber für erfolgreiches Internetmarketing mit Grundlagen Tipps
omkt.de
415 :: NATURKOSMETIK CALLA
10781
Berlin
Fachgeschäft für Naturkosmetik und Naturwaren. Kosmetische Behandlungen nach Dr. Hauschka und M.Gebhardt.
calla-naturkosmetik.de
416 Architektur Planung Beratung
10781
berlin
Architekten Hannover Berlin Architekturplanung Bauberatung Projektentwicklung Wertermittlung Architektur architectura nova
chocmoc.de
417 ChristianErdmann.de Christian
10781
Berlin
Willkommen auf der privaten Site von Christian Erdmann. Erfahren Sie mehr über meine Dozententäigkeit und
christian-erdmann.de Christian Erdmann Dozent Verwaltungsrecht Doppik.kom.bb
418 Christine Ordnung | Home xxxxx
10781
Berlin
xxxxx
christine-ordnung.de Xxxxx
419 CORINO 4 MEN CorinoArt
10781
Berlin
Photographer for beauty nude art fashion faces lingerie interieur
corino4men.de CorinoArt Photography Fotografie
420 Claudia Scholl Aktuelle Claudia
10781
Berlin
Claudia Scholl Buchkonzeption Gestalterische Konzepte Kinderkunstprojekte Illustration und Corporate Design
claudia-scholl.de Claudia Scholl Berlin Kartonzauber Grafikdesign
421 URBANIS Startseite URBANIS GmbH URBANIS
10781
Berlin
Herzlich willkommen bei der URBANIS GmbH
bvg-holding.de URBANIS Berlin Unternehmen
422 Home Chatwins Chatwin
10781
Berlin
CHATWINS: Bücher rund ums Reisen gibt es hier nach Ländern und Kontinenten sortiert. Reisen heißt:
chatwins.de Chatwin Chatwins Bruce Chatwin A
423 52. DeutschFranzösisches Volksfest Schaustellerverband Berlin e.V. Deutsch
10781
Berlin
Das mit Abstand größte jährliche Volksfest in Berlin Willkommen auf über 40.000m² Erlebnisfläche!
deutsch-franzoesisches-volksfest.de Deutsch Französisches Volksfest Laune
424 Beateberlin AGENTUR FÜR EVENTS beateberlin
10781
Berlin
beateberlin Agentur für Events und Stadterlebnisse in Berlin und Umgebung
beateberlin.de Beateberlin Agentur Agency
425 Berliner Berufsverband der Gesundheitsaufseher/Hygieneinspektoren BBGH
10781
Berlin
Der Berliner Berufsverband der Gesundheitsaufseher/Hygieneinspektoren stellt sich vor und bietet Informationsmaterial rund um den öffentlichen
bbghev.de BBGH BVH Hygiene
426 Organisationsberater Berater für Bio
10781
Berlin
Unternehmensberater für Ökologische Landwirtschaft (Biolandbau) und Biomarkt (Biohandel) ? Experte für Bio Lebensmittel und Biolandbau
bio-projektmanagement.de Bio Lebensmittel Bioprodukte
427 BeGreen Netzwerk für nachhaltiges beGreen Netzwerk für nachhaltiges Wirtschaften e.V. Verein
10781
Berlin
Alles Wissenswerte von der Historie über Ergebnisse Veranstaltungen und neueste Trends bis hin zur
begreen-net.de Verein Mitgliedschaft Beitrittserklärung
428 IOB Internationale OmnibusBetreibergesellschaft ZOB
10781
Berlin
ZOB Zentraler Omnibusbahnhof Berlin an Funkturm und Messegelände:
berlinzob.de ZOB Zentraler Omnibusbahnhof Berlin APC
429 Blauwerke verlag # groschenhefte blauwerke
10781
Berlin
Verlag aus Berlin fuer konkrete Literatur und konkrete Wissenschaft. Gebrauchstexte für die Westentasche.
blauwerke-berlin.de Blauwerke Blauwerke Berlin
430 Werbe und Vertriebsmangement GSW
10781
Berlin
Die “ FIGARO news” sind das GSW Club Magazin für die Mieter der GSW Immobilien
effektivwerbung24.de GSW Club Figaro News
431 Elena nehrmann promotion
10781
Berlin
Kultur Kommunikation
elenanehrmann.de Promotion P.r. Pr
432 MACKE Boutique Berlin
10781
Berlin
Mode ist Kultur Entsprechend diesem Motto bieten wir Ihnen stil und anspruchsvolle Mode und
macke-berlin.de
433 DigitalphotoBerlin Foto
10781
Berlin
Phototechnik Fehling Fotografie Bearbeitung Entwicklung Vergrößerung von Diabildern Digitalfotografien
digitalphoto-berlin.de Foto Fotografie Photo
434 Diethard Küster Regisseur
10781
Berlin
Diethard K¸ster Regisseur Produzent Autor Regie Produktion
diethard-kuester.de
435 HOME MEDIATION
10781
Berlin
ALEXANDER STAUBACH | MEDIATION | STAUBACHBERATUNG
staubach-beratung.de MEDIATION | KONFLIKT | KONFLIKTKLÄRUNG
436 BEOBOOKS Bücher aus Bücher
10781
Berlin
BEOBOOKS Bücher aus Serbien Katarina Belovukovic
beo-books.de Bücher Serbien
437 Bettina Willumeit | Styling bettina
10781
Berlin
innovatives kundenorientiertes Fashion Styling für die Bereiche Werbung Editorialproduktionen und Onlinevermarktung
bettina-willumeit.de Bettina Willumeit Stylistin
438 HOME
10781
Berlin
HOME
kunsttherapieraum.de
439 Joomla Toplist Hauptseite joomla
10781
Berlin
Dies ist die deutsche JoomlaTopseitenliste. Hier finden Sie die wahrscheinlich besten Seiten die mit
joomla-toplist.de Joomla Toplist Best
440 Jugendhilftweiter.de Jugend
10781
Berlin
Modellprojekt Jugendräte: Eine Homepage von den Jugendräten des Modellprojekts Jugendräte von Berlin SchönebergNord
jugend-hilft-weiter.de Jugend Hilft Weiter
441 LumpenPrinzessin ... Kinderkleidung Kinderkleidung
10781
Berlin
Die LumpenPrinzessin bietet seit über 15 Jahren Alles für Baby und Kind in gut erhaltener
lumpenprinzessin.de Kinderkleidung Kindermode Kinderschuhe
442 Herzlich Willkommen auf LittleThailand.de thai
10781
Berlin
Die neuesten und beliebtesten ThaiMassagen ThaiRestaurants Shops und mehr Mit vielen Bewertungen
little-thailand.de Thai Verzeichnis übersetzer Shops Restaurants
443 Evelyn Bornemann Berlin Berlin
10781
Berlin
Evelyn Bornemann in Berlin Physiotherapie Psychotherapie (HPG) Coach nach der TippingMethode hilft
evelyn-bornemann.de Berlin Physiotherapie Psychotherapie
444 ||| EuroKaukAsia     EuroKaukAsia e.V.
10781
Berlin
KaukasischEuropäischer Kultur und Wissenschaftsverin e.V.
eurokaukasia.de
445 Excelle.consulting | Produktions und excelle.consultin
10781
Berlin
excelle.consulting bietet kundenindividuelle Lösungen zu Fragen der strategischen Unternehmensentwicklung und der Gestaltung operativer Leistungsstrukturen sowie
excelle-consulting.de Excelle.consulting Excelle Excelle.de
446 F/21 Büro für Nora
10781
Berlin
f/21 Büro für Zukunftsfragen ist Beratungsinstitut und Denkfabrik. f/21 beobachtet die Gegenwart identifiziert
f-21.de Nora Stampfl Nora S. Stampfl
447 MEHR ALS STERNE |
10781
Berlin
Natalia Domagala
mehr-als-sterne.de
448 Investieren wie die Superreichen Investieren
10781
Berlin
Wie auch Sie schnell und einfach die Investments der Superreichen finden die nur ein
superreichtum.de Investieren Geld Anlegen
449 Mediation in Diversity Mediation
10781
Berlin
Mediation in Konfliktfällen Preisgünstige Mediationsausbildung nach anerkannten Standards von Bundesverbänden oder erfahrene Mediatoren? Kontaktieren
meddiv.de Mediation Berlin Mediationsausbildung Berlin
450 Jura Service Berlin | kaffeevollautomat
10781
Berlin
Jura Service Berlin| Kaffeemaschine u. Kaffeeautomat ReparturWartung u. Kundendienst in Berlin.Reparaturen von Kaffeemaschinen u.
jura-service-berlin.de Kaffeevollautomaten Reparatur Jura Service Kaffeemaschinen
451 Kanzlei Klaus Koblitzek homepage
10781
Berlin
homepage dokument webpage page web netz
kanzlei-koblitzek.de Homepage Dokument Webpage Page Web
452 Kanzlei Rechtsanwalt Böcker joomla
10781
Berlin
Joomla! dynamische PortalEngine und ContentManagementSystem
kanzleiboecker.de Joomla Joomla
453 Rechtsanwaltskanzlei und Notariat Michael Rechtsanwalt
10781
Berlin
Rechtsanwaltskanzlei und Notariat Michael Müller Rechtsanwalt und Notar Michael Müller in Berlin Schöneberg berät
kanzlei-mmueller.de Rechtsanwalt Notar Berlin
454 Schauspieler Coaching Berlin Karin
10781
Berlin
Mit dem KarriereTraining für Schauspieler durchstarten und dranbleiben. Die eigene Karriere lustvoll und aktiv gestalten.
karin-kleibel.de Karin Kleibel PR
455 LumpenPrinzessin ... Kinderkleidung Kinderkleidung
10781
Berlin
Die LumpenPrinzessin bietet seit über 15 Jahren Alles für Baby und Kind in gut erhaltener
kind-in-berlin.de Kinderkleidung Kindermode Kinderschuhe
456 Claudia Scholl Aktuelle Claudia
10781
Berlin
Claudia Scholl Buchkonzeption Gestalterische Konzepte Kinderkunstprojekte Illustration und Corporate Design
kartonzauber.de Claudia Scholl Berlin Kartonzauber Grafikdesign
457 Krups | Siemens | aeg
10781
Berlin
Krups | Siemens | AEG | ReparaturServiceWartung und Kundendienst in Berlin.Kaffeemaschinen und Kaffeevollautomaten
kaffeemaschine-reparatur.de Aeg Krups Siemens Kaffeevollautomaten Kaffeemaschinen
458 Home
10781
Berlin
Elzers Seiten zum Wohnungseigentumsrecht
oliverelzer.de
459 Patwork
10781
Berlin
Feinmechanik
pat-work.de
460 Peter Bruns Homepage Peter
10781
Berlin
Homepage von Peter Bruns
peterbruns.de Peter Bruns Cello
461 Rechtsanwälte PfaffHofmann u. Lee Rechtsanwalt
10781
Berlin
Die Rechtsanwaltskanzlei PfaffHofmann u. Lee legal Rechtsanwaltsgesellschaft bietet eine und zielorientierte Beratung. Schwerpunkt Wirtschaftsrecht z.B.
phl-legal.de Rechtsanwalt Rechtsanwaltskanzlei Arbeitsrecht
462 ..::Phoenix Lounge::.. Phoenix
10781
Berlin
Phoenix Lounge. Bar Restaurant Cafe in Schöneberg.
phoenix-lounge.de Phoenix Lounge Phoenix
463 Physimetron Elektronische Messtechnik Transimpedanzvers
10781
Berlin
Rauscharme analoge und digitale elektronische Messtechnik
physimetron.de Transimpedanzverstärker Pikoamperemeter Vorverstärker
464 Mobilienberlin.de living
10781
Berlin
mobilien: die schönen dinge zum leben wohnen und arbeiten! besuchen sie uns in berlinschöneberg...
mobilien-berlin.de Living Wohnen Wohnaccessoires
465 Otto Events Veranstaltungstechnik veranstaltungstec
10781
Berlin
Otto Events organisiert Ihre Veranstaltung in Berlin Brandenburg und Potsdam. Wir vermieten Veranstaltungstechnik
ottoevents.de Veranstaltungstechnik Berlin Potsdam
466 Naturheilpraxis im Hofbogen behandlung
10781
Berlin
Naturheilkunde Praxis Hofbogen Heilung Anwendung Rheuma Therapie Heilpraktiker
heilpraktikerin-schoeneberg.de Behandlung Therapie Körper
467 HALBE STUNDEN // HALF Kurzfilm
10781
Berlin
Film
halbestunden.de Kurzfilm Leere Familie
468 Flamencomeetsclassic flamenco
10781
Berlin
flamencomeetsclassic ist ein Tanztheater aus Berlin das klassische Texte Flamencomusik und Tanz zu
flamenco-meets-classic.de Flamenco Tanz Tanztheater
469 Flats Co. Flats & Co. GmbH Waldmannstr.
10781
Berlin
Eigentumswohnungen Waldmannstr. 3 BerlinLankwitz
flatsandco.de Waldmannstr. 3
470 Praxis für integrale Medizin Integral
10781
Berlin
Arztpraxis Dr. Martin Bosch BerlinSchöneberg
integralmedicine.de Integral Medicine Arztpraxis
471 Startseite
10781
Berlin
Anwälte Steuerberater PSInkasso
inkasso-in-berlin.de
472 Gerd Brendel | Journalist Gerd
10781
Berlin
Gerd Brendel Journalist
gerdbrendel.de Gerd Brendel Journalist
473 Autorin Martina Gneist CBT
10781
Berlin
Autorin Martina Gneist Projekte und Philosophie
gn-konzepte.de CBT WBT Lernkonzepte
474 Startseite hanslux Open
10781
Berlin
Beratung und Dienstleistungen für Computer Netze und ITSicherheit unter Verwendung von OpenSource Produkten
hanslux.de Open Source Freie Software
475 Theater Hans Wurst Nachfahren Grüffelo
10781
Berlin
Hans Wurst Nachfahren Theater für Kinder und Erwachsene in BerlinSchöneberg zeigt Spielplan
hasn-wurst-nachfahren.de Grüffelo Puppentheater Berlin
476 Organisationsberater Berater für Bio
10781
Berlin
Unternehmensberater für Ökologische Landwirtschaft (Biolandbau) und Biomarkt (Biohandel) ? Experte für Bio Lebensmittel und Biolandbau
handel-und-wandel.de Bio Lebensmittel Bioprodukte
477 Fachanwalt für Arbeitsrecht Berlin Fachanwalt
10781
Berlin
Fachanwalt für Arbeitsrecht Erbrecht und Versicherungsrecht in Berlin sowie Notar Berlin. Kanzlei Gäbelein
gaebelein-veith.de Fachanwalt Arbeitsrecht Versicherungsrecht
478 DFRV Regionalgruppe Berlin
10781
Berlin
| Website der Regionalgruppe Berlin des Deutschen Fundraising Verbands
fundraisingverband-berlin.de
479 Fußballwörterbuch in 7 Sprachen
10781
Berlin
FußballWörterbuch in 7 Sprachen: Homepage des Buches von Kaya Yildirim
fussballwoerterbuch.de
480 Felicitas Jacobs Theaterpädagogin Theater
10781
Berlin
Ich biete vielfältige theaterpädagogische Qualifikationen als Ausbildung oder Fortbildung initiiere theatrale Prozesse und entwickle
felicitasjacobs.de Theater Pädagogik Spiel
481 Organisationsberater Berater für Bio
10781
Berlin
Unternehmensberater für Ökologische Landwirtschaft (Biolandbau) und Biomarkt (Biohandel) ? Experte für Bio Lebensmittel und Biolandbau
conradthimm.de Bio Lebensmittel Bioprodukte
482 Startseite constant balance Fußpflege
10781
Berlin
Heilsame Behandlungen für Körper Geist und Seele Fußpflege Massagen und Heilarbeit
constant-balance.de Fußpflege Wellness Entspannung
483 Organisationsberater Berater für Bio
10781
Berlin
Unternehmensberater für Ökologische Landwirtschaft (Biolandbau) und Biomarkt (Biohandel) ? Experte für Bio Lebensmittel und Biolandbau
consultantfororganictrade.de Bio Lebensmittel Bioprodukte
484 Querschnitt Weine
10781
Berlin
Querschnitt Weine Weinhandlung in BerlinSchöneberg
querschnitt-weine.de
485 Startseite
10781
Berlin
Rechtsanwältin Sylvia PfaffHofmann: Ihr Recht in guten Händen! Spezialgebiete: Europarecht Einbuergerungsrecht und Asylverfahrensrecht
rechtsanwaeltinpfaff-hofmann.de
486 Praya ThaiMassage Startseite Massage
10781
Berlin
Praya ThaiMassage Ihre Praxis in Berlin bietet professionelle Physiotherapie und Massagen als therapeutisches
prayathai.de Massage Praxis
487 Startseite
10781
Berlin
Anwälte Steuerberater PSInkasso
ps-inkasso-berlin.de
488 Kanzlei Rechtsanwalt Böcker joomla
10781
Berlin
Joomla! dynamische PortalEngine und ContentManagementSystem
rechtsanwaltskanzlei-24.de Joomla Joomla
489 Fachanwalt Strafrecht Rechtsanwalt Fachanwalt
10781
Berlin
Fachanwalt Strafrecht Rechtsanwalt Feldkamp Berlin
rechtsanwaltskanzlei24.de Fachanwalt Strafrecht Rechtsanwalt
490 Reinigung360.de | Professionelle Gebäudereinigung Reinigung
10781
Berlin
Gebäudereinigung Büroreinigung Bauendreinigung Glassreinigung Laborreinigung Praxisreinigung Spezialreinigung Teppichreinigung
reinigung360grad.de Reinigung Reinigung Berlin
491 REISEDIENST WITTER: Tolle Reisen. Witter
10781
Berlin
REISEDIENST WITTER: Tolle Reisen. Viel Vergnügen!
reisedienst-witter.de Witter Reisedienst REISEDIENST
492 Schiek Sports Germany Bodybuilding Schiek
10781
Berlin
Offizieller Distributor Schiek Sports in Deutschland erhältlich Schiek Sports Schiek Sport Handschuhe
schiek-store.de Schiek Sport Handschuhe
493 Schiek Sports Germany offizieller Schiek
10781
Berlin
Offizieller Distributor von Schiek Produkten in Deutschland Fitness Bodybuilding Zubehör Fitnesshandschuhe Zughilfen Handgelenkschutz Bandagen
schiek-germany.de Schiek Fitnesshandschuhe Trainingsgürtel
494 HOME
10781
Berlin
Schulshirt Schulkleidung Schuluniform TShirts PoloShirts Sweatshirts Kapuzenshirts Kleidung Uniform Schule Freizeit Caps
scoolchic.de
495 Senioren Beratung Berlin Seniorenberatung
10781
Berlin
Seniorenberatung Berlin
senioren-beratung-berlin.de Seniorenberatung Pflegeheimberatung Neue
496 Datenschutzanalyse externer Datenschutzbeauftragter PrivCom Datenschutz GmbH Datenschutz
10781
Berlin
Wir organisieren als externe Datenschutzbeauftragte mit DatenschutzAudits Schulungen und Sicherheitstests datenschutzkonforme und sichere Prozesse.
privcom.de Datenschutz Audits Datensicherheit
497 PROMINENTENBAU© Prominentenbau
10781
Berlin
Erwachsene bauen mit LEGO Elementen für Kinder
prominenten-bau.de Prominentenbau Prominent DAI Lego Hellweg
498 PME PME
10781
Berlin
PME ProBau Management und Entwicklungsgesellschaft mbH
pme-gmbh.de PME ProBau Management Entwicklungsgesellschaft
499 Startseite
10781
Berlin
Rechtsanwältin Sylvia PfaffHofmann: Ihr Recht in guten Händen! Spezialgebiete: Europarecht Einbuergerungsrecht und Asylverfahrensrecht
recht24-berlin.de
500 IOB Internationale OmnibusBetreibergesellschaft ZOB
10781
Berlin
ZOB Zentraler Omnibusbahnhof Berlin an Funkturm und Messegelände:
iob-berlin.de ZOB Zentraler Omnibusbahnhof Berlin APC
501 Nina Petrick ? Autorin Nina
10781
Berlin
Nina Petrick freie Autorin für Kinder und Jugendbücher Belletristik und Kurzgeschichten. Ihr Jugendbuch
nina-petrick.de Nina Petrick Autorin
502 Digital Innovation Facilitator GuentherLange GmbH digitale
10781
Berlin
Mit Design Thinking systematisch zu kreativen Problemlösungen für das InternetBusiness: Jens Otto Lange moderiert Ideen
jensottolange.de Digitale Innovation Kreativität
503 Berlinatnight.de :: Stadtmagazin für Musikkalender
10781
Berlin
NightlifeGuide für Berlin: Clubs Bars Parties Tickets Kinoprogramm Konzerte
berlinatnight.de Musikkalender Movie Genießen
504 Www.djembeberlin.de
10781
Berlin
Du möchtest die westafrikanische Trommel Djembe spielen lernen. Hier findest du eine Liste von Lehrern
djembe-berlin.de
505 Naturheilpraxis im Hofbogen behandlung
10781
Berlin
Naturheilkunde Praxis Hofbogen Heilung Anwendung Rheuma Therapie Heilpraktiker
hofbogen.de Behandlung Therapie Körper
506 Theater Hans Wurst Nachfahren Grüffelo
10781
Berlin
Hans Wurst Nachfahren Theater für Kinder und Erwachsene in BerlinSchöneberg zeigt Spielplan
hans-wurst-nachfahren.de Grüffelo Puppentheater Berlin
507 Berliner Berufsverband der Gesundheitsaufseher/Hygieneinspektoren BBGH
10781
Berlin
Der Berliner Berufsverband der Gesundheitsaufseher/Hygieneinspektoren stellt sich vor und bietet Informationsmaterial rund um den öffentlichen
hygieneinspektoren.de BBGH BVH Hygiene
508 Kanzlei Rechtsanwalt Böcker joomla
10781
Berlin
Joomla! dynamische PortalEngine und ContentManagementSystem
kanzlei-boecker.de Joomla Joomla
509 ..::Phoenix Lounge::.. Phoenix
10781
Berlin
Phoenix Lounge. Bar Restaurant Cafe in Schöneberg.
phoenixlounge.de Phoenix Lounge Phoenix
510 Rosenscharf und Edelsüß Catering ZOE
10781
Berlin
Restaurant ZOE Berlin. Asiatische und mediterrane Küche zwischen Hackeschem Markt und Alexanderplatz in Berlin Mitte.
rosenscharf-edelsuess.de ZOE Restaurant Lounge
511 Tucanu Webseiten leicht Jürgen
10781
Berlin
tucanu der Weg zur eigenen Homepage leicht zu haben einfach zu bedienen
tucanu.de Jürgen Kubens Beratung
512 Nicolai Thärichen Komponist Arrangeur Thärichens
10781
Berlin
Nicolai Thärichen Komponist Arrangeur Pianist Aktuelles 2009 Thärichens Tentett Konzerte
thaerichen.de Thärichens Tentett Konzerte Myspace
513 Felicitas Jacobs Theaterpädagogin Theater
10781
Berlin
Ich biete vielfältige theaterpädagogische Qualifikationen als Ausbildung oder Fortbildung initiiere theatrale Prozesse und entwickle
theaterpaedagogische-kunst.de Theater Pädagogik Spiel
514 URBANIS Startseite URBANIS GmbH URBANIS
10781
Berlin
Herzlich willkommen bei der URBANIS GmbH
urbanis-berlin.de URBANIS Berlin Unternehmen
515 Ihre Website erstellen
10781
Berlin
Alles rund um die Website. Vorkonfiguriert oder maßgeschneidert für lokale Unternehmen aus Dienstleistung Handwerk
spreelink.de
516 Studio la voce Sängerin
10781
Berlin
Stefania Erzmoneit Habsburgerstrasse 5 10781 Berlin fon: 03021 99 68 23 fax:
studiolavoce.de Sängerin Sängerin Klang
517 Home Andrea Schlinkert Queer
10781
Berlin
Dies ist die Seite von Andrea Schlinkert Tanzlehrerin und Djane in Berlin.
tangoschlampen.de Queer Tango Queer Argentino
518 Willkommen auf der Startseite Tango
10781
Berlin
Tango Rueda eine Begegnung in vier Takten in Berlin
tangorueda.de Tango Rueda Berlin
519 VIEV | NEW
10781
Berlin
VIEV ? das sind Wagner Werner ein deutschchilenisches Designerkollektiv aus Berlin.
viev.de
520 Excelle.consulting | Produktions und excelle.consultin
10781
Berlin
excelle.consulting bietet kundenindividuelle Lösungen zu Fragen der strategischen Unternehmensentwicklung und der Gestaltung operativer Leistungsstrukturen sowie
excelle.de Excelle.consulting Excelle Excelle.de
521 Wanderreisen Pierolt Wanderreisen
10781
Berlin
Wanderreisen Pierolt Wandern im Spreewald Hüttenwanderung in den Lienzer Dolomiten Wandern rund
wanderreisen-pierolt.de Wanderreisen Pierolt Wandern Im
522 SammlungsVerkauf coupon
10781
Berlin
Webdealscout Suche deine Gutscheine Deals und Rabatte
webdealscout.de Coupon Gutschein Geschenk
523 Theo G. Gilbers Sexualpädagoge
10781
Berlin
Sexualpädagogische Fortbildung für pädagogische und psychosoziale Fachkräfte
theogilbers.de Sexualpädagoge Und Sexualtherapeut
524 Schmuckmanufaktur Berlin Goldschmiedin Schmuckmanufaktur
10781
Berlin
Schmuckmanufaktur Berlin Goldschmiedin Schmuck Trendart
schmuckmanufaktur-berlin.de Schmuckmanufaktur Berlin Goldschmiedin
525 LumpenPrinzessin ... Kinderkleidung Kinderkleidung
10781
Berlin
Die LumpenPrinzessin bietet seit über 15 Jahren Alles für Baby und Kind in gut erhaltener
schuhchen.de Kinderkleidung Kindermode Kinderschuhe
526 Robert Berghoff Berlin robert
10781
Berlin
Mit einfachem Blick auf die Dinge: Bildgestaltender Kameramann Director Of Photography Cinematographer
robertberghoff.de Robert Berghoff Filme
527 Schuldnerberatung Berlin Schuldenberatung Berlin Schuldnerberatung
10781
Berlin
? Schuldnerberatung Berlin vom Anwalt Privatinsolvenz Restschuldbefreiung Verbraucherinsolvenz Schuldenberatung Verbraucherinsolvenzverfahren. Rechtsanwalt Pillig Berlin
restschuldbefreiung.de Schuldnerberatung Berlin Privatinsolvenz Restschuldbefreiung Schuldenberatu
528 HOME
10781
Berlin
Schulshirt Schulkleidung Schuluniform TShirts PoloShirts Sweatshirts Kapuzenshirts Kleidung Uniform Schule Freizeit Caps
schulschick.de
529 Home ? Goldschmiede Schmuckbotschaften
10781
Berlin
Goldschmiede Schmuckbotschaften aus Berlin entwirft individuellen Schmuck!
schmuck-gewecke.de
530 Startseite
10781
Berlin
Anwälte Steuerberater PSInkasso
schygulla-inkasso.de
531 Gabriele Steiner Praxis für Ärztin
10781
Berlin
Gabriele Steiner Praxis für Homöopathie am Winterfeldtplatz in BerlinSchöneberg Ärztin für Allgemeinmedizin
steiner-gabriele.de Ärztin Homöopathie Homoeopathie
532 Stephan Szasz Startseite Über
10781
Berlin
Ich bin Stephan Szasz aus Berlin und erzähle euch auf dieser Webseite ein paar Geschichten
stephan-szasz.de Über Mich Hobby
533 Patwork
10781
Berlin
Feinmechanik
viosk.de
534 52. DeutschFranzösisches Volksfest Schaustellerverband Berlin e.V. Deutsch
10781
Berlin
Das mit Abstand größte jährliche Volksfest in Berlin Willkommen auf über 40.000m² Erlebnisfläche!
volksfest-berlin.de Deutsch Französisches Volksfest Laune
535 Apartment Dr. Claudia Malzfeldt
10781
Berlin
Startseite
westerlandapartment.de
536 Wirtschaftsmediatoren Berlin Wirtschaftsmediat
10781
Berlin
Wirtschaftsmediatoren Berlin
wirtschaftsmediatoren-berlin.de Wirtschaftsmediator Mediator Madiation Spannagel Eckolt
537 Home Musik
10781
Berlin
Kinderlieder Wir Kinder vom Kleistpark gute Musik für Kinder Konzerte für Kinder
wirkindervomkleistpark.de Musik Für Kinder Kinderkonzerte
538 Ölmühle Berlin Olivenöl
10781
Berlin
Olivenöl aus der ölmühle Berlin Schöneberg. Bei uns finden Sie ein Sortiment von über 60 meist
xn--lmhleberlin-qfb4f.de Olivenöl Olivenholz Balsamico
539 Home
10781
Berlin
Sachverständiger von der Handwerkskammer Berlin öffentlich bestellter und vereidigter Sachverständiger für das Dachdeckerhandwerk Steildacheindeckungen
xn--stutenbumer-heinz-wqb.de
540 Brautkleider alles für Kalamov und Kalamova GbR
10781
Berlin
Bei uns finden Sie moderne und günstige Brautkleider Abendmode Accessoires Dessous. Schneller
weddingssecrets.de
541 Anke Sevenich | Schauspielerin
10781
berlin
Anke Sevenich gehört zu den besten wenn auch eher unauffälligen Schauspielerinnen des deutschen Fernsehens
anke-sevenich.de
542 Restaurant AltÖsterreich Startseite Restaurant
10781
Berlin
Restaurant AltÖsterreich heißt: Echtes Wiener Schnitzel duftende Frittatensuppe eine ordentliche Portion Kaiserschmarrn oder
alt-oesterreich.de Restaurant AltÖsterreich Alt
543 Startseite Queer
10781
Berlin
Musikversierte und begeisterte Djane mit breitgefächertem Musikrepertoire für jegliche Anlässe buchbar. Ob Standard und Lateinmusik
andrea-schlinkert.de Queer Tango Queer Argentino
544 Welcome to Berlin Gym aktiv
10781
Berlin
Auf diesen Seiten findet Ihr alle Informationen rund um den Verein Berlin Gym ? Verein
berlin-gym.de Aktiv Fitness Kampfsporttraning
545 Berliner Berufsverband der Gesundheitsaufseher/Hygieneinspektoren BBGH
10781
Berlin
Der Berliner Berufsverband der Gesundheitsaufseher/Hygieneinspektoren stellt sich vor und bietet Informationsmaterial rund um den öffentlichen
bhbbev.de BBGH BVH Hygiene
546 Bing Ma Communication China
10781
Berlin
Neue Seite
bingma.de China Business Marketing
547 Schreibcoaching in Berlin Schreibcoaching
10781
Berlin
Schreibcoaching: Sie schreiben gerade an einer wissenschaftlichen Abschlußarbeit? Bringen Sie sich mit Schreibcoaching wieder in
faden-verloren.de Schreibcoaching Wissenschaftliche Abschlussarbeit
548 Ferienhaus Wittingen
10781
Berlin
Ferienhaus Wittingen
ferienhaus-wittingen.de
549 Organisationsberater Berater für Bio
10781
Berlin
Unternehmensberater für Ökologische Landwirtschaft (Biolandbau) und Biomarkt (Biohandel) ? Experte für Bio Lebensmittel und Biolandbau
consultantorganictrade.de Bio Lebensmittel Bioprodukte
550 Home
10781
Berlin
Brandenburger Tor Variationen mit FotoGalerie TorVariationen Brandenburg Berlin Logo
brandenburger-torheiten.de
551 Floorwalker.de Einfach. Schnell. floorwalker
10781
Berlin
Ein Floorwalker bietet nicht nur bei der Einführung neuer Software effektiven Support sondern auch
floorwalker.de Floorwalker Floorwalking Office
552 FHING Aktuell Werbung
10781
Berlin
für heute ist nichts geplant
fhing.de Werbung Postkarte Schwul
553 Restaurant AltÖsterreich Startseite Restaurant
10781
Berlin
Restaurant AltÖsterreich heißt: Echtes Wiener Schnitzel duftende Frittatensuppe eine ordentliche Portion Kaiserschmarrn oder
diodata-restaurant.de Restaurant AltÖsterreich Alt
554 Startseite House of House of Queer Sisters e.V. Queer
10781
Berlin
Wir sind Sisters und Guards die Gutes tun und dies überall wo wir gebraucht
house-of-queer-sisters.de Queer Sisters Schwulen
555 OnlineShop Bastelkits. Made
10781
Berlin
Wir haben ein Kit entwickelt mit dem man gleich loslegt in dem gute
bastelkits.de
556 Linda Sixt Linda
10781
Berlin
Linda Sixt
linda-sixt.de Linda Sixt
557 Lofts Co. Lofts & Co. GmbH lofts
10781
Berlin
Lofts Co. Best in Lofts!
loftsandco.de Lofts Berlin Dachwohnung Berlin
558 Antiquariat Mertens und Pomplun Antiquariat Mertens & Pomplun GbR Antiquariat
10781
Berlin
Antiquariat antiquarische Bücher OriginalPhotographien Fotografie Plakate Landkarten Luxuspapier
mp-rarebooks.de Antiquariat Antiquarische Bücher
559 MR Patterns Willkommen Nähen
10781
Berlin
Mr Patterns das Schnittstudio fuer SelberMacher
mrpatterns.de Nähen Schnittmuster Schnittkurs
560 Psychotherapie und Coaching in
10781
Berlin
Sie suchen einen Psychotherapeuten oder Coach in Berlin? Sie sind in einer schwierigen privaten oder
monika-holz.de
561 Gaastra Napapijri Diesel online Markenmode
10781
Berlin
Fashiontex 24 Online Shop. Ihr Designer Online Shop mit Markenbekleidung wie Gaastra Jacke Poloshirt
fashiontex24.de Markenmode Gaastra Napapijri
562 Heilpraktikerin in Berlin Schöneberg Homöopathie
10781
Berlin
Isabel Blume Heilpraktikerin Klassische Homöopathie und Shiatsu in Berlin
isabel-blume.de Homöopathie Klassische Homöopathie
563 Http://www.KinderladenKonfetti.de
10781
Berlin
Mitten im Schöneberger Winterfeldtkiez in Berlin liegt der kleine bunte Kinderladen Konfetti. Zwei Erzieherinnen
kinderladen-konfetti.de
564 MUTTER RESTAURANT BAR BERLIN thai
10781
Berlin
Die MUTTER in Berlin Schöneberg bietet vom Frühstück im Außenbereich thailändischer Küche und Cocktails
mutter-berlin.de Thai Bar Berlin Thaifood Frühstück
565 Zuhause Mundgerecht Magazin Save
10781
Berlin
MUNDGERECHT ist mehr als nur ein Magazin. Eigentlich sind wir ein soziales Startup mit einer
mundgerecht-magazin.de Save Food Nachhaltiges Essen
566 Home Siebergraphic Siebergraphic Berlin
10781
Berlin
siebergraphic macht die Grafik für Sie in Berlin Nürnberg und Umgebung. Egal was
siebergraphic.de Berlin Grafik Illustration
567 Schlüsseldienst Tempelhof Endpreise direkt Schlüsseldienst
10781
Berlin
Günstiger Schlüsseldienst für Tempelhof. Probleme mit Ihrem Türschloss? Kein Problem. Wir helfen kostengünstig schnell
schluesseldienst-tempelhof-berlin.de Schlüsseldienst Tempelhof Ihr Schlüsseldienst
568 StoppRitalin | Die ScherretMethode Wachstumsstörunge
10781
Berlin
Bei immer mehr Kindern und Jugendlichen in Deutschland stellen Ärzte Aufmerksamkeits und Hyperaktivitätsstörungen fest.
stopp-ritalin.de Wachstumsstörungen ADHS Ritalin StoppRitalin ScherretMethode
569 HOME
10781
Berlin
HOME
ulrikespeyerer.de
570 Wellfina Wellness Fitness Naturheilkunde
10781
Berlin
Angebot: Personal Training Ernährungsberatung Mesotherapie (Anti Aging) Kinesiologie Neuraltherapie Schröpfen
wellfina.de Naturheilkunde Heilpraktiker Personaltraining
StadtBranche.de Orts-Portrait von Berlin in Berlin. Die Themenseite zu Neueröffnungen, verkaufsoffene Sonntage, Gutscheine und Coupons in Berlin erhält 3 StadtBranche Punkte - Bewertet wird die Anzahl der Besucher dieser Themenseite. Stand: + Kontakt

Berlin
Berlin ist die Bundeshauptstadt der Bundesrepublik Deutschland und zugleich eines ihrer Länder. Die Stadt Berlin ist mit rund 3,5 Millionen Einwohnern die bevölkerungsreichste und mit 892 Quadratkilometern die flächengrößte Gemeinde Deutschlands sowie nach Einwohnern die zweitgrößte der Europäischen Union. Sie bildet das Zentrum der Metropolregion Berlin/Brandenburg und der Agglomeration Berlin . Der Stadtstaat unterteilt sich in zwölf Bezirke. Neben den Flüssen Spree und Havel befinden sich im Stadtgebiet kleinere Fließgewässer sowie zahlreiche Seen und Wälder.

LandkreisKreisfreie Stadt Berlin
BundeslandBerlin
Postleitzahl10785
Vorwahl030
BahnhofBerlin Potsdamer Platz
Finanzamt