
Berlin › Kreisfreie Stadt Berlin › Berlin

Branchenbuch Berlin 10783 Berlin

Kreisfreie Stadt Berlin
Berlin (Gemeinde in Berlin) gilt als Großstadt / Metropole in Berlin. Berlin als Kreisfreie Stadt hat 3.501.919 Einwohner.
1 Lead-Generator mit automat. Immobilienbewertung Immobilien

Lead-Generator mit automatisierter Immobilienbewertung (PDF) als Komplettlösung für Makler. Einfach, individualisiert & automatisiert. Jetzt KOSTENLOS loslegen...
leadmarkt.ch Lead Leads Generator Immobilienbewertung Makler Minuten Immobilienbewertungen Word
2 Hilfe bei Essstörungen - Schwerpunktpraxis bei Psychotherapie

Wenn Hunger nicht das Problem ist, dann ist Essen nicht die Lösung. Als Heilpraktikerin für Psychotherapie arbeite..
hilfe-bei-essstoerungen-berlin.de/ Essstörungen Ich Berlin Essen Binge Bulimie Eating Essstörung
3 GO Kfz Gutachter Berlin Kfz Gutachter

Erstellung von Sachverständigengutachten für Kraftfahrzeuge, Schadenbewertungen bei Unfällen, Unfallrekonstruktionen, Technische Prüfungen von Fahrzeugen, Bewertung von Schäden an..
4 Berliner Umzugsservice Umzugsservice

Unser Berliner Umzugsunternehmen bietet zuverlässigen und sorgfältigen Service bei Ihrem Umzug. Mit unserem erfahrenen Team und modernen..
berliner-umzugsservice.de/ Cuse Helvetica Lucida Not Prefetchable Berlin Arial Firma
5 Reinigungs Kommando (Reinigungsfirme Vienna) Reinigungsdienstleistungen

Wir, das Reinigungskommando, sind eine Putzfirma. Wir bieten professionelle Hilfe im Kampf gegen den Schmutz und für..
reinigungskommando.at Stylable Play Reinigung Post Ba Blog Containermain Kcp
6 MST Sicherheitsdienst Sicherheitsdienst

MST Sicherheitsdienst bietet Security Service in Berlin und Umgebung Kunden aus allen Branchen Objektschutz Veranstaltungsschutz - Baustellenbewachung..
sicherheitsdienst-berlin.com Berlin Sicherheitsdienst Security Service Kunden Umland Sicherheit Unsere
7 Berlin SEO Freelancer SEO Freelancer

Meine Name ist Noah Lutz und ich bin in Berlin Ihr SEO Freelancer auf Augenhöhe. Ob Anwalt..
berlin-seo-freelancer.de/ Freelancer Cuse Google Berlin Ich Noah Not Prefetchable
8 Regenbogenspuren Haustier Andenken

Sie möchten ein personalisiertes Andenken an Ihr Haustier? Unsere personalisierten Andenken sind ein ganz besonderes Geschenk, um Ihr..
regenbogenspuren.de/ Dateget Regenbogenspuren Boxenschilder Contact Toll Berlin Tiergrabsteine Grablichter
9 Zahnarztzentrum am Kurfürstendamm Zahnarzt

Schreibe mir ein Text über das Zahnarztzentrum am Kurfürstendamm und die angebotenen Leistungen. Das Zahnarztzentrum am Kurfürstendamm bietet..
zahnarzt-berlin-kurfuerstendamm.de Zahnarzt Zahnimplantate Berlin Kurfürstendamm Prophylaxe Infos Zähne Zahnmedizin
10 Berliner Umzugsunternehmen Umzugsunternehmen

Bei uns erhalten Sie alles aus einer Hand: vom passenden Möbelwagen bis zum Umzugsmaterial in Berlin –..
berlinerumzugsunternehmen.de/ Umzugsunternehmen Berlin Sans Symbol Umzug Segoe Emoji Extra
11 Umzugshelfer-Berlin.eu Umzugsunternehmen

Bei uns erhalten Sie alles aus einer Hand: vom passenden Möbelwagen bis zum Umzugsmaterial in Berlin –..
umzugshelfer-berlin.eu/ Berlin Umzug Umzugsunternehmen Montserrat Angebot Berlineu Font Umzugshelfer
12 Olymp Umzüge Umzugsunternehmen

Bei uns erhalten Sie alles aus einer Hand: vom passenden Möbelwagen bis zum Umzugsmaterial in Berlin –..
olymp-umzuege.de/ Berlin Umzugsunternehmen Umzug Montserrat Angebot Ihr Unternehmen Font

TOTENKOPF FRAKTION bietet eine große Auswahl an Totenkopf-Kleidung, Totenkopf-Schmuck und Accessoires an...
totenkopf-fraktion.de Totenkopf Fraktion Ring Shirts Shopify Shopifyroutes Shopifyshop Shopifylocale
14 Supervision und Coaching Supervisorin Coach

Systemische Supervision für Teams, Gruppen und Einzelpersonen zur Reflexion von Ressourcen und Herausforderungen im beruflichen Alltag mit..
ruth-kaukewitsch.de Coaching Supervision Teamentwicklung Berlin Stringfrom Arrayflag
15 bestesparer Fashion

Berlin, Germany
Was hält Sie davon ab, Ihre Lieblingssachen zu kaufen? Ihr Budget und die hohen Preise? Dann machen..
bestesparer.de/ Website Beste Bewertungen Blogs Rabatt Geld Marken Gutscheincodes
16 Rohrreinigung Berlin ROHRMED Rohrreinigung

Rohrreinigung in ganz Berlin Verstopfungsbeseitigung aller Art..
17 Privatumzug - Büroumzug Berlin - Umzugsfachspedition Umzugsunternehmen

Wir sind Ihr kompetenter und zuverlässiger Umzugspartner in allen Fragen der Planung und des Transports. Für den Privatumzug..
umzugsfachspedition.berlin Umzug Berlin Umzugsfachspedition If Warning Array Oswald Divi
18 Berliner Weddingplaner Weddingplaner

Ich bin ein professioneller Hochzeitsplaner in Berlin und helfe Paaren dabei, ihren perfekten Hochzeitstag zu planen. Von..
berliner-weddingplaner.de/ Cuse Berlin Helvetica Lucida Not Prefetchable Weddingplaner Awesome
19 Wir verlegen Estrich Flooring Contractor

Bessemerstraße 82 10. OG Süd, 12103 Berlin
Engagierter Estrichleger in Berlin und Umgebung. Qualität begeistert. Für Ihre Villa in Zehlendorf, die Altbau-Sanierung in Charlottenburg..
wirverlegenestrich.de Estrich Estrichleger Bayern Alz Opening Str Weißenburg Jahren
20 Umzugsunternehmen Bernau bei Berlin Umzugsunternehmen

Bernau bei Berlin
Ein Wohnortwechsel in Bernau bei Berlin oder nach Dachau oder doch nach Braunschweig bedeutet im ersten Moment..
umzugsunternehmen-bernau-bei-berlin.de Bernau Berlin Umzug Angebot Umzüge Umzugslogistik Unsere Umzugsunternehmen
21 Philipp Nedelmann Heilpraktiker

Sie leiden unter chronischer Erkrankungen, Schmerzen, Verdauungsprobleme oder Erschöpfung und Burnout? Wir sind eine Heilpraktiker-Praxis, die sich..
philippnedelmann.de/ Berlin Therapie Heilpraktiker Nedelmann Praxis Philipp Prenzlauer Berg
22 felmo Mobiler Tierarzt Berlin Tierarzt

felmo ist der mobile Tierarzt in Berlin, der stressfreie Hausbesuche für Hunde und Katzen anbietet. Unsere kompetenten..
felmo.de/tierarzt/berlin?utm_source=directories&utm_medium=referral&utm_campaign=stadtbranche Tierarzt Berlin App Tierärzte Leistungen Termin Hausbesuch Tierärztin
23 Eberhardt Service Group GmbH Hausmeisterdienstleistung

eberhardt-service.de/ Montserrat Poppins Bold Stylable Italic Post Service Bookings
24 Komfort Polsterei Polsterei

Wir von Komfort Polsterei kümmern uns um Ihre Möbel. Ganz egal, ob die Polster neu bezogen werden..
komfort-polsterei.de/ Sans Rotate Fade Blur Zoom Berlin Fly Roll
25 Norva24 Deutschland GmbH Rohrreinigung

Norva24 in Deutschland besteht aus mehreren Unternehmen mit verschiedenen Niederlassungen. Wir sind auf UIM (Underground Infrastructure Maintenance)..
norva24.de/ Borlabs Berlin Rohrreinigung Deutschland Norva Gmb Nitro Eventnitro
26 NK Cleaning Service Reinig

Sie suchen eine seriöse Reinigungsfirma in Berlin? Dann sind Sie bei uns genau richtig. Wir sind seit..
nk-cleaningservice.de/ Berlin Modern Browsers Reinigung Service Jost Compat Modes
27 Versicherungen Versicherungsmakler

Wir bieten individuelle Konzeptionen spezialisiert auf KFZ Händler und KFZ Werkstätten. Doch auch für alle anderen Gewerbetreibenden..
aurekon.de/ Montserrat Poppins Bold Italic Regular Post Blog Member
28 Matratzen Matratzen

Karibian verkauft bereits seit 1998 in sieben Ländern erfolgreich Premium Matratzen und produziert jährlich mehr als 65000 Schlafeinheiten. Bei..
karibianhome.de/ Wunschliste Kaltschaum Federkern Naturlatex Matratzen Gel Visco Produkte
29 Stagerockers Kommunikation

Stagerockers.de bringt mehr als die meisten zeitraubenden Seminare. Nutze unsere sofort anwendbaren Tipps & Tricks. Für Deine..
stagerockers.de/ Hörbuch Video Seminar Training Storytelling Coaching Präsentation Coach
30 ReproBerlin GmbH Digitaldruckerei &

ReproBerlin ist Ihre Digitaldruckerei und Copyshop in der Hardenbergstraße 7 in 10623 Berlin Charlottenburg Mo-Fr 9:30-18:30, Sa 11:00-16:00..
reproberlin.de Berlin Charlottenburg Digitaldruckerei Copyshop Mo Fr Sa Repro
31 Personalberatung Personalvermittlung

HSC Personalmanagement ist Ihre Personalberatung wenn es um die Personalsuche von Fach- und Führungskräften geht. Unsere Headhunter..
hsc-personal.de Personalberatung Headhunter Search Unternehmen Executive Kandidaten Führungskräfte Personalvermittlung
32 No3 Schinkelplatz Apartments

Luxus Serviced Apartments in Berlin-Mitte..
no3-schinkelplatz.com/ Schinkelplatz Residence No Berlin Residences Townhouse Superior Residenzen
33 Sophie Brand Studio Fotograf

Sophie Brand Studio: Mietstudio in Berlin der Fotografin Sophie Brand mit zwei wunderschönen und individuellen Locations mit..
sophiebrand-studio.de/ Berlin Tageslicht Sophie Brand Fotostudio Vorlieben Studio Arrayis
34 Sophie Brand Photography Photography

Emotionale, ausdrucksstarke & kreative Mode- & Portraitfotografie für Schauspieler*innen, Musiker*innen, Persönlichkeiten sowie für Firmen, Unternehmer*innen und Powerfrauen...
sophiebrand.de/ Safari Brand Individualität Deine Photography Bildern Fotografin Stärke
35 Naturheilpraxis Shop Gesundheits Online

Sie möchten Ihre Gesundheit aktiv unterstützen und Nahrungsergänzungsmittel kaufen – legen aber hohen Wert auf Qualität und..
naturheilpraxis-shop.de Ly Bewertung Reg Bewertungen Dateget Hook Adresse Mail
36 Berliner Immobiliengutachter Immobiliengutachter

Mit uns haben Sie einen zuverlässigen und fachkundigen Immobiliengutachter in Berlin. Alle Sachverständigen im Team agieren frei..
berliner-immobiliengutachter.de/ Sans Cuse Helvetica Segoe Arial Lucida Not Prefetchable
37 Dauerhafte Laser-Haarentfernung Berlin Schönheit &

Amara – Aesthetic- & Laserlounge ist ihr kompetenter und professioneller Ansprechpartner für dauerhafte Laser-Haarentfernung, apparative Kosmetik sowie..
amara-berlin.de Laser Haarentfernung Behandlung Haut Berlin Haare Amara Wellenlänge
38 Max Blinker E-roller

Wir bieten Ihnen Elektroroller in höchster Qualität sowie autorisierten und bequemen Service überall. Wir lieben eine nachhaltige..
39 meltus Studio Grafik

Sie suchen ein individuelles Bild mit dem Sie Ihr Produkt in den Vordergrund bringen können? meltus Studio..
meltus.de Studio Gallery Contact All Services Illustrations Product Visuals
40 Kaspar-Umzüge GmbH Umzugsunternehmen

Ein Umzug ist Vertrauenssache. Für einen sicheren und reibungslosen Umzug gibt es keine zweite Chance. Höchste Sorgfalt..
kaspar-umzuege.de Berlin Umzug Kaspar Umzüge Angebot Umzugsunternehmen Kontakt Mail
41 Quaabo Weiterbildung Berufskraftfahrer Weiterbildungen

Quaabo bildet seit 13 Jahren Berufskraftfahrer aus. (Weiterbildungen für Lkw-Fahrer & Busfahrer - Modul 95) Wir sind dazu..
quaabo.de Ausbildung Berufskraftfahrer Cookie Weiterbildung Quaabo Website Modul Informationen
42 Detektei Fahtz Berlin Detektei

Privatdetektei & Wirtschaftsdetektei Wir bieten unseren Mandanten seit mehr als über 20 Jahren seriöse und erfolgreiche Informationsbeschaffungen..
detektei-fahtz.de Berlin Detektei Privatdetektiv Mulifont Fahtz Anliegen Privatdetektive Unsere
43 Miteinander wachsen - Familienbegleitung Krabbelgruppe

Familienbegleitung Miteinander wachsen Berlin ich begleite engagierte und undogmatische Eltern, die sich für eine bedürfnisorientiere Erziehung interessieren und gleichzeitig..
miteinanderwachsen.org Eltern Kind Meine Shop Kontakt Leistungen Menü Gruppen
44 Sabayking Thai Massage Tempelhof Massage

Sabayking befindet sich direkt bei McFit in Berlin-Tempelhof und bieten Ihnen in unserer Wellnessoase ein in Deutschland..
thaimassage-tempelhof.de Massage Thai Sonnenstudio Berlin Tempelhof Sabayking Exklusive Sportmassage
45 Miteinander wachsen - Familienbegleitung Krabbelgruppe

Familienbegleitung Miteinander wachsen Berlin ich begleite engagierte und undogmatische Eltern, die sich für eine bedürfnisorientiere Erziehung interessieren und gleichzeitig..
miteinanderwachsen.org Eltern Kind Meine Shop Kontakt Leistungen Menü Gruppen
46 Sibolab UG Atemgastest Zur

Manche Krankheiten kann man riechen. Ein leicht süßlich-fruchtiger Acetongeruch etwa deutet beispielsweiße auf Diabetes, ein Ammoniakgeruch auf..
sibolab.de Arrayfrom Type Start Mathmin Untersuchung Sibo Reizdarm Sibolab
47 Dipl. Psych. Justyna Menke - Beratung Supervision Beratung

Supervision, Beratung, Elterncoaching, Hochbegabung, psychologische Beratung, Life Coaching, Outdoor Coaching, Business Coaching, Begabtenberatung, walk-and-talk-Coaching in Berlin..
justyna-menke.de Libre Post Bookings Blog Booking Objectassign Baskerville Stylable
48 Sparrks Business Coaching

Sparrks wurde 2021 als Berliner Start-Up ins Leben gerufen. Sparrks bietet eine selbstentwickelte B2B Coaching Plattform, die..
sparrks.io/ Coaching Sparrks Business Coaches Manrope Themen Unternehmen Mitarbeitenden
49 Berliner Fotoladen Fotoladen

Bei uns von IDEAL TREND finden Sie alles aus den Bereichen Bilderrahmen, Fotoalben und Kamerazubehör. Besuchen Sie..
berlinerfotoladen.de/ Important Bilderrahmen Fotouhren Kamerazubehör Kategorie Ihrem Versand Fotoalben
50 Matze Umzüge Services

Fühlen Sie sich festgefahren und fragen sich, wie Sie da rauskommen? Kein Grund zur Sorge; Rufen Sie..
matze-umzuege.de/ Sans Prefetchable Not Umz Awesome Matze Berlin Umzüge
51 Tante Emma Shop Online Lebensmittel

Bernau bei Berlin
Kennst Du mich noch? Ich bin es, Tante Emma. So wie du erwachsen geworden bist habe auch ich..
tanteemma.io/ Tante App Emma Du Dir Dich Kontakt Store
52 Handwerker-Berlin365 Allround-Handwerker

Meine Dienstleistungen werden im Raum Berlin und Umland angeboten. Die Arbeitszeit liegt im Zeitfenster zwischen 7.30 Uhr..
handwerker-berlin365.de Berlin Handwerker Speicherung Böden Art Zugriff Zustimmung Zweck

Anckeramic® Küchen Utensilien 100% handgefertigte Ceramico keramikreiben aus Finnland. Darunter Muskatnussreibe, Knoblauchreibe, Ingwerreibe, Parmesanreibe, Zitruspresse, Kaffeefilter-Halter..
anckeramic.de/ Fbw Text My Cormorant Helvetica Blog Ri Ligh
54 Strategieberatung Juliane Heinroth Unternehmensberatung

Positionierung, Strategie-Entwicklung & Kommunikation für kleine & mittelständische Unternehmen | Beratung, Workshops, Trainings & Umsetzungsbegleitung..
juliane-heinroth.de Mitarbeiter Menü Angebot Kommunikation Erstgespräch Kostenfreies Strategieberatung Kontakt
55 Zahnarztpraxis Spreekrone Zahnarzt

Willkommen in der Zahnarztpraxis Spreekrone Berlins Zahnspezialisten für die ganze Familie Moderne Zahnmedizin in entspannter Atmosphäre – kein Gegensatz..
spreekrone.de/ Zahnarzt Berlin Reinickendorf Praxis Termin Spreekrone Zahnarztpraxis Kontakt
56 DachProfi Berlin Services

Dachdecker ist ein Unternehmen in Berlin, das erstklassigen Service und Reparaturen für Dächer von Häusern und Gebäuden..
dachprofi.berlin/ Berlin Dach Dachdecker Ihr Wärmedämmung Dachbeschichtung Angebot Kontakt
57 LeadMarkt.ch Kostenloser Lead-Generator mit automatisierter Werteinschätzung Immobilien

Benutzerfreundlicher Leadgenerator für Makler & Werbeagenturen - prozessoptimiert durch mehrfache A/B-Tests. Geräteübergreifend, einfach & schnelle Integration in..
leadmarkt.ch/ Lead Leads Generator Immobilienbewertung Makler Minuten Immobilien Immobilienbewertungen
58 Tageslichtlampe Medizin

Tageslichtlampe Test – Die besten Tageslichtleuchten zur Lichttherapie Tageslichtlampen haben mittlerweile gut Fuß auf dem deutschen Markt gefasst..
tageslichtlampetest.com/ Tageslichtlampe Lux Lampe Beurer Test Tageslichtleuchten Philips Tageslichtleuchte
59 Praxis für systemische Therapie und Beratung Psychotherapie

Systemische Einzel-, Paar-, Familientherapie und Beratung, Traumafachberatung und Craniosacrale Körpertherapie...
praxis-benter.de Heilpraktikerin Berlin Sonja Benter Beratung Therapie Cranio Biodynamik
60 Hotel Dorint Kurfürstendamm Berlin Hotel

Die preisgekrönte Architektur von Jan Kleihues, spektakuläre Kunst von Lüpertz, Toscanelli & Kampmann sowie die einzigartig aufstrebende..
61 Hotel Essential by Dorint Berlin-Adlershof Hotel

62 Leadership Coaching München Coaching

Jeder Mensch ist anders. Individualität macht uns aus, das Leben spannend und lebenswert und stellt uns gleichzeitig oft..
leadership-coaching-muenchen.com/ Coaching München Leadership Eich Unternehmen Lioba Mitarbeiter Work
63 Sabayking Thai Massage & Wellness Charlottenburg Thai Massage

Sabayking ist Ihr exklusives Thai Massage und Wellness Studio in Berlin-Charlottenburg. Wir bieten Ihnen eine vielfalt an..
sabayking-thaimassage.de Massage Schmerzen Massagen Thai Unsere Stress Sabayking Muskeln
64 Maticz Technologies Software Development

Maticz is a Top Blockchain Development company in India that aims to help Fintech and other businesses..
maticz.com/ Development We Get Maticz Software Our Demo Web
65 Kunsttherapie | Ernährungsberatung | Innere Stärke Kunsttherapie und

Meine Grundhaltung: Meine Arbeit ist geprägt von der Wertschätzung für die jeweilige Familie, hochgradigem Einfühlungsvermögen in die aktuelle..
kunsttherapie-berlin.art/ Wnfo Text Wnf My Book Bookings Post Profile
66 Fahrschule Performance Tegel Fahrschule

Herzlich willkommen in der Performance-Fahrschule Filiale Berlin Tegel. Wir bilden in folgenden Klassen aus: Führerscheinklasse für PKW:..
performance-fahrschule.de Redirect Webkit Moz Khtml Homepage
67 LOVE DESTINATION Events - Pia Etzold Hochzeitsservice

Ich bin Hochzeitsplanerin & Event Designerin und plane Hochzeiten in Berlin und ganz Europa. Von den ersten..
lovedestination.events/ Luxes La Script Belleza Destination Berlin Tag Planung
68 Hire a Doctor Group Ärztevermittlung

Als Personaldienstleister im Gesundheitswesen vermittelt die Hire a Doctor Group medizinisches/pflegerisches Fachpersonal für Vertretungen in Gesundheitseinrichtungen und..
hireadoctor.de/ Cookie Website Doctor Hire Group Teams Informationen Unsere
69 Familiesportrait Portrait Zeichnen

Lass dein Foto professionell von uns zeichnen oder dein Bild malen lassen. Wir erstellen eine atemberaubende Zeichnung..
familiesportrait.de/products/portrait-zeichnen-lassen Farbe Foto Bleistift Fotovorlage Bleifstiftzeichnung Bild Portrait Offer
70 Majori Systems GmbH Informationstechnik

Majori Systems ist Ihr reliabler Kooperationspartner, bei allen Fragen rund um das Thema Microsoft 365. Mit unseren..
bertha-benz straße 5
71 COMPANIFY Franchiseberatung Unternehmensberatung Strategieberatung

Mit Franchisesystemen erfolgreich wachsen. COMPANIFY Franchiseberatung Berlin hilft Unternehmen und Gründern, die ein eigenes Franchisesystem aufbauen wollen. Ein..
companify.de/ Franchise Cookie Google Informationen Website Berlin Firmensitz Standort
72 Dreipeo - Die Hundeschule und Hundephysiotherapie Hundetraining Hundephysiotherapie

Hallo liebe/r Hundehalter/in! Mein Name ist Andrea Popp und ich bin zertifizierte Hundeerzieherin und Verhaltensberaterin (IHK Potsdam) mit..
dreipeo.de/ Hund Minuten Training Listenelement Link Element Befunderhebung Therapie
73 Hochdruckreiniger Testsieger Einkaufen

Dieser neue Ratgeber informiert seine Leser über die neusten Anbieter und Testberichte von Hochdruckreinigern...
hochdruckreinigers-testsieger.de/ Testsieger Hochdruckreiniger Alle Blick This Stringfrom Arrayflag
74 Hochdruckreiniger Testsieger Einkaufen

Dieser neue Ratgeber informiert seine Leser über die neusten Anbieter und Testberichte von Hochdruckreinigern...
hochdruckreinigers-testsieger.de/ Testsieger Hochdruckreiniger Alle Blick This Stringfrom Arrayflag
75 Rümpelgenie Cleaning

Wenn Sie in Berlin oder Umgebung wohnen und persönliche Hilfe bis hin zu Entrümpelungen oder Umzügen benötigen..
ruempelgenie.de/ Sans Montserrat Entrümpelung Berlin Rümpelgenie Service Cuse Entsorgung
76 Unicoaching-Berlin Wissenschaftscoaching

Bei jedem Arbeitsschritt auf dem Weg zur fertigen Masterarbeit werden Sie von kompetenten Wissenschaftlern begleitet. Wir leiten..
unicoaching-berlin.de/wissenschaftliches-coaching/masterarbeit/ Coaching Hilfe Seite Dissertation Forschung Wissenschaftliches Lektorat Qualitative
77 Agas Immobilien GmbH Immobilien

Herzlich Willkommen bei Ihrem Maklerbüro Agas Immobilien! Wir helfen Ihnen bei allen Belangen rund um Ihr jetziges..
agas-immobilien.de Berlin Immobilien Vermarktung Ort Ihr Agas Mwin Unsere
78 Wüstentouren wüstenreisen kameltrekking marokko Marokkoreisen

UNSERE ANGEBOT DES JAHRES 2022 – 6 für 5 Wenn Sie als Gruppe bei uns für sechs Personen..
wuestenperle.com Wuestenperle Marokkoreisen This Stringfrom Arrayflag Fwuestenperlecom Fgebirgstour Type
79 Abschleppdienst Krause Abschleppdienst

Einer der besten und zuverlässigsten Abschleppdienste in ganz Deutschland ist Krause Abschleppdienst. Wir bieten Abschleppdienste in allen..
abschleppdienst-krause.de/ Sans Abschleppdienst Berlin Krause Cuse Ihr Website Service
80 hellseher-magier.com Lebensberatung

Alles begann in Transsilvanien, im Herzen Rumäniens. Dort, wo Bram Stoker seine Inspiration holte und mit Vlad..
hellseher-magier.com/grandmaster-der-magie-ueber-mich Containerhtkcinline Ich Post Blog Objectassign Video Rumänien Captcha
81 Praxis für Homöopathie in Berlin Treptow Gesundheit

Diese Praxis für klassische Homöopathie liegt im ruhigen Baumschulenweg in Berlin. Die Heilpraktikerin behandelt hier in Treptow-Köpenick..
naturheilpraxis-homoeopathie-berlin.de Homöopathie Berlin Behandlung Details Heilpraktiker Praxis Treptow Köpenick
82 Praxis für Integrative Lerntherapie Margret Bradfield Lerntherapie

Hilfe beim Lesen, Schreiben und Rechnen bei einer LRS und Dyskalkuli...
lerntherapie-bradfield.de Cookie Lerntherapie Consent Praxis Lese Integrative These The
83 Euer Trauredner: Markus Lemke | Freie Hochzeitsredner

freietrauungberlin-markuslemke.de/ Trauung Markus Trauredner Berlin Hochzeit Trauzeremonie Lemke Freie
84 Mobile Hundeschule Fellkumpelz Berlin Brandenburg Hundeschule

Mein Name ist Tobias von den Fellkumpelz. Ich bin Hundeerzieher und Verhaltensberater mit IHK/ BHV Ausbildung und Abschlusszertifikat. Ich..
fellkumpelz.de Sans Open Hund Tobias Oswald Uv Training Fellkumpelz
85 Rechtsanwalt Uwe Heichel Rechtsanwalt

Rechtsanwalt Uwe Heichel in Berlin Charlottenburg-Wilmersdorf Das Immobilienrecht in Deutschland ist sehr komplex. Es wird beeinflusst von diversen..
rechtsanwalt-heichel.de Heichel Berlin Uwe Rechtsanwalt Feld Dieses Charlottenburg Wilmersdorf
86 Dave Brice Handy Jammer

jammer-store.de ist ein Störsender-Großhändler mit mehr als 15 Jahren Berufserfahrung, den Kunden die professionellsten Lösungen. https://www.jammer-store.de/WLAN-bluetooth-storsender.html..
jammer-store.de/ Störsender Antennen Signal Handy Handheld Bänder Wi Jammer
87 030 Immobilienbewertung Immobilienbewertung

Wir sind Ihr Ansprechpartner für eine unabhängige Immobilienbewertung in Berlin und Umgebung. Unsere Experten bieten dabei Gutachten..
030-immobilienbewertung.de/ Sans Cuse Awesome Helvetica Prefetchable Lucida Not Csvg
88 Dachdeckerei Briegmann Dachdecker

Wir von der Dachdeckerei Briegmann sind sowohl für Privatkunden als auch für Unternehmen, Architekten und öffentliche Auftraggeber..
dachdeckerei-briegmann.de/ Briegmann Dachdeckerei Berlin Dach Meisterbetrieb Kontakt Dachdeckermeister Team
89 June Six Hotel Berlin City West Hotel

Bohèmeflair, Künstlertreff, Institution im Nachtleben – der Berliner Savignyplatz ist der Hotspot in City West. In diesem..
june-six-hotels.com/hotels/berlin-city-west/ June Six Hotel Zimmer City Berlin West Uhr
90 IKARUS Steuerberatung in Berlin und Dessau Steuerberaterin

Wir sind Ihr zuverlässiger Steuerberater und decken sämtliche steuerrechtlichen Aspekte Ihres Unternehmens ab. Dazu gehören alle steuerrechtlichen..
ikarus-steuerberatung.de/ Steuerberatung Berlin Dessau Bettina Höll Steuerberaterin Lohnbuchhaltung Arial
91 Psychologische Praxis Zehlendorf | Psychotherapie & Psychotherapie

Die Psychologische Praxis Zehlendorf besteht aus einem Team hochqualifizierter Psychologen, Psychotherapeuten (HeilprG), Paartherapeuten und Hypnosetherapeuten. Unsere Praxis..
psychologische-praxis-zehlendorf.de Psychologische Praxis Zehlendorf This Stringfrom Arrayflag
92 EastSeven Hostel Berlin Hostel

EastSeven Hostel in Berlin - Du suchst nach einem gemütlichen Hostel in Berlin? Freue dich auf..
eastseven.de Sans Gothic One Berlin Prenzlauer Berg Hostel Segoe
93 Berliner Bausachverständiger Bausachverständiger

Wir sind Ihr zuverlässiger Bausachverständiger und Baugutachter in Berlin. Unser Team bestehend aus Spezialisten begleitet Sie bei..
berlin-bausachverstaendiger.de/ Sans Cuse Awesome Lucida Not Prefetchable Helvetica Berlin
94 Davinci Medic Ästhetische Medizin

Bei Davinci Medic Berlin stehen Sie als Patient im Mittelpunkt. Wir bieten Ihnen modernste wissenschaftlich fundierte Therapieverfahren..
davincimedic.de/ Tattooentfernung Berlin Eingewachsener Medic Zehnagel Entfernung Davinci Speicherung
95 Interior Studio Isabella Hamann Innenarchitektur

ELEGANTE HIGHLIGHTS FÜR JEDES INTERIOR Interior Studio Isabella Hamann bietet individuelle Planungen die auf die Bedürfnisse der..
ih-interiorstudio.com/ Giobagnara Leder Farbe Farben Designs Wildleder Materialien Italien
96 Zauber-Engel Zauberei mit Herz und Humor Künstler

Professionelle Zauberkunst Charmant, sympathisch, individuell Für alle Anlässe im Raum Berlin Brandenburg..
zauber-engel.de Berlin Zauberer Brandenburg Magie Ich Gäste Hochzeit Art
97 Wikinger Umzüge Umzüge

Es stehr ein Umzug wn und Sie benötigen professionelle Unterstützung von einer UMzugsfirma bei ihrem Umzug? Dann..
wikinger-umzuege.de/ Berlin Umzug Wohnungsauflösung Möbel Leistungen Umzugsunternehmen Umzüge Kontakt
98 BB Fliesen - Fliesenleger Berlin Handwerk

bb-fliesen.de Apx Fliesen Amin Berlin Mosaik Details Planung Prefetchable
99 Work-Life-Balance Coaching

14165 Berlin
Alle meines Coachings (Coaching für Führungskräfte, NLP-Kompaktkurs, Onlinekurse uvm.) zielen darauf, dich dabei zu unterstützen, deine Probleme..
work-life-balance-berlin.de Work Life Balance Coaching Berlin Online Coach Condensed
100 Dehler Coaching Coaching

Ich setze alles darauf an, das Potenzial meiner Klientinnen und Klienten voll auszuschöpfen und dabei Ideen zu..
dehlercoaching.de/ Coaching Berlin Dehler Business Ursula Coach Konfliktmoderation Führungskräfte
101 Rohr-Frei Berlin Rohrreinigung

Als Firma für Rohrreinigung in Berlin sind wir Ihr seriöser und erfahrener Ansprechpartner. Mit unserem Notdienst sind..
rohr-frei-berlin.de/ Sans Rotate Franklin Fade Blur Frei Zoom Roll
102 Odontik Odontik

Ihr Zahnarzt in Tempelhof VON PROPHYLAXE BIS ZAHNERSATZ Unser professionelles Team freut sich auf Ihren Besuch in unserer Zahnarztpraxis..
odontik.de/ Tempelhof Zahnarzt Stefanos Baraliakos Uhr Damm Unser Tempelhofer
103 Odontik Odontik

Ihr Zahnarzt in Tempelhof VON PROPHYLAXE BIS ZAHNERSATZ Unser professionelles Team freut sich auf Ihren Besuch in unserer Zahnarztpraxis..
odontik.de/ Tempelhof Zahnarzt Stefanos Baraliakos Uhr Damm Unser Tempelhofer
104 Resilienztraining Online Coaching

Viele neue Führungskräfte jonglieren am Anfang damit, plötzlich nicht mehr Team-Mitglied zu sein, sondern in der Rolle..
resilienztraining.online Reimann Resilienztraining Resilienz Führungskräfte Training Alexandra Mitarbeiterinnen Herausforderungen
105 Valera Medizinisches Kleintierzentrum Berlin Tierarzt

Valera – Medizinisches Kleintierzentrum ist ein tierärztliches Behandlungszentrum für Kleintiere. In unserem Standort in Berlin Zehlendorf beschäftigen..
valera.vet Product Tock Berlin Kleintierzentrum Team Medizinisches Tierarzt Menü
106 Ku´Damm 101 Design-Hotel Berlin Hotel

107 apprime GmbH | App Agentur Berlin App Entwicklung

Die App Agentur apprime GmbH aus Berlin bietet native iOS App und Android App Entwicklung, sowie hybride..
apprime.de App Sans Cookie Google Entwicklung Name Mobile Informationen
108 Berliner KFZ Gutachter KFZ Gutachter

Wir sind Ihr unabhängiger KFZ Gutachter in Berlin für fundierte Gutachten. Bei einem Unfall oder Schaden an..
berliner-kfzgutachter.de/ Cuse Lucida Prefetchable Not Helvetica Gutachter Auto Sans
109 Beschriftungen Druckerei Werbetechnik

Siebdruck, Museumsbeschriftung, Digitalisierung, Digitaldruck, Plattendruck, Kunstdruck, Folierung, Objektbeschriftung, Beschilderung, Schilder, Leitsysteme, datenbearbeitung, Fotodruck, Scans, Repros, Holzdruck..
110 Gon joy Africa - Ihr Afrika-Reisespezialist Reiseveranstalter

Gon joy Afrika - Ihr Afrika-Reiseveranstalter garantiert Ihnen authentische Begegnungen und erfahrene Guides. Wir sind mit Expertenwissen..
gonjoy-africa.de Reisen Afrika Safaris Africa Safari Go Tansania Kenia
111 PRIMEROS Erste Hilfe Kurs Berlin Friedrichshain Erste-Hilfe-Ausbildung

Berlin Friedrichshain
Erste Hilfe Kurs Berlin Friedrichshain - am besten bei PRIMEROS: Einfach einen Kurstermin wählen und mit ein..
primeros.de/erste-hilfe-kurse/erste-hilfe-berlin-friedrichshain/ Hilfe Erste Du Kurs Ersthelfer Kurse Berlin Friedrichshain
112 PRIMEROS Erste Hilfe Kurs Berlin Charlottenburg Erste-Hilfe-Ausbildung

Berlin Charlottenburg
Erste Hilfe Kurs Berlin Charlottenburg - am besten bei PRIMEROS: Einfach einen Kurstermin wählen und mit ein..
primeros.de/erste-hilfe-kurse/erste-hilfe-berlin-charlottenburg Hilfe Erste Du Kurs Ersthelfer Kurse Berlin Charlottenburg
113 PRIMEROS Erste Hilfe Kurs Berlin Mitte Erste-Hilfe-Ausbildung

Erste Hilfe Kurs Berlin - am besten bei PRIMEROS: Einfach einen Kurstermin wählen und mit ein paar..
primeros.de/erste-hilfe-kurse/erste-hilfe-berlin-mitte Hilfe Erste Du Kurs Ersthelfer Kurse Berlin Mitte
114 PRIMEROS Erste Hilfe Kurs Berlin Neukölln Erste-Hilfe-Ausbildung

Erste Hilfe Kurs Berlin Neukölln - am besten bei PRIMEROS: Einfach einen Kurstermin wählen und mit ein..
primeros.de/erste-hilfe-kurse/erste-hilfe-berlin-neukoelln Hilfe Erste Du Kurs Ersthelfer Kurse Berlin Neukölln
115 PRIMEROS Erste Hilfe Kurs Berlin Marzahn Erste-Hilfe-Ausbildung

Erste Hilfe Kurs Dachau - am besten bei PRIMEROS: Einfach einen Kurstermin wählen und mit ein paar..
primeros.de/erste-hilfe-kurse/erste-hilfe-berlin-marzahn Hilfe Erste Du Kurs Ersthelfer Kurse Berlin Marzahn
116 PRIMEROS Erste Hilfe Kurs Bernau bei Erste-Hilfe-Ausbildung

Bernau bei Berlin
Erste Hilfe Kurs Bernau bei Berlin - am besten bei PRIMEROS: Einfach einen Kurstermin wählen und mit..
primeros.de/erste-hilfe-kurse/erste-hilfe-bernau-berlin Hilfe Erste Du Kurs Ersthelfer Kurse Berlin Bernau
117 Metallzaun.de - Zäune und Tore aus Zaunbau

Der Zaunshop Metallzaun.de liefert robuste Zaunsysteme und Tore aus Aluminium nach Maß. Unsere Zäune sind pulverbeschichet nach..
metallzaun.de Stylable My Post Profile Blog Containerzvtnsinline Prompt Grid
118 Obsthof Berlin Obsthof

Wir sind ein junges Berliner Start-Up Unternehmen, dass es sich zum Ziel genommen hat Büros, Kanzleien etc...
obsthof-berlin.de/ Sans Cookie Slab Name Berlin Datenschutzerklärung Inhalte Obstkörbe
119 Zahnarztpraxis Neukölln Zahnarzt

Die Zahnarztpraxis Neukölln von Frau Dr. Petra Hartmann bietet Ihnen alle zahnmedizinischen Leistungen von A bis Z..
zahnarztneukoelln.com Behandlung Berlin Hartmann Neukölln Zahnarztpraxis Zahnarzt Uhr Zahnmedizin
120 THE OCEAN BETWEEN - Kunstausstellung Lifestyle

Internationale Kunstausstellung im Taxi Kundencenter „THE OCEAN BETWEEN“ Der Austausch zwischen Künstlerinnen aus Nordamerika und Deutschland steht in..
oceanbetweenartandculture.blogspot.com/ Neue Light Helvetica Blog Arial Link Facebook Twitter
121 Traumdisco-Berlin Veranstaltungen

Die Traumdisco-Berlin, eine ehrenamtliche Elterninitiative die einmal monatlich, freitags in „dieEICHE“, in der evangelischen Kirchengemeinde Neu-Westend..
traumdisco-berlin.de Berlin Traumdisco Neu Westend Disco Menschen Zipp Himmel
122 Aluzaun Zaun Zaunbau Gartentor Zaunbau

METALLZAUN.DE ist Hersteller für hochwertige Aluzäune und Gartentore und Briefkastensäulen. Wir produzieren für Sie Zaun- und Torsysteme..
metallzaun.de Stylable My Post Profile Blog Containerzvtnsinline Prompt Grid
123 Kebap with Attitude Gastronomie

Wir sind Berlins erstes new wave Kebap Restaurant. Was bedeutet das genau? Wir sind Berliner, wir lieben..
kebapyourlife.de My Subscriptions Grid Containercdmpinline Page Objectassign Bg Stylable
124 Peers Solutions GmbH Lernplattform

Peers ist die Softwarelösung für Personalentwicklung in der Industrie. Wir erstellen Lernpfade für Zukunftsthemen, indem wir die..
peers-solutions.com/ Peers Cookie Mitarbeitenden Website Solutions Google Name Informationen
125 Entsorgung Entrümpelung Wohnungsauflösung Berlin Kellerentrümpelung Müllentsorgung Entsorgung Entrümpelung

Entsorgung, Entrümpelung, Wohnungsauflösung, Berlin, Kellerentrümpelung, Müllentsorgung..
turbo-entsorgung.de Berlin Entsorgung Abfall Sperrmüll Service Abfälle Was Müll
126 Sperrmüll Entsorgung Entrümpelung Abholung Sperrmüll Entsorgung

Sie sind auf der Suche nach einer Entsorgungsfirma? Was genau haben zu entsorgen? Oder möchten Sie doch..
sperrmuell-berlin.com/ Berlin Sperrmüll Entsorgung Abholung Sondermüll Sperrmüllabholung Sperrmüllentsorgung Dienstleistungen
127 MBSR.berlin - MBSR & Achtsamkeitskurse beim Gesundheit

MBSR, Achtsamkeit & Meditation für Stressbewältigung und zur Verbesserung der Lebensqualität. Diplom-Psychologe Kirill Falkow ist vom MBSR..
mbsr.berlin Top Header Footer Sliding Action Side Recent Subheader
128 Online Marketing Agentur - NexTao GmbH Online Marketing

Ob SEO oder Webdesign, Printkampagnen, Grafikkonzepte oder Marketingstrategien: Die NexTao-Werbeagentur ist in jedem Fall Ihr kompetenter Ansprechpartner!..
129 Antiquitäten Schmuck und Altgold Ankauf Berlin Antiquitäten

Zum Standort Berlin des renommierten Unternehmens Haeger gehört auch die Antiquegalerie – wo Kunden gern ihre antiken..
antiquegalerie.de/standorte/antiquitaeten-berlin Ankauf Antiquitäten Kunst Gemälde Skulpturen Back Uhren Düsseldorf
130 Bellas Hochzeitsshop Hochzeitsshop

bellas-hochzeitsshop.de: Der Hochzeitsblog und Shop. Alles für den großen Tag! In regelmäßigen Artikeln informieren wir euch Neuigkeiten..
bellas-hochzeitsshop.de/ Alles Tag Hochzeitsshop Du Thema Hochzeit Dann Blog
131 Goldankauf Haeger GmbH Berlin Goldankauf

Kontaktieren Sie unsere Mitarbeiter bei der Haeger GmbH, wenn Sie zum Thema Ankauf per Post Fragen haben..
goldankauf-haeger.de/berlin/ Berlin Cookie Goldankauf Gold Gmb Haeger Schmuckankauf Informationen
132 Ku´Damm 101 Design-Hotel Berlin Hotel

133 Peilicke Telefonmarketing Telefontraining Telefoninkasso Weiterbildung

Durch meine Seminare, Trainings und Beratungen werden die Menschen ein Meister in der Kommunikation am Telefon...
peilicke-telefontraining.de Telefon Content Telefontraining Telefonakquise Header Peilicke Video Sans
134 Rheinische Scheidestätte GmbH Goldankauf Berlin Gold- und

Die Mitarbeiter der Rheinischen Scheidestätte GmbH sind für Sie da, wenn Sie zu fairen Konditionen Gold verkaufen..
rheinische-scheidestaette.de/goldankauf-berlin/ Goldbarren Krügerrand Goldpreis Goldmünzen Silber Silberbarren Gold Standort
135 Gabienoo- Systemische Therapie- Mediation- Supervision Paartherapie

Systemische Mediation, Therapie und Supervision aus Leidenschaft. Diplom-Pädagogin Februniye Gabienoo aus Berlin Schöneberg ist Ihre Expertin für..
therapie-mediation-supervision-berlin.de Berlin Therapie Supervision Coaching Systemische Mediation Beratung Ich
136 Sanus-Fahrdienst Behindertentransport Schülerbeförderung

Wir helfen Menschen mit unterschiedlichen körperlichen oder sonstigen Einschränkungen mobil zu bleiben. Wir bieten Ihnen pünktlichen, schnellen und..
sanus-fahrdienst.de/ Fahrdienst Sanus Kontakt Ziel Anfrage Informationen Personen Unsere
137 Anwalt Arbeitsrecht & Vertragsrecht Berlin | Rechtsanwalt Arbeitsrecht

Berlin (Dahlem)
Als ehemalige Unternehmensanwältin, Führungskraft und Personalleiterin (HR Business Partner) verfügt Frau Silke Hendrix nicht nur über das..
silkehendrix.de/ Cookie Name Borlabs Informationen Inhalte Website Line Datenschutzerklärung
138 Mietshausverkaufen Immobilien

Mietshausverkaufen bietet Ihnen einen schnellen und diskreten Weg Ihre Immobilie zu verkaufen. Wir suchen die für Sie..
mietshausverkaufen.de/mehrfamilienhaus-verkaufen Verkauf Immobilie Mehrfamilienhauses Mehrfamilienhaus Käufer Unterlagen Wohnungen Ihres
139 Waschmaschinen Reparatur Berlin Reparatur

Ob kaputte Waschmaschine, Wäschetrockner, Geschirrspüler, Herd/Ofen oder Fernsehr, Phoenix24 ist Ihr Reparaturdienst für Haushaltsgeräte in Berlin und..
phoenix-reparaturdienst.de/ Berlin Reparatur Waschmaschine Waschmaschinen Brandenburg Phoenix Hilfe Uhr
140 Fensterbauer24 Fenster

Wir sind als renommiertes Fensterbau Unternehmen in Berlin und Umland tätig. Fenstermontagen und -umbauten gehören zu unseren..
fensterbauer24.com/ Berlin Fensterbauer Fensterbau Nä Türen Kunden Fenster Reparaturen
141 MTS Umzüge Umzüge

Umzüge in Berlin..
mts-umzug-berlin.de/ Berlin Umzüge Umzug Angebot Umzugsunternehmen Umzugsangebot Sachen Umzugsgüter
142 Sanus-Fahrdienst Behindertentransport Schülerbeförderung

Wir helfen Menschen mit unterschiedlichen körperlichen oder sonstigen Einschränkungen mobil zu bleiben. Wir bieten Ihnen pünktlichen, schnellen und..
sanus-fahrdienst.de/ Fahrdienst Sanus Kontakt Ziel Anfrage Informationen Personen Unsere
143 Kiek rin Deutsche Küche & Catering Deutsche Küche

Muttern wie bei Muttern ... Täglich frische & leckere Gerichte..
kiek-rin.berlin Imbiss Partyservice Kiek Berlin Pankow Mittagsgerichte
144 SIGNAL IDUNA Versicherung Maria Radusch Versicherung

Die Haftpflichtversicherung ob privat oder betrieblich ist der Grundstein für ein sorgenfreies Leben, denn im Schadensfall bezahlt..
signal-iduna-agentur.de/maria.radusch Helvetica Calibri Arial Generalagentur Maria Radusch Ort Service
145 Blechdachhandel Berlin Baustoffe Handwerker

Blechdachhandel Berlin ist Ihr Spezialist für Trapezbleche und Blechdächer aller Art. Die Trapezbleche werden in eigener Produktion..
berlin-blechdachhandel.de/ Sans Blechdach Narrow Dach Lebensdauer Grad Blechdachs Cuse
146 Leadarchitekten Dienstleistungen

Wir kommen selber aus dem klassischen Mittelstand und wissen, wie viele Bälle unsere Kunden täglich jonglieren müssen...
leadarchitekten.de/ Vertriebsprozesse Vertrieb Wachstum Schritt Kunden Zeit Leadarchitekten Unternehmen
147 Berliner Brautmoden Brautmoden

Brautmoden, Brautkleider und Hochzeitskleider genau so individuell wie Sie, finden Sie in unserem Geschäft. Wir führen Kleider..
berliner-brautmoden.de/ Awesome Freefont Brautkleider Hochzeitskleider Brautmoden Performance Mutation Nitro
148 Shopyoga Versandhandel

shopyoga.de Yoga Zubehör Du Deine Kette Shop Mala Dir
149 CMD Zahnarzt Berlin Zahnarzt

Au weia, wir wissen schon, zum Zahnarzt geht keiner so richtig gern. Aber mit mehr als 20..
cmd-zahnarzt-berlin.de/ Berlin Zahnarzt Spezialisten Behandlung Therapie Dysfunktion Schmerzen Position
150 Zahnarztpraxis Sterndamm 9 Zahnarztpraxis

Wir arbeiten mit unterschiedlichen Meisterlaboren in Berlin zusammen. Durch die langjährige Zusammenarbeit sind wir, als Zahnarztpraxis Dr...
zahnarztberlin-drkhasin.de/ Berlin Sterndamm Zahnarztpraxis Zahnarzt Niederschöneweide Praxis Uhr Vereinbarung
151 Wichtel Umzüge GmbH Umzugsunternehmen

Als Berliner Umzugsunternehmen bietet die Firma Wichtel Umzüge GmbH professionelle Dienstleistungen aus dem Bereich Umzug und Transport..
wichtel-umzuege.de Umzug Umzugsunternehmen Umzüge Berlin Umzugshelfer Ihren Unsere Ihrem
152 FUNKE Reparaturservice Berlin-Brandenburg Waschmaschinen Reparatur

Sie möchten Ihre Haushaltsgeräte in ganz Berlin nach Belieben reparieren? Wenn das der Grund ist, dann entspannen..
153 Gebäudereinigung Klaus Gotzhein Gebäudereinigung

Herzlich willkommen bei der Gebäudereinigung von Klaus Gotzhein, Ihrem Fachwirt für Reinigungs- und Hygienemanagement in Berlin-Friedenau. Unsere..
gebaeudereinigung-gotzhein.de Gebäudereinigung Friedenau Gotzhein Berlin Klaus Website Geb Diese
154 Betriebsarztservice Arbeitsschutz &

Betriebsarztservice bietet Dienstleistungen im Bereich Arbeitsmedizin, Arbeitssicherheit und Arbeitspsychologie an acht Standorten in Deutschland an...
betriebsarztservice.de Kontakt Betriebsarztservice Mitarbeiter Ihr Standortseite Taxiarzt Praxis Fr
155 Zentherapie® Triggerpunkttherapie und Tiefe Bindegewebsarbeit - Heilpraktiker

Schmerzen und eingeschränkte Beweglichkeit hindern uns daran, frei und unbeschwert den Ereignissen des Alltags zu begegnen. Durch die..
heilpraxis-sommer.de Zentherapie Sommer Triggerpunkttherapie Tiefe Bindegewebsarbeit Zentherapy Heilpraktiker Heilpraxis
156 Hundeausführservice Dogs in Nature Dogwalking und

Dogs in Nature ist ein professioneller Hundeausführservice mit Abhol- und Bringservice. Lutz Rechenberg ist ausgebildeter Hundetrainer und..
dogs-in-nature.berlin Nature Dogs Hundeausführservice Hunde Berlin Dogwalking Hunden Hund
157 SevenDays Transports Berlin Umzugsunternehmen

Ein starker Partner für Umzüge, Transporte und Haushaltsauflösungen in Berlin - Preiswert & transparent. Vereinbaren Sie noch heute..
sevendays-transports.de Berlin Umzug Transports Umzugsunternehmen Seven Ihr Ihren Angebot
158 BU-Hilfe.de - Experten bei Berufsunfähigkeit Fachanwalt Versicherungsrecht

Die BU-Hilfe.de besteht aus einem Team hochspezialisierter Fachanwältinnen für Versicherungsrecht, die berufsunfähige Versicherte bei der Anmeldung und..
bu-hilfe.de Versicherer Cookie Informationen Versicherte Versicherten Leistungen Daten Arial
159 Tischlerei Gelbstein Tischlerei

Wir sind ein anerkannter Handwerks-, Ausbildungs- und Meisterbetrieb für Innenausbau / Fachgerechte Türen Einbau / Fenster Einbau..
tischlerei-gelbstein.de/ Tischlerei Unsere Meisterbetrieb Wartung Gelbstein Fachbetrieb Rauchmelder Brandschutztüren
160 AK-Bau Innenausbau

Baufirma in Berlin ---- Wir sind ein zuverlässiges Unternehmen für Wohnungsbaugenossenschaften, Hausverwaltungen sowie Privat- und Gewerbekunden. Unser Leistungsschwerpunkt bezieht..
ak-bauberlin.de Berlin Komplettsanierungen Bau Badmodernisierung Leistungen Beleuchtung Logo Deckensegel
161 Flugs Bauunternehmen Pflasterarbeiten

Flugs Bau - ein Bauunternehmen für alle Dinge draußen. Wir sind ein Unternehmen mit den Schwerpunkten Garten-..
flugsbau.de/ Berlin Bauunternehmen Winterdienst Tiefbau Straßenbau Mediumttf Flugs Brandenburg
162 Fitnessgeräte-Test.de Testberichte

Das Portal Fitnessgeräte-Test.de informiert über Fitnessgeräte. Im Vergleich werden die Testsieger in den Kategorien Laufbänder, Crosstrainer, Ergometer..
163 Deutsche Lebensversicherungs-AG Versicherung Lebensversicherung

Die Deutsche Lebensversicherungs-AG (DLVAG) aus Berlin* bietet ihren Geschäfts- und Privatkunden, als Spezialversicherer der Allianz, ausschließlich Lösungen..
164 Fashion Almanac Fashion Blog

Berlin, Germany
Fashion Almanac is a blog that features articles on topics including fashion trends for men and women..
fashionalmanac.net The You This Rebecca There If It But
165 DiVa Eventservice GbR Event Agentur

Wir unterstützen Sie bundesweit. Auf Veranstaltungen präsentieren wir Sie kompetent. Ihren Event begleiten wir stilvoll und mit..
diva-eventservice.com Gmb Berlin Personal Entertainment Event Mitarbeiter Kontakt Di
166 prima klima - no limits! travel Reisebüro

prima klima – no limits! bietet hochwertige Ski-, Motorrad- und Familienreisen an. Unsere Bus- und Gruppenreisen führen..
nolimits.de Angebot Ski Merkzettel Dieses Tour Hotel Skisafari Powder
167 Corona Schnelltest Reinickendorf Berlin Gesundheitswesen

Wir sind Ihr Corona Schnelltest Partner im Berliner Stadtteil Reinickendorf und Umgebung für schnelle und sichere Antigen-Schnelltests...
corona-test-reinickendorf.de/ Berlin Reinickendorf Teststelle Schnelltest Corona Covid Antigen Uhr
168 feinreparatur Smartphone

Smartphone, Laptop, Macbbok pro, Imac, Computer Reparatur in Berlin. Wir führen für Hard und Software Reparaturen ..
169 Doolado Agentur Digital Marketing

Doolado Agentur für Online Digital Marketing ✓ sowie Mobil Apps Ios Android App ✓App Entwicklung ✓Flutter..
doolado.de/ Marketing App Ihr Online Cookie Agentur Apps Mobile
170 Belvedere Zahnärzte Dr. Ohling & Ohling Zahnarztpraxis

Ihre Bestellpraxis mit Wohlfühlatmosphäre bei geringsten Wartezeiten in Berlin-Westend. Ihre Wünsche sind die Basis für unsere kompetente..
ohling.de/ Ohling Erfahren Dr Asset Zahn Belvedere Uhr Behandlung
171 SiBa Wirtschaftskanzlei GmbH Gründungsberatung Gründungsagentur

Unser Schwerpunkt liegt darin, Sie als Unternehmer zu unterstützen, schnell und unkompliziert Ihre Geschäftstätigkeit aufnehmen zu können...
siba-wirtschaftskanzlei.de/ Gmb Treuhand Vorrats Cookie Gründung Informationen Website Google
172 ABEX Stahlbau – Rohrbiegen – Stadtmöbel Metallbau Gartenbau

Hochwertige Pflanzkübel für grüne Innenstädte. Edelstahl – Cortenstahl für angesagte Rostoptik – Aluminium – Zink oder feuerverzinkte Metalle:..
pflanzkuebel-abex-berlin.de Seite Pflanzkübel Comic Sans Hier Neues Kürze Tage
173 TransLina Dolmetscher & Übersetzungsbüro Übersetzungen &

Wir übersetzen Urkunden jeder Art • Zivilstandwesen (Geburtsurkunden, Geburtsregister, Heiratsurkunden, Eheschließungsverträge, Eheregister, Personalausweise, Reisepässe, Zivilmelderegister, Familienbücher, Sterbeurkunden, Sterberegister..
translina.de Cavalry Facebook Ij Aa Unternehmen Einstellungen Intl Informationen
174 Sushi For You Lieferservice

Sushi for You ist ein Zusammenschluss selbständiger Unternehmer, die unter der gemeinsamen Marke einen einheitlich hohen Standard..
sushi-for-you.de/ Sushi Lieferservice For You Dein Berlin Köln Dortmund
175 Online Marketing Consulting | Kapuze statt Onlinemarketing

Kapuze statt Mütze bietet innovatives und kreatives Online Marketing Consulting aus Berlin. Die Leistungen umfassen digitale Strategie-Entwicklung..
kapuzestattmuetze.de Marketing Mütze Ich Poppins Consulting Kapuze Online Produkt
176 Teeshop Berlin Tee

Der Teeshop Berlin entführt Sie in die Welt des Tees Betreten Sie die Welt des Tees im Teeshop..
teeshop-berlin.de/ Tee Ronnefeldt Password Lager Lieferzeit Werktage Aromatisierter Tea
177 Dekorationsverleih Partyausstatter Dekorationsverleih Eventdienstleistung

Dekorationsverleih, Partyausstattung, Catering & Service..
hochzeitsverleih-berlin.de Store Is Id Home Button Untertitel Bildtitel Webseite
178 Eventservice & Hochzeitsplanung Dekorationsverleih Eventdienstleistung

Bei uns erhalten Sie Hochzeitsdekoration, Floristik, Eventdekoration oder den kompletten Service rund um Ihre Veranstaltung...
a-mare.de Sans Open Store Events Uv Is Home Event
179 Umzugsunternehmen Klassik Umzüge Umzug

Gern stehen wir Ihnen bei Ihrem Umzugsvorhaben zur Seite! Jahrelange Erfahrung und Spaß an der Arbeit geben..
klassik-umzuege.berlin Berlin Umzüge Klassik Umzugsunternehmen Umzug Preis Berliner Umzugsgutliste
180 Rzeczoznawca Samochodowy Berlin STOWARZYSZENIA MOTOEXPERT Kfz Gutachter

rzeczoznawca-samochodowy-berlin.pl Roboto Poppins Open Sans Berlinie Condensed Rajdhani Uv

Mit mehr als 20 Jahren Erfahrung bieten wir Ihnen als in Berlin agierende Event Management Agentur ganzheitliche..
east-end.de/eventagentur/berlin/ Cookie Event Name Events Berlin Ireland Datenschutzerklärung Google
182 Apartmentservice Vermittlung

Apartmentservice ist eine Vermittlungsagentur mit Online-Buchungsportal für das Wohnen auf Zeit in Serviced Apartments in Deutschland und..
apartmentservice.de Apartments Serviced Apartmentservice Haus Berlin Service Deutschland Zeit
183 Ersthelfer.tv - Erste Hilfe Kurs Berlin-Reinickendorf Ersthelfer

Ersthelfer.tv ist Ihr professioneller Anbieter für den Erste Hilfe Kurs in Reinickendorf. Unsere Erste Hilfe Kurse finden..
ersthelfer.tv/standorte/berlin-erste-hilfe-kurse/berlin-reinickendorf/ Hilfe Berlin Erste Kurs Reinickendorf Betrieb Sans Animation
184 Zabi Rollen

zabi-rollen.de/ Räder Symbol Kunststoff Rollen Zubehör Polyurethan Produkte Alle
185 Zahnärzte am Potsdamer Platz Zahnarzt

Die Zahnarztpraxis am Potsdamer Platz empfängt Sie in entspannter Atmosphäre mit einem zuvorkommenden und freundlichen Team. Wir..
zahnaerzte-am-potsdamer-platz.de Berlin Uhr Zahnarzt Zahnarztpraxis Bleaching Schubert Christine Dr
186 DPO STAR GmbH Software

dpostar ist eine neue DSGVO-Software, die alle notwendigen Datenschutz-Vorgaben und -Dokumentationen auf innovativ einfache, spielerische Art und..
dpostar.com Software Unternehmen Daten Aufgaben Freiberufler Mittelstand Konformität Unser
187 About Weed UG (haftungsbeschränkt) Gesundheit Kosmetik

About Weed wurde in Berlin-Friedrichshain gegründet und ist ein digitaler Marktplatz für Hanfprodukte, E-Zigaretten und Zubehöre. Das..
aboutweed.de/ Produkte Blüten Deine Nä Du Lebensmittel Kosmetik Tiere
188 TC Fahrzeugaufbereitung Fahrzeugaufbereitung

Autopflege - Autoreinigung vom Profi in Berlin Tegel - Reinickendorf Profitieren Sie von unserem hochqualifizierten Fachpersonal, das sich..
tegelcenter-autopflege.de Internal Server Error
189 Übersetzungen für Ukrainisch und Deutsch Übersetzer Sprachdienstleistungen

Übersetzungen verschiedener Dokumente: Pass und Peronalausweis Geburtsurkunde Heiratsurkunde ..
ukrainisch.berlin Ukrainisch Ufer Deutsch Goethe Sprache Tatiana Garcia Literatur
190 Immobiliendarlehen und Investitionsfinanzierung Immobilienbau

Persönliche Darlehensdienste Hallo Sie suchen einen Notkredit für ..
6 walter-bloch-straße 6
191 Polygraph Click Fraud

Founded in 2021, Polygraph is a cybersecurity system that helps in preventing, detecting, and eliminating click frauds...
polygraph.net/ Polygraph Fraud We Contact Detection Click Avoid Ad
192 DPO STAR GmbH Software

dpostar ist eine neue DSGVO-Software, die alle notwendigen Datenschutz-Vorgaben und -Dokumentationen auf innovativ einfache, spielerische Art und..
dpostar.de Unauthorized This Either
193 Regionales Onlinemarketing Onlinemarketing

regionales-onlinemarketing.de - Der Blog mit Informationen rund um SEA, SEA und Online-Marketing für regionale Unternehmen. Besuchen Sie..
regionales-onlinemarketing.de/ Marketing Online Unternehmen Google Local Trends Content Jahr
194 Müller & Woschke Umzüge

Sorfältige Umzugsplanung für einen stressfreien Umzug Undurchsichtige Preise, unerwartet hohe Rechnungen… Viele Menschen sind bereits auf unseriöse..
umzug-berlin.de Berlin Umzug Umzugsunternehmen Müller Ihr Ihren Woschke Umzugsfirma

Bei DRESP Sport Couture verbindet sich elegantes Modedesign mit Funktionalität. Seit 2016 bietet das Modelabel aus Berlin..
dresp.com Regulärer Preis Angebotspreis Stückpreis Shop Yoga Avenir Now
196 Kali Kali Ernährungstherapie Ernährungsberatung

Berlin - Friedrichshain
Erhalten Sie, bequem von Zuhause aus, eine persönliche Beratung für ein gesünderes Essverhalten. Als leidenschaftliche Diätassistentin stehe..
kalikali.de/ Customer Ernährungstherapie Berlin Ernährungsberatung Nä Kali Json Event
197 Clever Vital Health&Beauty

Berlin, Germany
Die eigene Gesundheit wird vielen immer wichtiger. Ausreichend Bewegung und Schlaf, Entspannung und die richtige Ernährung sind..
clevervital.com/ Sans Awesome Freefont Vital Deine Produkte Gesundheit Nitro
198 SGBVM Sport

sgbvm - Der Blog für den Hobby- und Breitensport in Deutschland. Wir stellen beliebte Sportarten und Veranstaltungen..
sgbvm.de/ Section Color Breitensport Sportverletzung Behandlungsmethoden Rückkehr Vereins Sportvereins
199 Brautschmuck Blenk Brautschmuck

Brautschmuck Blenk betreibt einen Blog rund um die Themen Brautmode, Brautschmuck, Schuhe, Styling, Accessoires und Co. Mit..
brautschmuck-blenk.de/ Brautkleid Hochzeit Schmuck Tag Kleider Outfit Styling Brautmode
200 Aca Berlin Blog

aca Berlin ist ein Online Forschungsinstitut. Hier werden Informationen aus Forschung und Wissenschaft geteilt. Besuchen Sie unseren..
aca-berlin.de/ Forschung Arbeit Ghostwriter Interdisziplinäre Forschungsinstitut Forschungsarbeit Forschungsbereiche Online
201 Existenzgründercoaching Unternehmensberatung

Die Existenzgründerhilfe UG ist ein deutschlandweit agierendes Beratungsunternehmen für Existenzgründer und Existenzgründerinnen, mit aktuell 22 Standorten. Wir..
existenzgruenderhilfe.de/ Alle Infos Existenzgründerhilfe Gründungszuschuss Beratung Gründerseminar Existenzgründerseminar Existenzgründer
202 Fa. Bootshaeuser.de Bootshäuser Vermietung

Ein Urlaub in einem unserer Bootshäuser ist die perfekte Verbindung aus purer Erholung, Naturerlebnis pur und stillvollem..
bootshaeuser.de Personen Bootshaus Wasser Landkreis Hausboot Urlaub See Zimmer
203 MW Expat Solution Services GmBH Insurance

At MW Expat, we not only realise the importance of having a sound financial plan for the..
mw-expat.com/ Expat Germany Solution Services Gmb Insurance More Information
204 Umzug Berlin Umzüge Privat Umzug Firma Umzug Berlin

Herzlich Willkommen bei Prinz Umzüge! Seit 1996 sind wir als Umzugsfirma für Sie da! Sie suchen für Umzüge in..
205 Umzugsunternehmen Berlin Umzugsunternehmen

Umzugsunternehmen Berlin Wir sind ein berliner Umzugsunternehmen. Unser Familienunternehmen besteht seit 2005. Wir führen Umzüge europaweit durch. Neben..
igel-umzuege.de Berlin Sans English German Awesome Umzug Umzüge Website
206 PiercingLine Fashion

Berlin, Germany
Piercings sind schon längst ein etablierter Modeschmuck geworden. Vor allem Piercings für das Ohr wie das Helix-..
piercingline.com Cookie Piercing Verwendung Anbieter Name Lebensdauer Piercings Google
207 Auto Service Asad Auto Service

Mercedes Fachwerkstatt seit 1975. Oldtimer & Youngtimer enthusiasten. Riesige Teileauswahl in unseren heiligen Hallen...
auto-service-asad.de/ Autoservice Asad Mercedes Partner Berlin
208 Edelmetall – An- und Verkauf Aurofix Goldankauf Goldverkauf

Die Firma Aurofix GmbH ist seit ihrer Gründung im Jahr 2013 im Bereich von Edelmetallen tätig. Nach langjähriger..
altgoldankauf24.de Börsenkursaktualisierung Automatische Vorschau Versandkosten Mw Heraeus Raleway Argor
209 Waldkraft. Online-Shop

Tiergesundheit unterstützen das ist unser Auftrag. Wir wollen, dass Tiere lebensfroh und unbeschwert umherspringen können und Tierbeitzen..
waldkraft.bio Kategorie Einstellungen Cookie Versand Kontakt Labortests Magen Zahlungsbedingungen
210 Proktologie Dr. Loch Proktologie

Mein Name ist Dr. med. Horst Loch. Ich bin renommierter Proktologe mit jahrzehntelanger Erfahrung in der Diagnostik..
proktologie-dr-loch.de/ Cookie Dr Loch Informationen Website Proktologie Google Berlin
211 PR-Agentur Große GmbH Strategie |

Bessere Medienpräsenz und qualifizierte Leads für Kunden aus den Bereichen Bauen, Wohnen, Energie durch maßgeschneiderte Kommunikation. Sie möchten..
pr-grosse.de Gmb Agentur Große Kommunikation Berlin Kunden Jahren Partner
212 Sebastian Helming Immobilien Immobilienmakler

PERSÖNLICHER SERVICE. VERLÄSSLICHE RESULTATE. Wer die besten Ergebnisse erzielen möchte, braucht die besten Makler. Profitieren auch Sie..
sebastianhelming-immobilien.de/ Immobilien Immobilienmakler Store Berlin Sebastian Is Helming Home
213 Garamantis GmbH Interaktive Ausstellungen

Garamantis wurde 2014 in Berlin gegründet und entwickelt interaktive Ausstellungen und Showrooms. Individuelle Software-Entwicklung steht im Fokus..
garamantis.com Multitouch Garamantis Tisch Ihr Reality Showroom Software Ausstellungen
214 SM MIR UG Tabakwaren

glimp.de Sans Price Bar Switch Salt Elf Islands Lady
215 Stylefy - die Möbelplattform für Hersteller Möbel Branche

stylefy.de/ Möbel Stylefy Lieferung Wohnung Kauf Regale Sets Widerrufsrecht
216 Bonsaihandel Bonsaihandel

Ikigai Bonsai ist ein reiner Bonsai-Onlineshop. Die Bestellungen können aber gerne mit Terminvereinabrung in Berlin Charlottenburg abgeholt..
ikigai-bonsai.com/ Bonsai Shohin Bonsais Ikigai Onlineshop Bonsaischalen Baum Juniperus
217 Coaching Coaching

Mein Name ist Ingrid Huttary. Seit mehr als 15 Jahren begleite ich als Coach und Trainerin Menschen..
offene-horizonte.de/ Coaching Balance Home Kongress Lebensbalance Coach Online Hier
218 Klassik Umzüge Dienstleistung Umzug

Wir sind ein kleines, aber feines Berliner Umzugsunternehmen mit langer Erfahrung. Diese Erfahrung können wir als fairen..
klassik-umzuege.berlin Berlin Umzüge Klassik Umzugsunternehmen Umzug Preis Berliner Einlagerung
219 SeniorenLebenshilfe Claudia Kruk Seniorenbetreuung

Die SeniorenLebenshilfe ist bundesweit das einzige Unternehmen, dass sich auf die vorpflegerische Betreuung spezialisiert hat. Wir unterstützen..
seniorenlebenshilfe.de/lebenshelfer-berlin/lebenshelferin-claudia-kruk/ Senioren Live Bitte Pflichtfeld Arial Anfrage Applying Berlin
220 Viveka Jaeger - Amerikanische Chiropraktik Chiropraktiker

Die Amerikanische Chiropraktik vereint verschiedene Disziplinen wie die Osteopathie, Kinesiologie und die Kunst der Justierung zu einer..
chiropraktik-jaeger.de/ Sans Jaeger Chiropraktiker Amerikanischer Berlin Weilheim Opening Viveka
221 BHI Hesse Immobilien Immobilienmakler

In Spandau, aus Spandau, für Spandau… Als Spandauer Immobilienmakler sind wir seit über 25 Jahren für Sie in..
immobilienmakler-spandau.de/ Hesse Spandau Immobilien Cookie Immobilie Name Immobilienmakler Verkauf
222 Akademily Ghostwriting

Wissenschaftscoaching: Coaching, Beratung Wo die Betreuung an Universitäten endet, beginnt Akademily mit seinen Mentoring-Dienstleistungen. Seit April 2018 begleiten..
akademily.de/ Wissenschaftscoaching Akademily Anbieter Garantierte Arbeit Schreibservices Coaching Korrektur
223 Tee online kaufen Tee Online

Tee online kaufen im Bio Tee Online Shop Unser Teesortiment umfasst zahllose Teesorten aus fast allen Teeregionen der..
hitoca.com Tee Bio Online Shop Teesorten Feine Hitoca Gew
224 Treza Hersteller Von

doppelstabzaun-treza.de New Roman Zäune Herstellung Doppelstabmatten Firma Pforten Polen
225 Balkon Sichtschutz Ideen Balkon Sichtschutz

Balkon Sichtschutz Ideen ist ein Onlineshop für großformatige Druckerzeugnisse, mit der Spezialisierung auf die Fertigung von Balkon..
balkon-sichtschutz-ideen.de/ Sansfont Uv Sans Sichtschutz Ideen Freefont Displayfont Display
226 vorbereitende Buchhaltung Dienstleistungen

Wir bieten Ihnen unsere Dienstleistungen im Bereich Buchhaltung für den Raum Berlin und Brandenburg an. BUCHHALTUNG / CONTROLLING: Buchen..
mmu-berlin.de/ Container Site Vertical Drop Raleway Five Wbu Header
227 Corona Schnelltest Berlin Schöneberg Telekommunikation

Corona Schnelltest, Antigentest, Bürgertest, Kostenloser Schnelltest..
228 M&W Bürobedarf Bürobedarf und

Alles rund ums Büro - Nachhaltig, schnell und gut. In Berlin begeistert Sie unser Bürobedarfservice M & W..
mw-buerobedarf.de/nachhaltigkeit Store Is Initial Home Webseite Parameters Id Key
229 heysports Vergleichsportal

heysports.io ist eine Website, auf der du ganz einfach die Fitness- und Yogastudios deiner Stadt miteinander vergleichen..
heysports.io/ Mui Segoe Emoji Yoga Apple Arial Symbol Color
230 Alexandra Reimann Unlimited Coaching

Seit Jahren helfe ich jungen internationalen Führungskräften beim Einstieg in ihre neuen Funktionen. Wie das geht und was..
alexandra-reimann.com/ Montserrat Roboto Merriweather Slab Sans Awesome Cuse Reimann
231 Corona-Testzentrum Laboratorien

In unserem CoVID19-Testzentrum können Sie sich, Ihre Familienangehörigen und Mitarbeiter schnell und unkompliziert ohne Termin testen lassen...
7com-corona-test.de/agb/ Berlin Verbraucher Corona Vertrag Schnelltest Bestellung Widerrufsrecht Bundesallee
232 Corona Express Test BLN Gesundheit &

Wir haben sehr vielfältige Öffnungszeiten, ein gutes Personal unter anderem auch freundliche Kunden was uns die Arbeit..
corona-express-test-bln.de Berlin Schnelltest Corona Wedding Antigen Test Ergebnis Uhr
233 PEN Personalgewinnung GmbH Unternehmensberatung

Die PEN Personalgewinnung ist eine Unternehmensberatung spezialisiert auf Mitarbeitergewinnung mit Sitz in Berlin. Der Schwerpunkt liegt dabei..
pen-personalgewinnung.de/ Sansfont Uv Sans Personalgewinnung Gmb Hauptsitz Nitro Eventnitro
234 TEENDOO Fashion

Sybelstraße 46, 10629, Berlin
Unser Online Shop bietet die heißesten Streetwear Outfits und Marken Turnschuhe von heute zu Schnäppchenpreisen...
teendoo.com Schuhe Wishlist Quick Ausführung Lite Awesome Stiefel Weizen
235 Foxx Umzüge Berlin Umzug

Das Umzugsunternehmen Foxx Umzüge in Berlin, bietet ihnen einen sicheren Umzug in Berlin, Deutschland und ganz Europa...
umzuege-berlin.com Umzug Umzüge Umzugsunternehmen Ihrem Transport Berlin Ihren Angebot
236 CoVID19 Testzentrum Laboratorien

In unserem CoVID19-Testzentrum können Sie sich, Ihre Familienangehörigen und Mitarbeiter schnell und unkompliziert ohne Termin testen lassen...
7com-corona-test.de/agb/ Berlin Verbraucher Vertrag Bestellung Schnelltest Widerrufsrecht Mail Internetshop
237 Taxi Taxi

thomastaxi.com Thomas Dahl Mail Interview Sicherheit Taxibetrieb Home Berlin
238 Gaststätte Ambrosius Gastronomie

Traditionelle Köstlichkeiten aus ganz Deutschland Ein Besuch in der Gaststätte Ambrosius im Herzen von Berlin lohnt sich immer...
gaststaette-ambrosius.de/ Berlin Uhr Home Begriff Petrus Küche Fpng Fpublicodcmallbusinessde
239 Augenzentrum Eckert Augenarzt

Im schönen Überlingen am Bodensee können wir Ihnen jetzt Augenheilkunde auf dem modernsten Stand der Technik anbieten...
augenzentrum-eckert.de/standorte/ueberlingen/ Verdana Helvetica Arial Filiale Sans Eckert Augenlasern Karlsruhe
240 Marketing Is The Key Marketing

Marketing Is The Key is a marketing blog that features articles on topics like how to hire..
marketingisthekey.com/ Marketing The Inbound It Traditional Key Is Mail
241 Zahnvorsorgecoach Zahnmedizinische Prophylaxe

Mein Angebot an Zahnarzt- und Arztpraxen: Mobile Prophylaxe-Assistenz im Raum Berlin Gründe, warum man in einer Zahnarzt- und..
zahnvorsorgecoach.de/ Titillium Font Webfont Feuer Webline Andrea News Zahnreinigung
242 sonnenspiele.com Spielautomaten

Bei Sonnenspiele.com geht es um die beliebtesten Spielautomaten in Deutschland. Wir nehmen dabei die bekanntesten Automatenspiele verschiedener..
sonnenspiele.com Spielautomaten Sonnenspielecom Gaming Menü Hersteller Time Anregungen Verbesserungsvorschläge
243 Mittagessen für Adlershof Altglienicke und Bohnsdorf Lieferservice

Wir beliefern Sie montags bis freitags kostenlos mit abwechslungsreicher Hausmannskost in den Berliner Ortsteilen Adlershof, Altglienicke &..
lieferservice-mittagstisch.de Essen Adlershof Altglienicke Bohnsdorf Ihr Lieferung Mittagessen Uhr
244 Changelly Kryptobörse

Von 2020 bis 2015 erleichtert das Changelly Team seinen Kunden und Partnern den Zugang zu Kryptowährungen. Produkte Der Dienst..
changelly.com/de Changelly Terms Services The Affiliate You We Website
245 Fahrerflucht Anwalt Anwalt

Der Fahrerflucht Anwalt informiert auf dem unternehmenseigenen Portal über Strafen und Sanktionen bei Unfallflucht. Interessierte erfahren Wissenswertes..
fahrerflucht.eu/ Fahrerflucht Unfallflucht Unfallort Anwalt Fahrerlaubnis Kfz Unfall Geldstrafe
246 Pioneer DJ Forum Musik

Beim PioneerDJ--Forum handelt es sich um ein Onlineforum rund um alle Fragen zur Pioneer DJ Hardware und..
pioneerdj-forum.de Pioneer Beiträge Themen Forum Keine Kanal Mixer Controller
247 memoria-Stein│ individuelle Grabsteine aus Berlin Grabsteine

Individuelle Grabsteine aus Berlin. Bildhauerin gestaltet persönliche Grabmale aus Naturstein und anderen Materialien nach Gesprächen über das..
memoria-stein.de Grabstein Berlin Grabsteine Leben Stein Grab Bildhauerin Gedenkstein
248 Tea Deli - Dein Shop für Bio-Tee

Bei Tea Deli bieten wir dir leckere Bio Tees in zertifizierter Qualität. Ohne künstliche Aromen, ohne Zuckerzusätze..
teadeli.de Tees Tee Bio You Tea Roboto Futura Deli
249 iSIOS GmbH Roboterkalibrierung

Die iSIOS GmbH bietet Roboterkalibrierungen für Industrieroboter an. Durch innovative Technik können Höchstgenauigkeiten bei der Absolutgenauigkeit erzielt..
isios.de Isios Kalibrierung Vermessung Roboter Präzision Wartung Laser Sensorik
250 Key to see GmbH Coaching &

Das Leitbild von Key to see basiert auf unserer Überzeugung, dass jeder Mensch den Schlüssel zu einem..
keytosee.de Key Motivation Enneagramm Methode Berlin Leben Coaching Beziehungen
251 Handy Reparatur Berlin Handyreparatur

Seit 10 Jahre reparieren wir Display und Akku Austausch in Berlin Pankow unser Service für die Hauptstadt..
handy-reparatur-berlin.com/ Reparatur Berlin Xperia Reihe Pixel Austausch Oswald Apple
252 Rümpelfüchse Entrümpelung Berlin Entrümpelung

entruempelung-berlin.de Berlin Google Eventrocket Rümpelfüchse Entrümpelung Entsorgung Fsvg Rocket
253 Webdesign Agentur Berlin Webdesign

Unavailable Light Webdesign ist eine Full Service Webdesign Agentur in Berlin und bietet ein umfängliches Leistungsspektrum an...
unavailable-light.de/ Design Web Agentur Webdesign Service Full Website Uncategorized
254 The Connoisseur Of Food Food

TheConnoisseurOfFood.com is a food blog that features articles on topics including natural energy drinks, advantages of diary..
theconnoisseuroffood.com/ Connoisseur Of Food The Stringfrom Arrayflag
255 Nikola Fischer Brautkleider Brautmode

Brautmode mit Stil in Überlingen am Bodensee, Wir führen u.a. Küssdiebraut, GreenbyDesign, Modeca, Ladybird, Esther Hofmann und..
brautmode-bodensee.de/ Brautmode Bodensee Stil Dich Brautkleider Friedrichshafen Du Dir
256 Marketing Almanac Marketing

Marketing Almanac is a blog that discusses about various types of marketing such as digital marketing, content..
marketingalmanac.com/ Almanac Marketing Stringfrom Arrayflag
257 Mohr Gesprächscoach

www.spirituellerbeziehungscoach.de Gordon Konfliktmanagement / Familienkonferenz friedfertige Kommunikation & Ich-Botschaften Mediation Hypnose Heilungsmantra 60, 00 Euro pro Stunde..
spirituellerbeziehungscoach.de Beziehungscoach Spiritueller Konfliktmanagement Familienkonferenz Kommunikation Ich Botschaften Mediation
258 KFZ-Zulassung24.de GmbH - Ihr freundlicher Zulassungsdienst Zulassungsdienst

Wir sind ein Berliner Zulassungsdienst mit Abhol- und Bringservice Ihrer Dokumente. Unser Service ist kompetent, schnell und..
kfz-zulassung24.de Berlin Zulassungsdienst Auto Express Online Zulassung Ihr Service
259 DimaPax GmbH Verpackungen

Verpackungen aller Art von DimaPax: Für jedes Produkt haben wir die richtige Verpackung Wir sind ein relativ..
dimapax.de/ Html Taschen Luftpolster Schnellkauf Lager Lieferzeit Gr Werktage
260 Dr. med Henning Freiherr von Gregory Plastische und

Wir freuen uns über eine Terminvereinbarung für einen persönlichen Besuch in unserer Praxis. Alle Operationen an Nase..
drvongregory.de/ Awesome Freefont Borlabs Brandsfont Sans Code Helvetica Open
261 Scandinavian Biolabs Haarwachstum

Bei der Gründung von Scandinavian Biolabs standen Funktionalität, Transparenz und echte Wirkung an oberster Stelle. In der..
scandinavianbiolabs.de/ Re Geld Haarausfall Inhaltsstoffe Garantie Dateget Haar Biolabs
262 Marketing Talk Marketing

MarketingTalk.info is a marketing blog that dives deep into topics such as on marketing tips, brand promotion..
marketingtalk.info/ Talk Navigation Marketing Stringfrom Arrayflag Menu
263 Entrümpelungen in Berlin Entrümpelungen

Es wird ein Spezialist für die Entrümpelung oder Haushaltsauflösung benötigt? Perfekt, wir sind dafür Ihr Ansprechpartner! Sie..
entruempelunginberlin.de/ Berlin Roboto Firefox Mozilla Sans Font Open Entrümpelung
264 Studio Matthias Last Design Studio

Studio Last is a multidisciplinary design studio working primarily in the fields of media, art, culture and..
studio-last.com Berlin Art Design Direction Last Magazine We Identity
265 Blake & Vargas Publishing House

Blake & Vargas is a Kreuzberg based space founded by Sarah Bernauer and Matthias Last. The Kunstraum hosts..
blakeandvargas.com Vargas Basis Americana Regularcolorletter Blake Text All Regular
266 The World of Marketing Marketing

TheWorldofMarketing is a blog that covers topics related to marketing such as personalized marketing, brand marketing, stealth..
267 Gitarrenunterricht Berlin Musikunterricht

Fangen Sie an, Gitarre oder E-Bass bei mir zu lernen: nach einigen Grundübungen können Sie bald Ihre..
268 Gitarrenlehrer Berlin Musikunterricht

Fangen Sie an, Gitarre oder E-Bass bei mir zu lernen: nach einigen Grundübungen können Sie bald Ihre..
269 Jevio Jessica Leidel Portal

Das optimale Beauty- & Wellness Portal für Nagelstudio, Massage, Kosmetikstudio, Friseure in der Nähe. Auch Maniküre, Entspannung..
beauty-wellness-in-der-naehe.de Nä Portal Kosmetikstudio Nagelstudio Friseure Massage Nagelstudios Wellness
270 ECOCHECK-SachverständigenbüroBaubiologie Baubiologie Schadstoffmessung

Messungen von Schadstoffen im Wohnraum Luftmessung im Innenraum und Fertigteilhäusern mit Schadstoffanalyse auf Formaldehyd und VOC. Wir..
schadstoffgutachter.eu Elektrosmog Messung Haus Smog Wohnung Messungen Büro Berlin
271 Vis-Render Architektur Visualisierung Dienstleitung

Wenn es um fotorealistische 3D Visualisierung geht, sind wir ihr Ansprechpartner. Wir bei Vis-Render spezialisieren uns von..
vis-render.de/ Helvetica Roboto Arial Sans Visualisierung Open Architektur Font
272 The Marketing Blog Marketing

TheMarketingBlog.net is a blog loaded with marketing topics including social media marketing, buzz marketing, acquisition marketing, influencer..
themarketingblog.net/ Blog Marketing The Stringfrom Arrayflag
273 Reinigungsservice Niklas Reinigungsservice

Seit über zehn Jahren bin ich in der Reinigungsbranche tätig und vollbringe zur höchsten Zufriedenheit meiner Kunden..
reinigungsservice-niklas.de/ Open Sans Bold Regular Niklas Kontakt Grundreinigung Reinigungsservice

Die Meisterkammer kannst du mieten. Was bieten wir: -Ladengeschäft im Herzen von Friedrichshain -2 Räume, weiss, Galerieschienen, kleines Schaufenster -inkl...
meisterkammer.de Meisterkammer Jeder Meister Stringfrom Arrayflag
275 Bootsschule Weiss Bootsführerschein Berlin

Wir bieten in Berlin die Ausbildung zum Bootsführerschein Motor für Binnengewässer (Flüsse) oder für die See (Meer)..
bootsschule-weiss.de/ See Bootsführerschein Binnen Berlin Bootsschule Kurs Kombi Prüfung
276 Green Garden Delivery Catering Catering Partyservice

Nachhaltigkeit geht jeden Menschen etwas an. Ebenso die Gastronomie. Green garden delivery steht für genussvolles, frisches und..
greengardendelivery.de Pro Maven Condensed Cabin Service Berlin Green Catering
277 Online-Marketing & Website-Pflege aus Berlin Online-Marketing-Beratung

Hier erhalten kleine Unternehmen, Solo-Selbstständige und die, die es werden wollen, Hilfe beim Online-Marketing: Vom Aufbau der..
webseitenliebe.de/ Website Marketing Astra Online Pflege Beratung Noto Serif
278 Supervision Supervision und

Supervision dient der beruflichen Reflexion mit dem Ziel Verbesserungspotenziale zu entdecken, Zusammenarbeit zu optimieren und vielfältige Handlungsoptionen..
ruth-kaukewitsch.de Supervision Coaching Teamentwicklung Berlin Stringfrom Arrayflag
279 Halteverbot Berlin24 Halteverbot Berlin

Halteverbot berlin Als Fachmann wissen wir genau, worauf es beim Einrichten einer Halteverbotszone ankommt und setzen dies..
halteverbot-berlin24.de Halteverbot Berlin Ihr Umzug Halteverbotszone Halteverbotsschilder Date Seite
280 Trademate Software

Online-Shops und Warenwirtschaftssysteme für Hofläden..
trademate.de Online Shop Warenwirtschaft Hofläden Kunden Landwirte Kontakt Hand
281 onrooby Software

Online-Shops und Warenwirtschaftssysteme für Hofläden..
onrooby.com Webshops Softwareentwicklung Ihr Unsere Projektmanagement Agile Ruby Unternehmen
282 Umzugsunternehmen-Berlin.de Umzug

Das Umzugsunternehmen-Berlin ist ein Familienunternehmen, die Ihren Schwerpunkt seit mehr als 7 Jahren, auf die Umzugsbranche gelegt..
umzugsunternehmen-berlin.de/ Berlin Umzugsunternehmen Umzug Kosten Cookie Wohnung Umzugsgüter Umzugskosten
283 TN-Reinigungsservice Gebäudereinigung Gebäudereinigung

TN Reinigungsservice Ihre Reinigungsfirma Ein sauberes Büro, eine aufgeräumte Küche, glasklare Fenster, ein gereinigtes Treppenhaus, oder eine saubere..
tn-reinigungsservice.de Reinigungsservice Gebäudereinigung Grundreinigung Sauberkeit Büroreinigung Industriereinigung Glasreinigung Baureinigung
284 Manu Lemke Heilpraktikerin Heilpraktikerin

Berlin Charlottenburg
Unser Darm- in der Mitte liegt die Kraft In unserem längsten Organ- dem Darm- befindet sich der größte..
manu-lemke.de Lemke Therapie Manuela Lato Helvetica Heilpraktikerin Arial Manu
285 ÖZ Gebäudeservice in Berlin Gebäudeservice

ÖZ-Gebäudeservice in Berlin ist Ihr Ansprechpartner für branchenspezifische Reinigungen und sämtliche Leistungen rund um Gebäudeservice. Durch unsere..
oz-gebaeudeservice.de/ Berlin Brandenburg Gebäudeservice Winterdienst Geb Immobilie Leistungen Hausmeisterservice
286 Adomos Immobilien Immobilien

Sehr gerne betreuen wir Sie bei dem Verkauf oder der Vermietung Ihrer Immobilie. Lassen Sie sich von uns..
adomos.de/ Immobilien Adomos Home Helvetica Verkauf Kontakt Immobilie Helfer
287 JalouCity GmbH & Co.KG Sicht- und

Seit über 30 Jahren bietet JalouCity den Kunden hochwertige und moderne Systemlösungen für Licht-, Sicht- und Sonnenschutz..
jaloucity.de/ Site Jalou Außendienst Sonnenschutz Beratung Jalousien Online Node
288 BMC Bauservice in Berlin Sanierungsunternehmen

BAUSERVICE MIT QUALITÄTSGARANTIE Zuverlässigkeit gesucht? Beauftragen Sie den BMC Bauservice aus Berlin! BMC Bauservice aus Berlin hat sich als..
bmcbauservice.de/ Bauservice Berlin Notdienst Wohnungssanierung Sanitär Generalunternehmer Brandenburg Logo
289 BDH Bauservice in Berlin Sanierungsunternehmen

Berliner Bauunternehmen und eingetragener Betrieb der Handwerkskammer. Komplette Wohnungs- und Haussanierungen in Berlin und Umland aus einer..
bdhbauservice.de/ Berlin Bauservice Bodenverlegung Hand Trockenbau Wohnungssanierung Küchenaufbau Umland
290 TURBO Entsorgung Clean

TURBO Entsorgung Berlin: Wir entsorgen Ihren Sperrmüll | Abfall & führen Ihre Wohnungsauflösung | Entrümpelung durch. Schnell..
turbo-entsorgung.de/ Berlin Entsorgung Sperrmüll Wohnungsauflösung Turbo Entrümpelung Abrissarbeiten Aktuelles
291 Realestating Immibilienmakler

Wir sind ein erfahrenes Makler-Unternehmen und emotionale Makler für Immobilien aus Berlin. Unser Team besteht aus jungen..
realestating.de Immobilien Makler Hotelimmobilien Immobilie Luxus Real Haus Gewerbe
292 FriseurTeamKathleenBock Friseur

Wir sind leidenschaftliche Friseure mit Schwerpunkten: Haarfarbe, Farbtechniken, Farbkorrekturen, Color Correction, Balayage, Babylights, Pivot Point, Haarverlängerung, Extension..
friseurteamkathleenbock.berlin Kathleen Shampoonieren Bock Strähnen Aufwand Preis Styling Schnitt
293 SeniorenLebenshilfe Silke Morgenstern Seniorenbetreuung

Die SeniorenLebenshilfe ist bundesweit das einzige Unternehmen, dass sich auf die vorpflegerische Betreuung spezialisiert hat. Wir unterstützen..
seniorenlebenshilfe.de/lebenshelfer-berlin/lebenshelferin-silke-morgenstern/ Live Senioren Bitte Pflichtfeld Arial Anfrage Applying Mail
294 contract management system cms Software

We provide the highest level of quality software products and services globally that meet the needs of..
295 natürliche Kosmetik Naturkosmetik

Wir bieten natürliche Kosmetik mit hochwertigen Inhaltsstoffen. farar Kosmetik ist vegan und frei von Tierversuchen. Unser Arganöl..
farar.de/ Zm Nunito Sans Dateget Einkaufswagen Produkte Gründerin Haut
296 Besonnungsstudie Verschattungstudie Umweltverträglichkeitsprüfung

sfimm.de/content/schattenwurfgutachten-fuer-hochbauten Schattenwurfgutachten Hochbauten Besonnungsverhältnisse Belichtungs Tageslicht Verschattungsgutachten Leistungen Innenräumen
297 Andreas Kutschke Umweltverträglichkeitsuntersuchung

Immissionsprognostik für Lärm, Gerüche, luftgetragene Schadstoffe...
sfimm.de/content/immissionsprognosen Immissionsprognosen Beurteilung Freien Richtlinien Leistungen Lärm Lato Stoffe
298 Immissionsprognose Umweltverträglichkeitsuntersuchung

SFI - Sachverständige für Immissionsschutz GmbH..
sfimm.de/content/immissionsprognosen Immissionsprognosen Beurteilung Freien Richtlinien Leistungen Lärm Lato Stoffe
299 Mp Objektschutz Sicherheitsdienst

Sie benötigen für Ihr Objekt ein Sicherheitsdienst, dann sind Sie bei Mp Objektschutz in Berlin genau richtig...
mp-objektschutz.de/ Berlin Professionelles Wachpersonal Wachschutz Objektschutz Security Personal Word
300 Sanitärexpress Berlin Sanitärnotdienst

Rohrbruch? Dann müssen Sie schnell handeln rufen Sie uns schnell an wir Sanitärexpress Berlin sind Ihr Klempner..
sanitaer-express.berlin Berlin Heizungsnotdienst Klempnerdienste Sanitärdienst Rohrnotdienst Rohrbruch Abflussreinigung Toilette

Kleinanzeigen, Kommentare und Mitfahrgelegenheit Berlin

+ Kommentar oder Kleinanzeige für Berlin eintragen!

301 Home Augenarztpraxis im
Augenarztpraxis im Ärzte Centrum Bülowstraße
302 Albers DAS SPORTRESTAURANT Albers Wettboerse GmbH Albers
Großzügig konzipiert ist das Albers Sportrestaurant der Treffpunkt aller Besucher des Pferdesportparks BerlinKarlshorst. Der aufmerksame
albers-restaurant.de Albers Berlin Restaurant
303 Home
304 Weihnachtsmarkt auf dem Winterfeldtplatz Berlin
Der traditionelle Weihnachtsmarkt auf dem Winterfeldtplatz ist einzigartig und an den Adventssonntagen geöffnet.
weihnachtsmarkt-winterfeldtplatz.de Berlin Weihnachtsmarkt Winterfeldtplatz
305 Formular.de Tipps Formular.de ist ein Angebot der Formblitz AG
Auf Formular.de finden Sie umfangreiche Informationen zu juristischen Themen wie Mietvertrag Arbeitsvertrag Patientenverfügung
306 Cafe Peri Start
Homepage of Cafe Peri
307 Czollek consult Willkommen! Leah
Diversity Dialoge Mediatorin Trainerin Dozentin Konflikte produktiv und zufriedenstellend lösen Kommunikation Dialog Unternehmen Kommunikationskultur
czollek-consult.de Leah Carola Czollek
308 PROFORMA Corporate Design Gesellschaft für Unternehmenskommunikation mbH & Co. KG Design
Corporate Design Agentur Berlin Agentur für Unternehmenskommunikation WebEntwicklungen und Beratung. Für Unternehmen
proforma.de Design Gestaltung Corporate
309 Business Development Germany German
We bring your business on the German market ? contact us today!
businessdevelopmentgermany.de German Companies German Marketing
310 DJ Frank DJService DJ
Dj Frank Berlin DJService für Partys Feste Hochzeiten ...
dj-frank-berlin-brandenburg.de DJ Berlin Brandenburg Party Hochzeit
311 Berlin Taekwondo Willkommen Berlinsan Taekwondo Sportverein e.V. Adnan
Olympic Sports Center Berlinsan Taekwondo e.V. Adnan Karabulut
berlintaekwondo.de Adnan Karabulut Taekwondo Berlin
312 Wohnungsauflösung Berlin 030 wohnungsauflösung
Wohnungsauflösung Berlin günstig und schnell von Complett Räumung 030 261 01 714
berlin-wohnungsaufloesung.de Wohnungsauflösung Berlin Wohnungsauflösungen Entrümpelung Entrümpelungen
313 RAe Böhm MeyerDulheuer §§
Rechtsanwälte Rechtsanwalt Matthias Böhm Notar Helmuth MeyerDulheuer RA RAe §
boehmmeyerdulheuer.de §§ § Rechtsanwälte
314 Astrid Elisabeth Stebich
Astrid Elisabeth Stebich Make up Artist Friseurmeisterin aus Berlin. Make up Haare
315 Home www.berlinevangelisch.de Gesellschaft für Unternehmenskommunikation mbH & Co. KG Abgeltungssteuer
www.berlinevangelisch.de ? Das ServicePortal der Evangelischen Kirche in Berlin.
berlin-evangelisch.de Abgeltungssteuer Advent Austritt Bach Berlin
316 Berlin Apartments Potsdamer Str Berlin
Apartments in Berlin nähe Potsdamer Platz für Gruppenreisen Gruppenunterkunft
berlin-aparts.de Berlin Apartments Berlin Gruppenreise
317 Bar Voyage barvoyages bar
Bar Café Kleinkunstbühne
barvoyage.de Bar Berlin Kleinkunst Berlin
318 Home ? Kunstsaele Berlin Kunstsaele
Die Kunstsaele Berlin verbinden Galerie Sammlung und Kulturprojekte an einem Ort. Neben den wechselnden
kunstsaele.de Kunstsaele Oehmen Bergmeier
319 WerbeartikelAgentur für Fahrradsattelbezüge
Kultkeks ist Ihr Partner für individuelle Werbemittel und Werbegeschenke. Unser Sortiment reicht von der Handysocke
Seit nunmehr 26 Jahren ist das TRIO PALMERA unterwegs um landesweit und über die Landesgrenzen
josefinol.de Salsa Cumbia Merengue
321 Home Labbow Personalleasing e.K.
Personalberatung und dienstleistungen
322 Marian Kiss Marian
Marian Kiss Film Berlin Filmemacherin Filmmaker Regiesseurin Director
mariankiss.de Marian Kiss Film
323 Marianne Rosenberg | RoseWeb Public Image GmbH Marianne
Die offizielle Website von Marianne Rosenberg mit aktuellen Infos SongDownloads Biografie Diskografie
rosenberg.de Marianne Rosenberg Pop
324 MännerMinne e.V. Erster schwuler choir
MännerMinne e.V. Erster schwuler Männerchor Berlin gegründet 1987 Mitglied im Berliner Sängerbund.
maennerminne.de Choir Chorus Gay
325 | MARTINA DOEHRING | c/o Formblitz AG Martina
Dies ist die offizielle Website der Sopranistin Martina Doehring
martinadoehring.de Martina Doehring Sängerin
326 EVA GmbH EVA GmbH
KFZ Reparatur oder Ausfuhrversicherung:sofort in unserem OnlineShop. Auch Gebrauchtwagengarantie und Finanzierung für Privatpersonen und Händler
327 Diversitygendertraining.de joomla
Joomla! dynamische PortalEngine und ContentManagementSystem
energydeal.de Joomla Joomla
328 :: Keding / ESS Keding / ESS Elektronische Sicherheitssysteme GmbH / Keding GmbH & Co. KG sicherheitssystem
ESS GMBH Planung Lieferung Montage Inbetriebnahme von elektronischen Signal und Anzeigeanlagen
ess-sicherheit.de Sicherheitssysteme Alarmanlagen Brandmeldetechnik Brandmelder Brandmeldeanl
329 Hauptstadtplan | interaktiver stadtplan Adler & Schmidt GmbH Bundeshauptstadt
Interaktiver häusergenauer Stadtplan der Berliner Innenstadt. Suchmöglichkeit nach den Kategorien Sehenswürdigkeiten Kultur Regierungsbauten
hauptstadtplan.de Bundeshauptstadt Berlin Hauptstadt Bundesregierung Reichstag
330 Home GmbH & Co. KG ML4
Personalleasing ML4 Personalmanagement GmbH Co.
ml4-dienstleistungen.de ML4 ML4Personalmanagement ML4
331 Keding GmbH Co.KG Integral
IntegralSecurity Integralsecurity Integral Security Integral Security Antennentechnik und Sicherheitstechnik Alarmanlagen Brandmeldeanlagen Einbruchmeldeanlagen Videoüberwachung und mehr)
keding.de Integral Security IntegralSecurity Integralsecutity Integral
332 Start Kauffeld und
Kauffeld und Jahn
333 Willkommen bei Pascha Grill joomla
Joomla! dynamische PortalEngine und ContentManagementSystem
pascha-grill.de Joomla Joomla
334 PartytechnikBerlin Verleih von Berlin
Partytechnik Berlin verleiht Lichttechnik und Tontechnik für Eure Party/Veranstaltung
partytechnik-verleih-berlin.de Berlin Partytechnik Verleih Party Verleih
335 Home
Tierärzte Tierarztpraxis Marianne Gass
336 Willkommen bei perko profundus! Perko
perko profundus
perko-profundus.de Perko Gudrun Profundus Wissenschaftscoach Education
337 Ludger Jungnitz Men's Maenner
Ludger Jungnitz Men's Care Men's Studies
mensstudies.de Maenner Lebensqualitaet Gesundheit
338 Berlin Apartments Potsdamer Str Berlin
Apartments in Berlin nähe Potsdamer Platz für Gruppenreisen Gruppenunterkunft
cityapartsberlin.de Berlin Apartments Berlin Gruppenreise
339 HumanistischSystemische Beratung Frank systemisch
Erkennen und Auflösen von Verstrickungen Familienstellen Psychodrama Gestaltherapie Trauma
frankstamer.de Systemisch Familienstellen Aufstellung
340 Flowers of life Flowers
Flowers of life richtet sich an alle Menschen die Begleitung Gesellschaft oder eine persönliche
flowers-of-life.de Flowers Of Life Brigitte
341 INTEGRAL SECURITY Sicherheitstechnik Keding GmbH & Co. KG IntegralSecurity
Sicherheitstechnik von Integral Security dem deutschlandweiten Firmenverbund für Sicherheitstechnik (Alarmanlagen Brandmeldeanlagen Einbruchmeldeanlagen
integralsecurity.de IntegralSecurity Sicherheitstechnik Integral
342 IJam.de ? mediendesign Webdesign
10 Schritte zur eigenen Website | iJam.de Mediendesign
ijam.de Webdesign Mediendesign Homepage
343 Startseite » Gesine Palmer » Herzlich Willkommen auf Gesine
Dr. Gesine Palmer leitet das Berliner Büro für besondere Texte. Die Religionsphilosophin bietet Kommunikationsberatung und
gesine-palmer.de Gesine Palmer Redenschreiben
344 Politikmanagement mit Gitta Stieber Politikmanagement
Gitta Stieber Berlin Politikmanagement Qualifizierung und Weiterbildung die Sie in sozialen
gittastieber.de Politikmanagement Kommunikation SoftSkills
345 Gift Music Gift Music GmbH Weltmusik
Ein kleines Weltmusiklabel aus Berlin
giftmusic.de Weltmusik Label Berlin
346 GEAG Immobilienverwaltung Berlin:Wir verwalten GEAG Immobilienverwaltungs GmbH Wirtschaft
GEAG Immobilienverwaltungs GmbH: kompetente Verwaltung und Betreuung von Immobilien in Berlin Brandenburg Sachsen
geag-berlin.de Wirtschaft Immobilien Immobilienverwaltung
347 Business Development Germany German
We bring your business on the German market ? contact us today!
business-development-germany.de German Companies German Marketing
348 Moritz Tilman Achelis | rechtsanwalt
Rechtsanwalt Arbeitsrecht Achelis Baurecht Architektenrecht Grundstücksrecht Wohnungseigentumsrecht Medizinrecht
ra-achelis.de Rechtsanwalt Arbeitsrecht Achelis
349 RDM: Startseite Landesverband Berlin und Brandenburg e.V. rdm
RDM Ring Deutscher Makler Landesverband Berlin und Brandenburg e.V.
rdm-berlin-brandenburg.de Rdm Ring Deutscher
350 Startseite Willkommen
351 Rita Leinenweber · Astrologie Astrologie
Ich freue mich Ihnen meine Kenntnisse in Astrologie Massage energetischen Heilweisen
ritaleinenweber.de Astrologie Horoskop Geburtshoroskop
352 GEAG Immobilienverwaltung Berlin:Wir verwalten GEAG Immobilienverwaltungs GmbH Wirtschaft
GEAG Immobilienverwaltungs GmbH: kompetente Verwaltung und Betreuung von Immobilien in Berlin Brandenburg Sachsen
sabinespehr.de Wirtschaft Immobilien Immobilienverwaltung
353 Rundum Ich Ihr massage
Massage Ernährungsberatung Fitness und Personal Training Hypnosetherapie in Berlin für Privatkunden
rundum-ich.de Massage Ernährung Hypnose
354 Astrologische Gesundheits und Lebensberatung Astrologie
Astrologische Gesundheits und Lebensberatung Yvonne v. Bechtolsheim: Astrologie Reiki Ernährungsberatung und Radionik in
schwarzer-second-hand-shop.de Astrologie Reiki Ernährungsberatung
355 Roger Thilo EDV Service Roger
Wir bieten ITLösungen im Businessbereich für alle Branchen und Unternehmensgrößen. innovativ zuverlässig
rthilo.de Roger Thilo EDV Service
356 PROBase easy PROFORMA GmbH & Co. KG CMS
Mit PROBase easy erstellen wir individuell hochwertige Webauftritte Sie brauchen nur noch die Texte
pro-base-easy.de CMS ContendManagemnetSystem Contend
357 Sm hope ick Kindermode
Die Teilnahme am Wettbewerb ?Meine Heimat? auf der Kreativplattform Dawanda.de war Anlass Designs zu
smhope.de Kindermode
358 LOOK22 Home LOOK22 LOOK22
LOOK22 MediaService ~ zielgruppenoptimiertes Webdesign ~ aussagekräftige Fotografie ~ perfekte Grafik ~ treffsichere Texte ~
look22.de LOOK22 MediaService Internet Fotografie Grafik
359 Raumdesignerin .Silke Smida. kunst
Art by Silke Smida composed drawings find new places!
raumdesignerin.de Kunst Design Graffiti Wandtattoos Acryl
360 BEGINE Treffpunkt und Frauen
Interkulturelles Frauenkulturzentrum Künstlerinnenförderung Konzerte Ausstellungen Potsdamer Str. 139 BerlinSchöneberg
begine.de Frauen Lesben Frauencafé
361 Complett Räumung | Wohnungsauflösung wohnungsauflösung
Wohnungsauflösung Berlin günstig und schnell von Complett Räumung 030 261 01 714
complett-berlin.de Wohnungsauflösung Berlin Wohnungsauflösungen Entrümpelung Entrümpelungen
362 Contravision breaking news contra medienwerkstatt e.v. ContraVision
short film festival in berlin germany march 20th to march 28th
contravision.de ContraVision Cinema Contra
363 Doktus.de Dokumente uploaden FORMBLITZ AG doktus
Hier findet man Dokumente zu allen Themen und kann Dokumente suchen verwalten
doktus.de Doktus
364 | MARTINA DOEHRING | c/o Formblitz AG Martina
Dies ist die offizielle Website der Sopranistin Martina Doehring
martina-doehring.de Martina Doehring Sängerin
365 Wolfgang Kommerell | kommerell.de Wolfgang
Website von Wolfgang Kommerell: Segeln Fotografie.
kommerell.de Wolfgang Kommerell Fotografie
366 Marianne Rosenberg | RoseWeb Public Image GmbH Marianne
Die offizielle Website von Marianne Rosenberg mit aktuellen Infos SongDownloads Biografie Diskografie
roseclub.de Marianne Rosenberg Pop
367 Linux auf CD/DVDR linux
LinuxDistributionen auf CDR und DVDR tuxpost.de Shop
tuxpost.de Linux Iso Shop
368 Home Texts and Birgit
Dr. Birgit Hollenbach brings language and science together. Her university studies of translation and biochemistry
textsandtranslations.de Birgit Hollenbach Translation
369 .:|Stadtrundfahrten|Originelle Alternative Stadtrundfahrt|Berliner Dialekt Berlin
| BerlinerSchnauze Stadtrundfahrten | Alternative Stadtrundfahrt im Berliner Dialekt | Mundart sehr Orginelles Geschenk
berliner-schnauze.de Berlin Stadtrundfahrt Stadtrundfahrten Information Private
370 Übersetzer Deutsch Rumänisch Rumänisch
Übersetzungen Deutsch Rumänisch Dolmetscher für Rumänisch in Berlin profesionelle Übersetzung kundenorientiert
turbatu-translations.de Rumänisch Übersetzer Deutsch Rumänisch
371 Home / tausendschwarz.de Angebot
HomepageTitel Berlin
tausendschwarz.de Angebot Kompetenz Beratung
372 Subversionen.de | praeludium
??? Beuys + Agnoli
373 Betreutes Wohnen in Demenz betreutes
Der FAW e.V. begleitet und verwaltet ambulant betreute Wohngemeinschaften für Menschen mit Demenz.
verein-faw.de Betreutes Wohnen Demenz Wg
Seit nunmehr 26 Jahren ist das TRIO PALMERA unterwegs um landesweit und über die Landesgrenzen
trio-palmera.de Salsa Cumbia Merengue
375 Astrologische Gesundheits und Lebensberatung Astrologie
Astrologische Gesundheits und Lebensberatung Yvonne v. Bechtolsheim: Astrologie Reiki Ernährungsberatung und Radionik in
sternen-klar.de Astrologie Reiki Ernährungsberatung
376 Italienische Weine Online Weine
Vinila Weine aus Italien. Wer via eCommerce in Deutschland die besten italienischen Weine online
vinila.de Weine Wein Aus Italien
377 NAS Planung Baumanagement Nas Planung & Baumanagement GmbH & Co. KG Berlin
NAS Planung Baumanagement GmbH Co. KG Telefon +49 (0)30. 216 95 45
xn--nas-planungsbro-cwb.de Berlin Ahmet Nas
378 AllmendeKontor Gemeinschaftsgarten Allmende-Kontor e.V.
Allmende = Gemeingut = Commons: Berliner AllmendeKontor Gemeinschaftsgarten und eine der größten Hochbeetanlagen der
379 Beste Hunde: OnlineMagazin für
Das Online Hundemagazin mit aktuellen Artikeln zu Gesundheit Ernährung Erziehung und Verhalten
380 Berliner Schlagerfest 2012 berliner
Das Berliner Schlagerfest geht in die 2. Runde.
berliner-schlagerfest.de Berliner Schlagerfest 2012 Schlagerfest Berlinmitte
381 Birgit Schlieps Birgit
Urban Sculpture. Die Künstlerin Birgit Schlieps arbeitet mit dem urbanen Raum als Phantom Mythos
birgitschlieps.de Birgit Schlieps Kunst
382 Startseite Willkommen
383 Business Development Germany German
We are the leading German Marketing Company bringing your business on the German market. Our
cockpit-germany.de German Companies German Marketing
384 Coworkingberlinsquarehaus.de coworkingberlinsquarehaus Webseite! Square Haus am Nollendorfplatz GmbH
SquareHaus work meet share collaborate coworking büros konferenzraum
385 Business Development Germany German
We are the leading German Marketing Company bringing your business on the German market. Our
dashboard-germany.de German Companies German Marketing
386 Herzlich Willkommen Willkommen Forner + Forner GbR
Als kreatives und innovatives Unternehmen für Beratung und Kommunikation möchten wir Sie als vertrauensvoller Partner
387 Home SchwarzweißFotogr
Neue Wege Neue Sichten Neue Fotografien Du möchtest besser wahrnehmen und kreativ sein
fotografisch-sehen-lernen.de SchwarzweißFotografie Konzeptfotografie Fotografisch
388 Fotostudio Altman. Hochzeit Wettbewerb Studioalex.de
Suchen Sie einen professionellen Fotografen mit über 25 Jahre Erfahrung in der Fotografie? Dann sind
fotostudioalex.de Studioalex.de Hochzeit Wettbewerb Meine Traumhochzeit!
389 DIF | Dit is mirapodo ? operated by myToys.de GmbH
DAS Berliner Modeblog zu Fashiontrends und Modesünden Parties und Veranstaltern Designern und Kollektionen
390 Heilpraxis Susanne Weis Heilpraxis
Heilpraxis Susanne Weis
391 BAKUNAPOLI BakuNapoli
BAKUNAPOLI.Aserbaidschanische und italienische Küche.
baku-napoli.de BakuNapoli Restaurant Berlin Aserbaidschanische Küche
392 Kristina Jacoby Startseite Ghostwriter
Kristina Jacoby unterstützt Autoren bei der Erstellung ihrer Bücher
kristinajacoby.de Ghostwriter Ghostwriting Wissenschaftliches
393 Startseite Klinisches Krebsregister Klinisches Krebsregister für Brandenburg und Berlin gGmbH Klinisches
Informationen zur klinischen Krebsregistrierung in Brandenburg
kkrbb.de Klinisches Krebsregister Brandenburg
394 Kniggeinberlin.de Willkommen bei Knigge
Gesellschaftlicher Schliff selbstsicheres und stilvolles Auftreten ist heute wichtiger denn je. Jeder kann Benehmen
knigge-in-berlin.de Knigge Seminare KniggeSeminare Benehmen Benimmkurse
395 PROJECT318 photography
Homepage für die Vernissage / Ausstellung PROJECT318 der SRH Hochschule der populären Künste (hdpk).
project318.de Photography Design Motion
396 Ludger Jungnitz Prozessbegleitung Prozessbegleitung
Prozessbegleitung Berlin Ludger Jungnitz
prozessbegleitung-berlin.de Prozessbegleitung Coaching Projekte
397 SPAM Magazin SPAM
SPAM Magazin Ausgabe 01
spam-music.de SPAM; Magazin Musik
398 Text Julia Richter
Erstklassige Unternehmenskommunikation Texte und Konzepte in Berlin
399 ReBuy der einfache An reBuy reCommerce GmbH gebraucht
An und Verkauf für gebrauchte Handys Tablets Videopiele Filme CDs
rebuy.de Gebraucht Kaufen Gebraucht Verkaufen
400 Pasta e Più Startseite Frische
Frische Pasta in Berlin
pasta-e-piu.de Frische Pasta Berlin Raviolli Ghnochi
401 Aktuelles Bürgerinitiative
Stadtplanung von unten Stadtentwicklung TempelhofSchoeneberg Berlin
stadtplanung-von-unten.de Bürgerinitiative Bürgerbegehren Bürgerentscheid Anwohnerversammlung Gleisdr
402 Taxi Bildungscenter Berlin Treffpunkt Bildung GmbH Taxischein
Wir schulen seit 18 Jahren erfolgreich auf die Ortskundeprüfung mit eigenem ständig aktuellem
taxi-bildungscenter.de Taxischein PSchein Taxifahrer Fahrgastbeförderung Ortskundeprüfung
403 Studio NiMa Produktion Mode Kauffeld und Jahn GbR
Vom Entwurf bis zur Produktion. Mode und Textil. Studio NiMa ist in der Bekleidungsindustrie
404 Schuhe Online Shop myToys, mirapodo und ambellis - Shops der myToys.de GmbH
Schöner Schuhe shoppen ? riesige Auswahl für Damenschuhe ? Herrenschuhe ? und Kinderschuhe ? Bestellen
405 Yoga in Kreuzberg Yoga
Yoga in Berlin an Ihrem Arbeitsplatz oder besuchen Sie YogaKurse in Berlin Kreuzberg mit
yoga-und-massage.de Yoga Am Arbeitsplatz Yoga
406 MyToys | Alles für myToys, mirapodo und ambellis - Shops der myToys.de GmbH
myToys Ihr OnlineShop für Spielzeug Kindermode Babyausstattung und vieles mehr. Über 100.000
407 Werbung auf dem Sattelschoner|
Sattelschützer als Werbemittel: Bedrucken Sie Sattelbezüge mit Ihrem Logo. Individuelle Gestaltungsmöglichkeiten Lieferung nach drei
408 Finest Whisky Shop Whisky
Unsere Philosophie ist es hochwertige seltene und alte Flaschen der verschiedensten Destillen und Abfüller
finestwhisky.de Whisky Verkauf Berlin
409 Black meadow music production Martin Klein und Christian Kociolek GbR
black meadow music production is a label situated in Berlin.
410 Immocollect.de by Portal Financecollect Immocollect.de by Portal Financecollect GmbH Immocollect.de
Immobilienangebote von Immocollect.de by Portal Financecollect GmbH
immocollect.de Immocollect.de By Portal Financecollect GmbH
411 Simply : pr + simply
simply : die PR und Marketing Agentur für erklärungsbedürftige Produkte! fon +49 (0) 30. 21
agentur-simply.de Simply Public Relation
412 Ashtanga Yoga Schule Berlin Ashtanga
Ashtanga Yoga Schule in Berlin Schöneberg am Winterfeldtplatz Pallasstr. 89 10781 Berlin
ashtangayogaschoeneberg.de Ashtanga Yoga Berlin Schöneberg
413 Rosenscharf und Edelsüß Catering ZOE
Restaurant ZOE Berlin. Asiatische und mediterrane Küche zwischen Hackeschem Markt und Alexanderplatz in Berlin Mitte.
aromamanufaktur.de ZOE Restaurant Lounge
414 Online Marketing: Wissen
Endlich von Online Marketing profitieren. Portal Ratgeber für erfolgreiches Internetmarketing mit Grundlagen Tipps
Fachgeschäft für Naturkosmetik und Naturwaren. Kosmetische Behandlungen nach Dr. Hauschka und M.Gebhardt.
416 Architektur Planung Beratung
Architekten Hannover Berlin Architekturplanung Bauberatung Projektentwicklung Wertermittlung Architektur architectura nova
417 ChristianErdmann.de Christian
Willkommen auf der privaten Site von Christian Erdmann. Erfahren Sie mehr über meine Dozententäigkeit und
christian-erdmann.de Christian Erdmann Dozent Verwaltungsrecht Doppik.kom.bb
418 Christine Ordnung | Home xxxxx
christine-ordnung.de Xxxxx
419 CORINO 4 MEN CorinoArt
Photographer for beauty nude art fashion faces lingerie interieur
corino4men.de CorinoArt Photography Fotografie
420 Claudia Scholl Aktuelle Claudia
Claudia Scholl Buchkonzeption Gestalterische Konzepte Kinderkunstprojekte Illustration und Corporate Design
claudia-scholl.de Claudia Scholl Berlin Kartonzauber Grafikdesign
Herzlich willkommen bei der URBANIS GmbH
bvg-holding.de URBANIS Berlin Unternehmen
422 Home Chatwins Chatwin
CHATWINS: Bücher rund ums Reisen gibt es hier nach Ländern und Kontinenten sortiert. Reisen heißt:
chatwins.de Chatwin Chatwins Bruce Chatwin A
423 52. DeutschFranzösisches Volksfest Schaustellerverband Berlin e.V. Deutsch
Das mit Abstand größte jährliche Volksfest in Berlin Willkommen auf über 40.000m² Erlebnisfläche!
deutsch-franzoesisches-volksfest.de Deutsch Französisches Volksfest Laune
424 Beateberlin AGENTUR FÜR EVENTS beateberlin
beateberlin Agentur für Events und Stadterlebnisse in Berlin und Umgebung
beateberlin.de Beateberlin Agentur Agency
425 Berliner Berufsverband der Gesundheitsaufseher/Hygieneinspektoren BBGH
Der Berliner Berufsverband der Gesundheitsaufseher/Hygieneinspektoren stellt sich vor und bietet Informationsmaterial rund um den öffentlichen
bbghev.de BBGH BVH Hygiene
426 Organisationsberater Berater für Bio
Unternehmensberater für Ökologische Landwirtschaft (Biolandbau) und Biomarkt (Biohandel) ? Experte für Bio Lebensmittel und Biolandbau
bio-projektmanagement.de Bio Lebensmittel Bioprodukte
427 BeGreen Netzwerk für nachhaltiges beGreen Netzwerk für nachhaltiges Wirtschaften e.V. Verein
Alles Wissenswerte von der Historie über Ergebnisse Veranstaltungen und neueste Trends bis hin zur
begreen-net.de Verein Mitgliedschaft Beitrittserklärung
428 IOB Internationale OmnibusBetreibergesellschaft ZOB
ZOB Zentraler Omnibusbahnhof Berlin an Funkturm und Messegelände:
berlinzob.de ZOB Zentraler Omnibusbahnhof Berlin APC
429 Blauwerke verlag # groschenhefte blauwerke
Verlag aus Berlin fuer konkrete Literatur und konkrete Wissenschaft. Gebrauchstexte für die Westentasche.
blauwerke-berlin.de Blauwerke Blauwerke Berlin
430 Werbe und Vertriebsmangement GSW
Die “ FIGARO news” sind das GSW Club Magazin für die Mieter der GSW Immobilien
effektivwerbung24.de GSW Club Figaro News
431 Elena nehrmann promotion
Kultur Kommunikation
elenanehrmann.de Promotion P.r. Pr
432 MACKE Boutique Berlin
Mode ist Kultur Entsprechend diesem Motto bieten wir Ihnen stil und anspruchsvolle Mode und
433 DigitalphotoBerlin Foto
Phototechnik Fehling Fotografie Bearbeitung Entwicklung Vergrößerung von Diabildern Digitalfotografien
digitalphoto-berlin.de Foto Fotografie Photo
434 Diethard Küster Regisseur
Diethard K¸ster Regisseur Produzent Autor Regie Produktion
436 BEOBOOKS Bücher aus Bücher
BEOBOOKS Bücher aus Serbien Katarina Belovukovic
beo-books.de Bücher Serbien
437 Bettina Willumeit | Styling bettina
innovatives kundenorientiertes Fashion Styling für die Bereiche Werbung Editorialproduktionen und Onlinevermarktung
bettina-willumeit.de Bettina Willumeit Stylistin
438 HOME
439 Joomla Toplist Hauptseite joomla
Dies ist die deutsche JoomlaTopseitenliste. Hier finden Sie die wahrscheinlich besten Seiten die mit
joomla-toplist.de Joomla Toplist Best
440 Jugendhilftweiter.de Jugend
Modellprojekt Jugendräte: Eine Homepage von den Jugendräten des Modellprojekts Jugendräte von Berlin SchönebergNord
jugend-hilft-weiter.de Jugend Hilft Weiter
441 LumpenPrinzessin ... Kinderkleidung Kinderkleidung
Die LumpenPrinzessin bietet seit über 15 Jahren Alles für Baby und Kind in gut erhaltener
lumpenprinzessin.de Kinderkleidung Kindermode Kinderschuhe
442 Herzlich Willkommen auf LittleThailand.de thai
Die neuesten und beliebtesten ThaiMassagen ThaiRestaurants Shops und mehr Mit vielen Bewertungen
little-thailand.de Thai Verzeichnis übersetzer Shops Restaurants
443 Evelyn Bornemann Berlin Berlin
Evelyn Bornemann in Berlin Physiotherapie Psychotherapie (HPG) Coach nach der TippingMethode hilft
evelyn-bornemann.de Berlin Physiotherapie Psychotherapie
444 ||| EuroKaukAsia     EuroKaukAsia e.V.
KaukasischEuropäischer Kultur und Wissenschaftsverin e.V.
445 Excelle.consulting | Produktions und excelle.consultin
excelle.consulting bietet kundenindividuelle Lösungen zu Fragen der strategischen Unternehmensentwicklung und der Gestaltung operativer Leistungsstrukturen sowie
excelle-consulting.de Excelle.consulting Excelle Excelle.de
446 F/21 Büro für Nora
f/21 Büro für Zukunftsfragen ist Beratungsinstitut und Denkfabrik. f/21 beobachtet die Gegenwart identifiziert
f-21.de Nora Stampfl Nora S. Stampfl
Natalia Domagala
448 Investieren wie die Superreichen Investieren
Wie auch Sie schnell und einfach die Investments der Superreichen finden die nur ein
superreichtum.de Investieren Geld Anlegen
449 Mediation in Diversity Mediation
Mediation in Konfliktfällen Preisgünstige Mediationsausbildung nach anerkannten Standards von Bundesverbänden oder erfahrene Mediatoren? Kontaktieren
meddiv.de Mediation Berlin Mediationsausbildung Berlin
450 Jura Service Berlin | kaffeevollautomat
Jura Service Berlin| Kaffeemaschine u. Kaffeeautomat ReparturWartung u. Kundendienst in Berlin.Reparaturen von Kaffeemaschinen u.
jura-service-berlin.de Kaffeevollautomaten Reparatur Jura Service Kaffeemaschinen
451 Kanzlei Klaus Koblitzek homepage
homepage dokument webpage page web netz
kanzlei-koblitzek.de Homepage Dokument Webpage Page Web
452 Kanzlei Rechtsanwalt Böcker joomla
Joomla! dynamische PortalEngine und ContentManagementSystem
kanzleiboecker.de Joomla Joomla
453 Rechtsanwaltskanzlei und Notariat Michael Rechtsanwalt
Rechtsanwaltskanzlei und Notariat Michael Müller Rechtsanwalt und Notar Michael Müller in Berlin Schöneberg berät
kanzlei-mmueller.de Rechtsanwalt Notar Berlin
454 Schauspieler Coaching Berlin Karin
Mit dem KarriereTraining für Schauspieler durchstarten und dranbleiben. Die eigene Karriere lustvoll und aktiv gestalten.
karin-kleibel.de Karin Kleibel PR
455 LumpenPrinzessin ... Kinderkleidung Kinderkleidung
Die LumpenPrinzessin bietet seit über 15 Jahren Alles für Baby und Kind in gut erhaltener
kind-in-berlin.de Kinderkleidung Kindermode Kinderschuhe
456 Claudia Scholl Aktuelle Claudia
Claudia Scholl Buchkonzeption Gestalterische Konzepte Kinderkunstprojekte Illustration und Corporate Design
kartonzauber.de Claudia Scholl Berlin Kartonzauber Grafikdesign
457 Krups | Siemens | aeg
Krups | Siemens | AEG | ReparaturServiceWartung und Kundendienst in Berlin.Kaffeemaschinen und Kaffeevollautomaten
kaffeemaschine-reparatur.de Aeg Krups Siemens Kaffeevollautomaten Kaffeemaschinen
458 Home
Elzers Seiten zum Wohnungseigentumsrecht
459 Patwork
460 Peter Bruns Homepage Peter
Homepage von Peter Bruns
peterbruns.de Peter Bruns Cello
461 Rechtsanwälte PfaffHofmann u. Lee Rechtsanwalt
Die Rechtsanwaltskanzlei PfaffHofmann u. Lee legal Rechtsanwaltsgesellschaft bietet eine und zielorientierte Beratung. Schwerpunkt Wirtschaftsrecht z.B.
phl-legal.de Rechtsanwalt Rechtsanwaltskanzlei Arbeitsrecht
462 ..::Phoenix Lounge::.. Phoenix
Phoenix Lounge. Bar Restaurant Cafe in Schöneberg.
phoenix-lounge.de Phoenix Lounge Phoenix
463 Physimetron Elektronische Messtechnik Transimpedanzvers
Rauscharme analoge und digitale elektronische Messtechnik
physimetron.de Transimpedanzverstärker Pikoamperemeter Vorverstärker
464 Mobilienberlin.de living
mobilien: die schönen dinge zum leben wohnen und arbeiten! besuchen sie uns in berlinschöneberg...
mobilien-berlin.de Living Wohnen Wohnaccessoires
465 Otto Events Veranstaltungstechnik veranstaltungstec
Otto Events organisiert Ihre Veranstaltung in Berlin Brandenburg und Potsdam. Wir vermieten Veranstaltungstechnik
ottoevents.de Veranstaltungstechnik Berlin Potsdam
466 Naturheilpraxis im Hofbogen behandlung
Naturheilkunde Praxis Hofbogen Heilung Anwendung Rheuma Therapie Heilpraktiker
heilpraktikerin-schoeneberg.de Behandlung Therapie Körper
467 HALBE STUNDEN // HALF Kurzfilm
halbestunden.de Kurzfilm Leere Familie
468 Flamencomeetsclassic flamenco
flamencomeetsclassic ist ein Tanztheater aus Berlin das klassische Texte Flamencomusik und Tanz zu
flamenco-meets-classic.de Flamenco Tanz Tanztheater
469 Flats Co. Flats & Co. GmbH Waldmannstr.
Eigentumswohnungen Waldmannstr. 3 BerlinLankwitz
flatsandco.de Waldmannstr. 3
470 Praxis für integrale Medizin Integral
Arztpraxis Dr. Martin Bosch BerlinSchöneberg
integralmedicine.de Integral Medicine Arztpraxis
471 Startseite
Anwälte Steuerberater PSInkasso
472 Gerd Brendel | Journalist Gerd
Gerd Brendel Journalist
gerdbrendel.de Gerd Brendel Journalist
473 Autorin Martina Gneist CBT
Autorin Martina Gneist Projekte und Philosophie
gn-konzepte.de CBT WBT Lernkonzepte
474 Startseite hanslux Open
Beratung und Dienstleistungen für Computer Netze und ITSicherheit unter Verwendung von OpenSource Produkten
hanslux.de Open Source Freie Software
475 Theater Hans Wurst Nachfahren Grüffelo
Hans Wurst Nachfahren Theater für Kinder und Erwachsene in BerlinSchöneberg zeigt Spielplan
hasn-wurst-nachfahren.de Grüffelo Puppentheater Berlin
476 Organisationsberater Berater für Bio
Unternehmensberater für Ökologische Landwirtschaft (Biolandbau) und Biomarkt (Biohandel) ? Experte für Bio Lebensmittel und Biolandbau
handel-und-wandel.de Bio Lebensmittel Bioprodukte
477 Fachanwalt für Arbeitsrecht Berlin Fachanwalt
Fachanwalt für Arbeitsrecht Erbrecht und Versicherungsrecht in Berlin sowie Notar Berlin. Kanzlei Gäbelein
gaebelein-veith.de Fachanwalt Arbeitsrecht Versicherungsrecht
478 DFRV Regionalgruppe Berlin
| Website der Regionalgruppe Berlin des Deutschen Fundraising Verbands
479 Fußballwörterbuch in 7 Sprachen
FußballWörterbuch in 7 Sprachen: Homepage des Buches von Kaya Yildirim
480 Felicitas Jacobs Theaterpädagogin Theater
Ich biete vielfältige theaterpädagogische Qualifikationen als Ausbildung oder Fortbildung initiiere theatrale Prozesse und entwickle
felicitasjacobs.de Theater Pädagogik Spiel
481 Organisationsberater Berater für Bio
Unternehmensberater für Ökologische Landwirtschaft (Biolandbau) und Biomarkt (Biohandel) ? Experte für Bio Lebensmittel und Biolandbau
conradthimm.de Bio Lebensmittel Bioprodukte
482 Startseite constant balance Fußpflege
Heilsame Behandlungen für Körper Geist und Seele Fußpflege Massagen und Heilarbeit
constant-balance.de Fußpflege Wellness Entspannung
483 Organisationsberater Berater für Bio
Unternehmensberater für Ökologische Landwirtschaft (Biolandbau) und Biomarkt (Biohandel) ? Experte für Bio Lebensmittel und Biolandbau
consultantfororganictrade.de Bio Lebensmittel Bioprodukte
484 Querschnitt Weine
Querschnitt Weine Weinhandlung in BerlinSchöneberg
485 Startseite
Rechtsanwältin Sylvia PfaffHofmann: Ihr Recht in guten Händen! Spezialgebiete: Europarecht Einbuergerungsrecht und Asylverfahrensrecht
486 Praya ThaiMassage Startseite Massage
Praya ThaiMassage Ihre Praxis in Berlin bietet professionelle Physiotherapie und Massagen als therapeutisches
prayathai.de Massage Praxis
487 Startseite
Anwälte Steuerberater PSInkasso
488 Kanzlei Rechtsanwalt Böcker joomla
Joomla! dynamische PortalEngine und ContentManagementSystem
rechtsanwaltskanzlei-24.de Joomla Joomla
489 Fachanwalt Strafrecht Rechtsanwalt Fachanwalt
Fachanwalt Strafrecht Rechtsanwalt Feldkamp Berlin
rechtsanwaltskanzlei24.de Fachanwalt Strafrecht Rechtsanwalt
490 Reinigung360.de | Professionelle Gebäudereinigung Reinigung
Gebäudereinigung Büroreinigung Bauendreinigung Glassreinigung Laborreinigung Praxisreinigung Spezialreinigung Teppichreinigung
reinigung360grad.de Reinigung Reinigung Berlin
491 REISEDIENST WITTER: Tolle Reisen. Witter
REISEDIENST WITTER: Tolle Reisen. Viel Vergnügen!
reisedienst-witter.de Witter Reisedienst REISEDIENST
492 Schiek Sports Germany Bodybuilding Schiek
Offizieller Distributor Schiek Sports in Deutschland erhältlich Schiek Sports Schiek Sport Handschuhe
schiek-store.de Schiek Sport Handschuhe
493 Schiek Sports Germany offizieller Schiek
Offizieller Distributor von Schiek Produkten in Deutschland Fitness Bodybuilding Zubehör Fitnesshandschuhe Zughilfen Handgelenkschutz Bandagen
schiek-germany.de Schiek Fitnesshandschuhe Trainingsgürtel
494 HOME
Schulshirt Schulkleidung Schuluniform TShirts PoloShirts Sweatshirts Kapuzenshirts Kleidung Uniform Schule Freizeit Caps
495 Senioren Beratung Berlin Seniorenberatung
Seniorenberatung Berlin
senioren-beratung-berlin.de Seniorenberatung Pflegeheimberatung Neue
496 Datenschutzanalyse externer Datenschutzbeauftragter PrivCom Datenschutz GmbH Datenschutz
Wir organisieren als externe Datenschutzbeauftragte mit DatenschutzAudits Schulungen und Sicherheitstests datenschutzkonforme und sichere Prozesse.
privcom.de Datenschutz Audits Datensicherheit
497 PROMINENTENBAU© Prominentenbau
Erwachsene bauen mit LEGO Elementen für Kinder
prominenten-bau.de Prominentenbau Prominent DAI Lego Hellweg
PME ProBau Management und Entwicklungsgesellschaft mbH
pme-gmbh.de PME ProBau Management Entwicklungsgesellschaft
499 Startseite
Rechtsanwältin Sylvia PfaffHofmann: Ihr Recht in guten Händen! Spezialgebiete: Europarecht Einbuergerungsrecht und Asylverfahrensrecht
500 IOB Internationale OmnibusBetreibergesellschaft ZOB
ZOB Zentraler Omnibusbahnhof Berlin an Funkturm und Messegelände:
iob-berlin.de ZOB Zentraler Omnibusbahnhof Berlin APC
501 Nina Petrick ? Autorin Nina
Nina Petrick freie Autorin für Kinder und Jugendbücher Belletristik und Kurzgeschichten. Ihr Jugendbuch
nina-petrick.de Nina Petrick Autorin
502 Digital Innovation Facilitator GuentherLange GmbH digitale
Mit Design Thinking systematisch zu kreativen Problemlösungen für das InternetBusiness: Jens Otto Lange moderiert Ideen
jensottolange.de Digitale Innovation Kreativität
503 Berlinatnight.de :: Stadtmagazin für Musikkalender
NightlifeGuide für Berlin: Clubs Bars Parties Tickets Kinoprogramm Konzerte
berlinatnight.de Musikkalender Movie Genießen
504 Www.djembeberlin.de
Du möchtest die westafrikanische Trommel Djembe spielen lernen. Hier findest du eine Liste von Lehrern
505 Naturheilpraxis im Hofbogen behandlung
Naturheilkunde Praxis Hofbogen Heilung Anwendung Rheuma Therapie Heilpraktiker
hofbogen.de Behandlung Therapie Körper
506 Theater Hans Wurst Nachfahren Grüffelo
Hans Wurst Nachfahren Theater für Kinder und Erwachsene in BerlinSchöneberg zeigt Spielplan
hans-wurst-nachfahren.de Grüffelo Puppentheater Berlin
507 Berliner Berufsverband der Gesundheitsaufseher/Hygieneinspektoren BBGH
Der Berliner Berufsverband der Gesundheitsaufseher/Hygieneinspektoren stellt sich vor und bietet Informationsmaterial rund um den öffentlichen
hygieneinspektoren.de BBGH BVH Hygiene
508 Kanzlei Rechtsanwalt Böcker joomla
Joomla! dynamische PortalEngine und ContentManagementSystem
kanzlei-boecker.de Joomla Joomla
509 ..::Phoenix Lounge::.. Phoenix
Phoenix Lounge. Bar Restaurant Cafe in Schöneberg.
phoenixlounge.de Phoenix Lounge Phoenix
510 Rosenscharf und Edelsüß Catering ZOE
Restaurant ZOE Berlin. Asiatische und mediterrane Küche zwischen Hackeschem Markt und Alexanderplatz in Berlin Mitte.
rosenscharf-edelsuess.de ZOE Restaurant Lounge
511 Tucanu Webseiten leicht Jürgen
tucanu der Weg zur eigenen Homepage leicht zu haben einfach zu bedienen
tucanu.de Jürgen Kubens Beratung
512 Nicolai Thärichen Komponist Arrangeur Thärichens
Nicolai Thärichen Komponist Arrangeur Pianist Aktuelles 2009 Thärichens Tentett Konzerte
thaerichen.de Thärichens Tentett Konzerte Myspace
513 Felicitas Jacobs Theaterpädagogin Theater
Ich biete vielfältige theaterpädagogische Qualifikationen als Ausbildung oder Fortbildung initiiere theatrale Prozesse und entwickle
theaterpaedagogische-kunst.de Theater Pädagogik Spiel
Herzlich willkommen bei der URBANIS GmbH
urbanis-berlin.de URBANIS Berlin Unternehmen
515 Ihre Website erstellen
Alles rund um die Website. Vorkonfiguriert oder maßgeschneidert für lokale Unternehmen aus Dienstleistung Handwerk
516 Studio la voce Sängerin
Stefania Erzmoneit Habsburgerstrasse 5 10781 Berlin fon: 03021 99 68 23 fax:
studiolavoce.de Sängerin Sängerin Klang
517 Home Andrea Schlinkert Queer
Dies ist die Seite von Andrea Schlinkert Tanzlehrerin und Djane in Berlin.
tangoschlampen.de Queer Tango Queer Argentino
518 Willkommen auf der Startseite Tango
Tango Rueda eine Begegnung in vier Takten in Berlin
tangorueda.de Tango Rueda Berlin
519 VIEV | NEW
VIEV ? das sind Wagner Werner ein deutschchilenisches Designerkollektiv aus Berlin.
520 Excelle.consulting | Produktions und excelle.consultin
excelle.consulting bietet kundenindividuelle Lösungen zu Fragen der strategischen Unternehmensentwicklung und der Gestaltung operativer Leistungsstrukturen sowie
excelle.de Excelle.consulting Excelle Excelle.de
521 Wanderreisen Pierolt Wanderreisen
Wanderreisen Pierolt Wandern im Spreewald Hüttenwanderung in den Lienzer Dolomiten Wandern rund
wanderreisen-pierolt.de Wanderreisen Pierolt Wandern Im
522 SammlungsVerkauf coupon
Webdealscout Suche deine Gutscheine Deals und Rabatte
webdealscout.de Coupon Gutschein Geschenk
523 Theo G. Gilbers Sexualpädagoge
Sexualpädagogische Fortbildung für pädagogische und psychosoziale Fachkräfte
theogilbers.de Sexualpädagoge Und Sexualtherapeut
524 Schmuckmanufaktur Berlin Goldschmiedin Schmuckmanufaktur
Schmuckmanufaktur Berlin Goldschmiedin Schmuck Trendart
schmuckmanufaktur-berlin.de Schmuckmanufaktur Berlin Goldschmiedin
525 LumpenPrinzessin ... Kinderkleidung Kinderkleidung
Die LumpenPrinzessin bietet seit über 15 Jahren Alles für Baby und Kind in gut erhaltener
schuhchen.de Kinderkleidung Kindermode Kinderschuhe
526 Robert Berghoff Berlin robert
Mit einfachem Blick auf die Dinge: Bildgestaltender Kameramann Director Of Photography Cinematographer
robertberghoff.de Robert Berghoff Filme
527 Schuldnerberatung Berlin Schuldenberatung Berlin Schuldnerberatung
? Schuldnerberatung Berlin vom Anwalt Privatinsolvenz Restschuldbefreiung Verbraucherinsolvenz Schuldenberatung Verbraucherinsolvenzverfahren. Rechtsanwalt Pillig Berlin
restschuldbefreiung.de Schuldnerberatung Berlin Privatinsolvenz Restschuldbefreiung Schuldenberatu
528 HOME
Schulshirt Schulkleidung Schuluniform TShirts PoloShirts Sweatshirts Kapuzenshirts Kleidung Uniform Schule Freizeit Caps
529 Home ? Goldschmiede Schmuckbotschaften
Goldschmiede Schmuckbotschaften aus Berlin entwirft individuellen Schmuck!
530 Startseite
Anwälte Steuerberater PSInkasso
531 Gabriele Steiner Praxis für Ärztin
Gabriele Steiner Praxis für Homöopathie am Winterfeldtplatz in BerlinSchöneberg Ärztin für Allgemeinmedizin
steiner-gabriele.de Ärztin Homöopathie Homoeopathie
532 Stephan Szasz Startseite Über
Ich bin Stephan Szasz aus Berlin und erzähle euch auf dieser Webseite ein paar Geschichten
stephan-szasz.de Über Mich Hobby
533 Patwork
534 52. DeutschFranzösisches Volksfest Schaustellerverband Berlin e.V. Deutsch
Das mit Abstand größte jährliche Volksfest in Berlin Willkommen auf über 40.000m² Erlebnisfläche!
volksfest-berlin.de Deutsch Französisches Volksfest Laune
535 Apartment Dr. Claudia Malzfeldt
536 Wirtschaftsmediatoren Berlin Wirtschaftsmediat
Wirtschaftsmediatoren Berlin
wirtschaftsmediatoren-berlin.de Wirtschaftsmediator Mediator Madiation Spannagel Eckolt
537 Home Musik
Kinderlieder Wir Kinder vom Kleistpark gute Musik für Kinder Konzerte für Kinder
wirkindervomkleistpark.de Musik Für Kinder Kinderkonzerte
538 Ölmühle Berlin Olivenöl
Olivenöl aus der ölmühle Berlin Schöneberg. Bei uns finden Sie ein Sortiment von über 60 meist
xn--lmhleberlin-qfb4f.de Olivenöl Olivenholz Balsamico
539 Home
Sachverständiger von der Handwerkskammer Berlin öffentlich bestellter und vereidigter Sachverständiger für das Dachdeckerhandwerk Steildacheindeckungen
540 Brautkleider alles für Kalamov und Kalamova GbR
Bei uns finden Sie moderne und günstige Brautkleider Abendmode Accessoires Dessous. Schneller
541 Anke Sevenich | Schauspielerin
Anke Sevenich gehört zu den besten wenn auch eher unauffälligen Schauspielerinnen des deutschen Fernsehens
542 Restaurant AltÖsterreich Startseite Restaurant
Restaurant AltÖsterreich heißt: Echtes Wiener Schnitzel duftende Frittatensuppe eine ordentliche Portion Kaiserschmarrn oder
alt-oesterreich.de Restaurant AltÖsterreich Alt
543 Startseite Queer
Musikversierte und begeisterte Djane mit breitgefächertem Musikrepertoire für jegliche Anlässe buchbar. Ob Standard und Lateinmusik
andrea-schlinkert.de Queer Tango Queer Argentino
544 Welcome to Berlin Gym aktiv
Auf diesen Seiten findet Ihr alle Informationen rund um den Verein Berlin Gym ? Verein
berlin-gym.de Aktiv Fitness Kampfsporttraning
545 Berliner Berufsverband der Gesundheitsaufseher/Hygieneinspektoren BBGH
Der Berliner Berufsverband der Gesundheitsaufseher/Hygieneinspektoren stellt sich vor und bietet Informationsmaterial rund um den öffentlichen
bhbbev.de BBGH BVH Hygiene
546 Bing Ma Communication China
Neue Seite
bingma.de China Business Marketing
547 Schreibcoaching in Berlin Schreibcoaching
Schreibcoaching: Sie schreiben gerade an einer wissenschaftlichen Abschlußarbeit? Bringen Sie sich mit Schreibcoaching wieder in
faden-verloren.de Schreibcoaching Wissenschaftliche Abschlussarbeit
548 Ferienhaus Wittingen
Ferienhaus Wittingen
549 Organisationsberater Berater für Bio
Unternehmensberater für Ökologische Landwirtschaft (Biolandbau) und Biomarkt (Biohandel) ? Experte für Bio Lebensmittel und Biolandbau
consultantorganictrade.de Bio Lebensmittel Bioprodukte
550 Home
Brandenburger Tor Variationen mit FotoGalerie TorVariationen Brandenburg Berlin Logo
551 Floorwalker.de Einfach. Schnell. floorwalker
Ein Floorwalker bietet nicht nur bei der Einführung neuer Software effektiven Support sondern auch
floorwalker.de Floorwalker Floorwalking Office
552 FHING Aktuell Werbung
für heute ist nichts geplant
fhing.de Werbung Postkarte Schwul
553 Restaurant AltÖsterreich Startseite Restaurant
Restaurant AltÖsterreich heißt: Echtes Wiener Schnitzel duftende Frittatensuppe eine ordentliche Portion Kaiserschmarrn oder
diodata-restaurant.de Restaurant AltÖsterreich Alt
554 Startseite House of House of Queer Sisters e.V. Queer
Wir sind Sisters und Guards die Gutes tun und dies überall wo wir gebraucht
house-of-queer-sisters.de Queer Sisters Schwulen
555 OnlineShop Bastelkits. Made
Wir haben ein Kit entwickelt mit dem man gleich loslegt in dem gute
556 Linda Sixt Linda
Linda Sixt
linda-sixt.de Linda Sixt
557 Lofts Co. Lofts & Co. GmbH lofts
Lofts Co. Best in Lofts!
loftsandco.de Lofts Berlin Dachwohnung Berlin
558 Antiquariat Mertens und Pomplun Antiquariat Mertens & Pomplun GbR Antiquariat
Antiquariat antiquarische Bücher OriginalPhotographien Fotografie Plakate Landkarten Luxuspapier
mp-rarebooks.de Antiquariat Antiquarische Bücher
559 MR Patterns Willkommen Nähen
Mr Patterns das Schnittstudio fuer SelberMacher
mrpatterns.de Nähen Schnittmuster Schnittkurs
560 Psychotherapie und Coaching in
Sie suchen einen Psychotherapeuten oder Coach in Berlin? Sie sind in einer schwierigen privaten oder
561 Gaastra Napapijri Diesel online Markenmode
Fashiontex 24 Online Shop. Ihr Designer Online Shop mit Markenbekleidung wie Gaastra Jacke Poloshirt
fashiontex24.de Markenmode Gaastra Napapijri
562 Heilpraktikerin in Berlin Schöneberg Homöopathie
Isabel Blume Heilpraktikerin Klassische Homöopathie und Shiatsu in Berlin
isabel-blume.de Homöopathie Klassische Homöopathie
563 Http://www.KinderladenKonfetti.de
Mitten im Schöneberger Winterfeldtkiez in Berlin liegt der kleine bunte Kinderladen Konfetti. Zwei Erzieherinnen
Die MUTTER in Berlin Schöneberg bietet vom Frühstück im Außenbereich thailändischer Küche und Cocktails
mutter-berlin.de Thai Bar Berlin Thaifood Frühstück
565 Zuhause Mundgerecht Magazin Save
MUNDGERECHT ist mehr als nur ein Magazin. Eigentlich sind wir ein soziales Startup mit einer
mundgerecht-magazin.de Save Food Nachhaltiges Essen
566 Home Siebergraphic Siebergraphic Berlin
siebergraphic macht die Grafik für Sie in Berlin Nürnberg und Umgebung. Egal was
siebergraphic.de Berlin Grafik Illustration
567 Schlüsseldienst Tempelhof Endpreise direkt Schlüsseldienst
Günstiger Schlüsseldienst für Tempelhof. Probleme mit Ihrem Türschloss? Kein Problem. Wir helfen kostengünstig schnell
schluesseldienst-tempelhof-berlin.de Schlüsseldienst Tempelhof Ihr Schlüsseldienst
568 StoppRitalin | Die ScherretMethode Wachstumsstörunge
Bei immer mehr Kindern und Jugendlichen in Deutschland stellen Ärzte Aufmerksamkeits und Hyperaktivitätsstörungen fest.
stopp-ritalin.de Wachstumsstörungen ADHS Ritalin StoppRitalin ScherretMethode
569 HOME
570 Wellfina Wellness Fitness Naturheilkunde
Angebot: Personal Training Ernährungsberatung Mesotherapie (Anti Aging) Kinesiologie Neuraltherapie Schröpfen
wellfina.de Naturheilkunde Heilpraktiker Personaltraining

Ergebnisse der Bewertung der Themenseite zu Neueröffnungen, verkaufsoffene Sonntage, Gutscheine und Coupons in Berlin
36 Bewertungen ergeben 3 StadtBranche Punkte

Berlin ist die Bundeshauptstadt der Bundesrepublik Deutschland und zugleich eines ihrer Länder. Die Stadt Berlin ist mit rund 3,5 Millionen Einwohnern die bevölkerungsreichste und mit 892 Quadratkilometern die flächengrößte Gemeinde Deutschlands sowie nach Einwohnern die zweitgrößte der Europäischen Union. Sie bildet das Zentrum der Metropolregion Berlin/Brandenburg und der Agglomeration Berlin . Der Stadtstaat unterteilt sich in zwölf Bezirke. Neben den Flüssen Spree und Havel befinden sich im Stadtgebiet kleinere Fließgewässer sowie zahlreiche Seen und Wälder.

LandkreisKreisfreie Stadt Berlin

Berlin Karte

Berlin Karte Kreisfreie Stadt Berlin Berlin Berlin Stadtplan Kreisfreie Stadt Berlin Berlin