optional Stadt:
Ort ›

Berlin › Kreisfreie Stadt Berlin › Berlin

Branchenbuch Berlin 10783 Berlin

Kreisfreie Stadt Berlin


1 Detektiv Detektei
13409
Berlin
Die City Detektei in Berlin, steht Ihnen gerne zur Verfügung wenn es um die Ermittlungen und Observierungen...
city-detektei.com Detektei City Privatdetektive Wirtschaftsdetektive Personen Ermittlungen Mobbing Auffinden
2 Detektiv Detektei
13409
Berlin
Die City Detektei in Berlin, steht Ihnen gerne zur Verfügung wenn es um die Ermittlungen und Observierungen...
city-detektei.com Detektei City Privatdetektive Wirtschaftsdetektive Personen Ermittlungen Mobbing Auffinden
3 Frau Hilfreich die mobile Katzensitterin Katzensitter
14129
Berlin
Frau Hilfreich Ihre mobile Kiez- Katzensitterin in Nikolassee, Schlachtensee, Wannsee, Grunewald, Dahlem und Zehlendorf. Besuchen Sie meine Internetseite...
frau-hilfreich.com Hilfreich Frau Wannsee Zehlendorf Stubentiger Ihren Augen Kiez
4 Frau Hilfreich die mobile Katzensitterin Katzensitter
14129
Berlin
Frau Hilfreich Ihre mobile Kiez- Katzensitterin in Nikolassee, Schlachtensee, Wannsee, Grunewald, Dahlem und Zehlendorf. Besuchen Sie meine Internetseite...
frau-hilfreich.com Hilfreich Frau Wannsee Zehlendorf Stubentiger Ihren Augen Kiez
5 15 Beispiele gelungener Kriegs- und Bürgerkriegsprävention Friedensforschung
14195
Berlin
Das 2017 neu von dem gemeinnützigen Verein Forum Crisis Prevention e.V. herausgegebene Buch auf englisch, deutsch und...
crisis-prevention.info Prevention Peace Crisis Forum Building Commission Organisationen Beispiele
6 Werbeagentur Goldweiß Werbeagentur
10437
Berlin
Als Werbeagentur Goldweiß arbeiten wir nach mehreren Prinzipien, die alle zur Zufriedenheit unserer Kunden und zum Erfolg...
agentur-goldweiss.de Texte Werbeagentur Seite Goldweiß Marketing Keine Fragen Ständige
7 Flink Rohrreinigung Berlin Klempner + Sanitär Klempner
13355
Berlin
Egal ob verstopftes Klo, Badewanne, Verschlammter Kanal oder einfaches Rohr, wir spülen flink wieder durch. Unsere Rohr...
flink-rohrreinigung.de Rohrreinigung Berlin Info Verstopfung Problem Wasser Notdienst Reinigung
8 WLAN Hotspot für Veranstaltungen mieten Veranstaltungstechnik Eventbranche
10117
Berlin
Unser mobiles Veranstaltungs-WLAN bietet Ihren Gästen Zugang zum Internet: zuverlässig, sicher und unkompliziert. Derzeit bieten wir WIFi-Insellösungen...
wlan-hotspot-mieten.de Hotspot Gäste Vermietung Event Veranstaltung Service Full Zoll
9 Ideal Sterbegeldversicherung Versicherung
13086
Berlin
Dieser Ratgeber stellen euch die idealen Anbieter von Sterbegeldversicherungen vor....
ideal-sterbegeldversicherung.de/ Sterbegeldversicherung Ratgeber Sterbegeld Angebote Warum Lebensversicherung Testsieger Sterbegeldversicherunghellip
10 Essayhilfe - jede akademische Arbeit: schnell Ghostwriter
10178
Berlin
EssayHilfe können Ihnen hochwertige wissenschaftliche Arbeiten zu günstigsten Preisen mit einer Vielzahl von Rabatten, die unsere Dienstleistungen...
essayhilfe.de Uns Ghostwriter Bachelorarbeit Schreiben Danksagung Diplomarbeit Kontaktiere Masterarbeit
11 SCHMUCKE Galerie-Werkstatt für zeitgenössischen Schmuck und Galerie Schmuck
10625
Berlin
schmucke.net Schmucke Arbeiten Berlin Galerie Werkstatt Künstler Individualität News
12 Tischkreissäge kaufen Heimwerken
10115
Berlin
Wir präsentieren Ihnen Kreissägen jeder Art. Egal ob Handkreissäge, Tischkreissäge oder Kappsäge....
kreissaege-kaufen.com/ Angebot* *zum Kaufen Tischkreissäge ✔ Handkreissäge Kreissäge Wordpress

Kostenloses Buch Tipps & Tricks für Arbeitswelt & Leben:

Erhalten Sie Ihr Buch "Tipps und Tricks für Arbeitswelt und Leben"
kostenlos per E-Mail als .pdf Datei:


13 Dimitri Finanzen Bitcoin
10625
Berlin
Krypto Vergleich ist ein Vergleichs- und Bewertungsportal für Kryptowährungen und Blockchain Technologien. Mit unserer Experten Community aus...
krypto-vergleich.de/ Vergleich Bitcoin Linked Plus Krypto Google Keine ⭐
14 Moderne kabellose Alarmanlagen und Alarmsysteme Alarmanlagen
12623
Berlin
Die Petit Alarmanlage ist ein Infraschall Alarmsystem das sich insbesondere durch seine einfache Montage und Bedienung auszeichnet....
petit-alarmsysteme.de Petit Alarmanlagen Brandenburg Berlin Le ✔ Shop Hinweise
15 Limousine Berlin Limousinenservice
10115
Berlin
Wir vermieten Limousinen und Stretchlimousinen im Bereich Berlin und Brandenburg....
b-limo.de Stretchlimousine Berlin Anfrage Partybus Buchung Offers Hochzeitsauto Limousine
16 Social Media Daily Social Media
10119
Berlin
{Social Media Daily {provides|offers} {top-notch|reliable|professional} social media marketing {services|products} to businesses and individuals {worldwide|around the globe}.|{If|When} you...
socialmediadaily.com/ Followers Likes Soundcloud Instagram Mixcloud Youtube Views Vimeo
17 Carmen Schroll -Jazz Sängerin Musiker
10781
Berlin
Jazz Konzerte im Duo für Ihren Event: Wir bieten im Duo oder Ensemble: Auftritte für private Feiern oder Firmenanlässe; Unterhaltungsmusik...
carmen-schroll.de Carmen Jazz Schroll Berlin Ensemble Vocal Sängerin Jazzclub
18 Laser ONE - Institut für apparative Laser Haarentfernung
10707
Berlin
Laser ONE Institut - ist ein professioneller Anbieter im Bereich der apparativen Kosmetik in Berlin mit Schwerpunkt...
laserone.de Laser Haarentfernung Behandlung Haare Google Informationen Institut Haut
19 Schäferhunde Schäferhundzüchter
12623
Berlin
Als verantwortungsvoller Züchter liegen mir “gesunde, wesensfeste Schäferhunde” am Herzen. Mein Zuchtziel steht heute noch unter dem selben...
vonderliszt.de Welpen Bewi Liszt Berlin Zucht Würfe Farbe Hund
20 Regsamkeit & Wachstum Heilpraktikerin Auf
13359
Berlin
Praxis für Regsamkeit & Wachstum EMDR und Entspannungstherapie Prävention und Gesundheitsförderung Ich richte mich nach Ihren Wünschen – eine Massage...
regsamkeit-und-wachstum.de Wittek Antonia Instagram Linkedin Angebote Server Heilpraktikerin
21 Shakti-Yogaloft Ausbildung Sport
10967
Berlin
Yogalehrerausbildung im Shakti-Yogaloft Yoga Shakti bietet Dir auf 166qm in einer lichtdurchflutete Yogaloft in Kreuzberg großartige Yogakurse aus verschiedensten Stilen an. Mit...
yogalehrer-berlin.de Yogaloft Yogakurse Yogalehrerausbildung Shakti Yogaschule Berlin Yoga Yogashop
22 Nonstop Pflegevermittlung - 24 Stunden Pflege Pflege
13086
Berlin
24 Stunden Pflege mit Betreuungskräften aus Polen, die in häuslicher Gemeinschaft mit der pflegebedürftigen Person leben. Komptente...
nonstoppflege.de ✅ Stunden Betreuung Rund Frank Uhr Hause Pflege
23 Buchvermarktung Online Marketing
14169
Berlin
Beratung für Autoren und Verlage im Bereich Online Marketing. Von Social Media Betreuung über Blogbeiträge bis hin...
buchvermarktung.de Buchvermarktung Einrichtung Blog Marketing Social Media Marketinginstrumentencrashkurs Bloggen
24 Lautsprecher Testsieger Technik Hifi
13086
Berlin
Dieser Ratgeber informiert seine Leser über die Anbieter und Modellvarianten von Lautsprechern....
testsieger-lautsprecher.de Lautsprecher Play Sony Sonos Teufel Mini Samsung Ultimate
25 Suchmaschinenoptimierung Steglitz-Zehlendorf Tempelhof Onlinemarketing
12277
Berlin
Biete für Firmen, Existenzgründer, Handwerksbetriebe Local Seo an. Damit sie besser über Google gefunden werden und auch...
lokale-suche.jimdo.com/ Z Y
26 Immobilienkredit Heute Finanzen
13086
Berlin
Dieser Ratgeber informiert seine Leser über die Anbieter und Angebote von Immobilienkrediten....
immobilienkredite-heute.de Bank Immobilienkredit Platz Sparkasse Sparda Ratgeber Landesbausparkasse Frankfurter
27 Werkbank günstig Heimwerker
10115
Berlin
Bestellen Sie online Ihre neue Werkbank...
werkbank-guenstig.com/ Wasserhahn ✔ Wordpress Amazon Httpwerkbank Guenstigcom Bestseller Preis
28 Whirlpool badewanne Sanitär
10115
Berlin
Finden Sie Sanitärbedarf einfach online...
wasserhahn24.com/ Angebot* *zum Wasserhahn Küche Armatur Whirlpool Mischbatterie Dusche
29 Rattanmöbel Gartenmöbel
10115
Berlin
Finden Sie Rattanmöbel und Gartenmöbel einfach online...
rattanmoebel-guenstiger.de/ Angebot* Rattanmöbel Rattan *zum Gartenmöbel Polyrattan Lounge Günstig
30 kreissäge kaufen Heimwerken
10115
Berlin
Finden Sie Ihre passende Kreissäge...
kreissaege-kaufen.com/ Angebot* *zum Kreissäge Sägeblatt Tischkreissäge Handkreissäge Bosch Kaufen
31 Schreibtisch höhenverstellbar Büromöbel
10115
Berlin
Finden Sie Ihren Schreibtisch höhenverstellbar...
hoehenverstellbare-schreibtische.com/ Schreibtisch Informieren* *bei Höhenverstellbar Höhenverstellbarer Höhenverstellbaren Arbeitgeber Bürostuhl
32 finazberatung Finanzen
10115
Berlin
Finden Sie eine unabhängige Finanzberatung...
global-finanzberatung.de/ Baufinanzierung ✔ Daytrading Moment Kredit Hauskauf Kürze Tipps
33 daytrading Finanzen
10115
Berlin
Daytrading strategien die wirklich funktionieren...
day-trading-pdf.de/ Daytrading Pdf Strategien Strategie Demokonto Fachwissen Geld Plus
34 baufinanzierung Finanzen
10115
Berlin
finden Sie die für Sie passende Baufinanzierung...
baufinanzierung-center.de/ Baufinanzierung Daytrading ✔ Hauskauf Moment Kredit Theme Hompage
35 garten Garten
10115
Berlin
Ankas Rosengarten...
ankas-rosengarten.de/ Meerschweinchen Tier Zähne Tiere Rosengartende Wwwankas Verhalten Tieren
36 Minidumper Gartengeräte
10115
Berlin
Kaufen Sie Ihren Minidumper oder Ihre Motorschubkarre einfach online....
motorschubkarre-kaufen.de/ Angebot* Motorschubkarre *zum Dumper Powerpac Elektroschubkarre Kaufen Miniraupendumper
37 Jura Kundendienst Service Berlin Kaffeemaschinen
10559
Berlin
Jura Kaffeevollautomaten Reparatur Service in Berlin mit 12 Monate Reparaturgarantie....
jura-kaffeeautomaten-reparatur.de Reparatur Jura Kaffeeautomaten Berlin Kundendienst Kundenservice Unser Reparaturservice
38 Artiva Sports Online Shop
10719
Berlin
Wir bieten unseren Kunden maßgeschneiderte Sportbekleidung in Bundesligaqualität an. Egal ob Firma oder Individualsportler hier finden Sie...
artiva-sports.com/ Artiva Shirts Zurück Sportartikel Sportswear Individuelle Firmen Shirt
39 UNION-KLISCHEE GmbH Spezialdruck
12107
Berlin
Union-Klischee ist ein Industrieunternehmen mit dem Fokus auf Spezialdrucke und Ätztechniken und hat dabei langjährige Erfahrung. Egal...
union-klischee.de Siebdruck Digitaldruck Isolam® Klischee Union News Tampondruck Textildruck
40 Claudia Heuser - Heilerin Mediale Beratung
13086
Berlin
Mediale Beratung – Antworten und Wege finden Meine Beratungen beziehen sich auf alle Bereiche Ihres privaten und beruflichen...
claudia-heuser.de Heuser Claudia Heilerin Haftungsausschluss Beratung Coaching | Geistiges
41 ZIMMER Fahrradtaschen und Portemonnaies Fahrrad
10243
Berlin
ZIMMER ist eine kleine Marke, die für stilvolle Fahrradtaschen und Portemonnaies steht. Unsere Fahrradtaschen sind Begleiter für...
zimmer-fahrradtaschen.de/ Portemonnaies Fahrradtaschen Damen Herren Zimmer Showroom Journal Stilvolle
42 ProImmobilia - PRIO Haus- und Grundstücksverwaltungsgesellschaft Immobilien
10707
Berlin
Die Qualität und Effizienz des ProImmobilia -Teams basiert auf dessen langjähriger Erfahrung und bildet einen soliden Grundstein...
proimmobilia-berlin.de Proimmobilia Portfolio Investition Unternehmen Ankauf Gesamtes Berlin Entwicklung
43 Schrank und Stuhl Möbelhandel
14059
Berlin
Wir bieten Ihnen Betriebseinrichtung, Laboreinrichtung, Schulausstattung, Spinde, Tresore, Stapelstühle, Artikel zur Gefahrstofflagerung und vieles mehr. In unserem...
schrank-und-stuhl.de/ Z Y
44 FAIR.EVER EVENTS GmbH Personalvermittlung
10719
Berlin
FAIR.EVER EVENTS GmbH bietet Ihnen das perfekte Personal für jede Veranstaltung, egal ob privat oder von Ihrem...
fairever-events.com Hostessen Promotion Outfits Messe Berlin Events Kongress Vip
45 berliner team GbR Unternehmensberatung
13507
Berlin
Das berliner team begleitet Menschen, die Veränderungsprozesse in Teams und Organisationen gestalten wollen und dabei auf Wir-Lösungen...
berlinerteam.de Rarr Erfahren Management Team Talent Change Work Growth
46 Kopfhörerparty Deutschland
12347
Berlin
Kopfhörerpartys werden immer beliebter. Stille Partys, bei denen trotzdem die Musik nicht fehlt? Bei denen man sich...
xn--kopfhrerparty-mmb.de/ Kopfhörer Silent Kopfhörerparty Disco Verleih Stille Party Musik
47 Halleluja Styles Schmuck
10559
Berlin
Hochwertiger Christlicher Schmuck - Ob für die eigene Hochzeit als Brautschmuck - Finde das perfekte Geschenk für...
halleluja-styles.de Z Y
48 Frohraum GmbH Möbel Einrichtung
12277
Berlin
Wenn Sie Massivholmöbel nach Maß suchen, dann ist die frohraum der richtige Ansprechpartner für Sie. Wir bieten...
frohraum.de Möbel Maß Massivholz Frohraum Lieferung Unternehmen Agb Besuch
49 Möbelfreiheit GmbH Möbel Betten
10437
Berlin
Ihr Ansprechpartner für alles Futon- egal ob Sie nach Futonbetten, Matratzen, Sofas oder Kissen suchen. Wir bieten...
edofuton.de Cm X Futonbetten ✓ Zubehör Größen Futonmatratzen Futonsofas
50 Dienstleistung der Kanzlei Steffens Rechtsanwalt
14195
Berlin
Die Kanzlei Steffens in Berlin Dahlem ist mit dem Fachanwalt für Bank- und Kapitalmarktrecht Karl-Heinz Steffens auf...
rasteffens.de Kanzlei Bank Lebensversicherungen Widerruf Steffens Abgasskandal Fonds Schiffsfonds
51 Bridgeclub Gegenspiel Neukölln Verein
12045
Berlin
Als jüngster, nettester und überhauptester Bridgeclub weit und breit wollen wir von diesem großartigen Spiel andere Menschen...
bridgeclub-gegenspiel.de Gegenspiel Bridgeclub Neukölln Bridge … Stolz Anders Präsentiert
52 Hochzeitsfotograf Berlin Hochzeitsfotograf
12524
Berlin
Als Hochzeitsfotograf in Berlin ist es schwer, sich durchzusetzen. Es gibt sehr viele Konkurrenten, die ebenfalls gut...
berlinerfotografin.de/ Berlin Hochzeitsfotograf Hochzeitsfotografin Kinderfotografie Hochzeitsfotografie Ich Meiner
53 Tischfabrik24 GmbH & Co. KG Möbel
13581
Berlin
tischfabrik24.de Massivholz München Möbel Showroom Stuhl Esstisch Esstische Aparte
54 PEPERO Fotograf Berlin Fotograf
14163
Berlin
Professionelle Fotografie für Business & Privat. Berlin...
pepero.de Fotograf Ungerahmt Zurück Katzen Familie Fotografie Hochzeit Seiteninhalt
55 Immobilienkredite Heute Finanzierung
13086
Berlin
Dieser Ratgeber informiert seine Leser über die aktuellen Immobilienkredite von Heute....
immobilienkredite-heute.de/ Bank Immobilienkredit Platz Sparkasse Ratgeber Sparda Frankfurter Landesbausparkasse
56 Arabisch Übersetzer Dolmetscher Berlin Übersetzer Dolmetscher
10589
Berlin
Übersetzung مرحبا لكافه احتياجاتكم في مجال الترجمه الشفويه والتحريريه رجاء الاتصال مسبقا شكرا...
arabiclanguagesolutions.com Arabic Translator English German Berlin Spanish Salama Ed
57 Autoaufbereitung - Auto-Glanz-Berlin Autoaufbereitung
13088
Berlin
Auto-Glanz-Berlin – Ihre professionelle Autopflege in Berlin Pankow / Weißensee. Nutzen Sie unsere langjährige Erfahrung in der...
auto-glanz-berlin.de/ Berlin Ihres Auto Fahrzeugpflege Fahrzeugaufbereitung Glanz Weißensee Pankow
58 Institut für Topvertrieb GmbH Consulting
10437
Berlin
Consulting, Software & Trainings für den effizienten Vertrieb & Verkauf Als dynamisches, innovatives Beratungs- und Softwareunternehmen für den...
institut-topvertrieb.de Vinzentia® Vinzentia Cgs Topvertrieb Produkte Ssi Check Cos
59 Metal-Art HAUSARENA Zaunhersteller
13089
Berlin
Metallzäune, Tore und Geländer aus Polen - preiswert, individuell und in Top-Qualität! Wenn Sie auf der Suche nach...
zaun-metalart.de Zaun Metal Art Grüßen Freundlichen Zaunmuster Zaunanlage Zäune
60 Scholz Umzüge Möbelspedition GmbH Lagerboxen Lagerraum
13156
Berlin
Scholz ist Ihr Umzugs- und Möbellogistik-Experte aus Berlin. Unser Team steht Ihnen von der Beratung, Umzugsplanung und...
extraraum.de/de/standorte/ Z Y
61 Venvie I Online Steuerberater Steuern Dienstleistung
10623
Berlin
Venvie.de, eine Dienstleistung der Primanus Steuerberatungsgesellschaft mbH...
venvie.de/ Venvie Buchhaltung Steuerberater Team Fragen Jahresabschluss Steuererklärung Steuer
62 veedu ist eine moderne und komfortable Softwareentwicklung
10829
Berlin
veedu sorgt für erfolgreiches und abwechslungsreiches E-Learning: Wir produzieren seit 2015 mit veedu Azubi interaktive und browserbasierte...
veedu.de Veedu Learning Azubis Gamification Videos Blog Digitalebegleiten Found
63 Heilpraktikerin Heilpraktikerin Gesundheit
10551
Berlin
Die Naturheilpraxis Christine Märtens bietet ein umfassendes individuelles Behandlungsangebot für Körper- Geist und Seele. Gefäßtherapie BEMER, Akupunktur...
chmaertens.de Christine Märtens Heilpraktikerin Medizin Chinesische Vita Angebote Entspannungstherapie
64 Seite der Kanzlei Steffens in Berlin Rechtsanwalt
14195
Berlin
Die Seite stellt das Dienstleistungsangebot der Kanzlei Steffens von Fachanwalt für Bank- und Kapitalmarktrecht Karl-Heinz Steffen saus...
rasteffens.de Bank Steffens Kapitalmarktrecht Kanzlei Widerruf Fonds Schiffsfonds Berlin
65 JOMEC GmbH Unternehmensberatung Unternehmensberatung
10711
Berlin
Die JOMEC GmbH ist eine Unternehmensberatung fokussiert auf das Gesundheitswesen im speziellen Krankenhäuser. Seit über 20 Jahren...
jomec.de Krankenhaus Jomec Akademie Fachbeiträge News Unternehmensberatung Presse Team
66 Schlüsseldienst 24 Schlüsseldienst
13127
Berlin
Ihr Schlüsselnotdienst in Berlin - Günstig & Schnell. Wir als Schlüsseldienst in Berlin lassen unsere Kunden nicht...
schluesseldienst-24.org/ Berlin Schlüsseldienst Rufen Schlüsselnotdienst Einbruchschutz Baden Sicherheitsberatungen Frankfurt
67 Rpd.Berlin Rollstuhlvermietung
12247
Berlin
Rollstuhlvermietung-und-mehr.de nur echt die mit der Ente...
rollstuhlvermietung.berlin Z Wheelchairs Y
68 Spreevital - Häusliche Krankenpflege Pflegedienst
10367
Berlin
Spree Vital ist ein häuslicher Pflegedienst mit Sitz in Berlin-Lichtenberg, der in den Bereichen Verhinderungspflege, hauswirtschaftliche Versorgung...
spreevital.de
69 Weinprofi-Blog Wein
10965
Berlin
Wollten Sie schon immer mal Ihre Freunde oder auch Geschäftspartner mit Ihrem erlesenen Weingeschmack beeindrucken – es...
weinprofiblog.wordpress.com/
70 Espressoautomaten Reparatur-Annahmestelle Marzahn Hellersdorf Kaffeemaschinen
12621
Berlin
Jura Kaffeeautomaten und Espressomaschinen Reparatur - Annahmestelle in Berlin Marzahn Hellersdorf Reparatur-Annahmestation Cafe Klatsch Kaulsdorf Mädewalder Weg 35 12621 Berlin Kaulsdorf...
reparatur-jura.de Berlin Wegbeschreibung Kundendienst Jura Standorte Formular Reparatur Hellersdorf
71 tuning-art-com GmbH Autoteile Ersatzteile
13599
Berlin
Tuning-Art bietet nur die beste Qualität, egal ob Fußmatten, Kofferraummatten, Grill Leisten oder doch Ladekantenschutzleisten, wir haben...
tuning-art.com/de/ Info@tuning + Artcom Zierleisten Montageanleitungen Ladekantenschutz Direkt Autozubehör
72 Heid Immobilienbewertung Berlin Immobilienbewertung
10117
Berlin
Heid Immobilienbewertung Berlin begutachtet Immobilien sowie Grundstücke und erstellt in diesem Zusammenhang Verkehrswertgutachten für die entsprechenden Objekte....
heid-immobilienbewertung.de/berlin/ Immobiliengutachter Immobilienbewertung Faq Berlin Agb Hamburg Sachsen Bremen
73 Heid Immobilienbewertung Berlin Immobilienbewertung
10117
Berlin
Heid Immobilienbewertung Berlin begutachtet Immobilien sowie Grundstücke und erstellt in diesem Zusammenhang Verkehrswertgutachten für die entsprechenden Objekte....
heid-immobilienbewertung.de/berlin/
74 Wirbelwind Sportbekleidung Bekleidung
10713
Berlin
Herstellung von RSG Anzügen, Eiskunstlaufkleidern, Rollkunstlaufkleidern, Voltigieranzügen, Anzüge für Sportarobatik und Kunstturnen, Turnanzüge. Maßanfertigung und individuelle Beratung. Abverkauf...
wirbel-wind.com Z Y
75 Holen Sie sich heute Ihre finanziellen Geschäft Finanzdienstleistungen
10243
Berlin
Bitte nehmen Sie dies ernst, denn es ist der wirkliche Deal. Ich habe meine bereits programmierte leere...
76 Klinische Studien IKFE Berlin GmbH Medizin Forschung
10115
Berlin
Durchführung klinischer Studien auf dem gesamten Gebiet der Inneren Medizin, speziell Diabetes mellitus Typ 1 und Typ...
ikfeberlin.de Klinische Ikfe Diabetes Studien Berlin Medikamente Forschung Krankenhaus
77 Jobbörse IT IT Branche
10715
Berlin
Jobbörse IT – IT Jobs finden Sie unter anderem in Stellenangeboten in Hamburg, Düsseldorf, Köln, Frankfurt, Stuttgart...
stellenpiraten
78 digital-mediadesign.de – Professionelle Produktfotografie in Berlin Produktfotografie Fotograf
12679
Berlin
Professionelle Produktfotografie & Objektfotografie in Berlin Vom Packshot bis zur aufwändigen High-End Produktfotografie. Ob Onlineshop, Katalog, oder Marketingkampagne...
digital-mediadesign.de Produktfotografie Berlin Produktfotos Mediadesignde Professionelle Objektfotografie Ihrem Aufwändigen
79 Pink Gellac Deutschland Kosmetik Vertrieb
10557
Berlin
Pink Gellac ist eine Marke für Gel-Nagellack aus den Niederlanden. Die Marke wird geführt von der Firma...
pinkgellac.de
80 automatikshop.de | Ihr Shop rund um Toren Türen
13055
Berlin
automatikshop.de ist ein Online-Shop, der sich auf automatische Tore, Türen und Antriebstechnik spezialisiert. In unserem Shop bieten...
automatikshop.de Gt Zubehör Handsender Türöffner Türen Drehtorantriebe Hörmann Elka
81 Kumpel GmbH - Scharbat Getränke
10117
Berlin - Mitte
Die Kumpel GmbH präsentiert sich auf dem Getränkemarkt mit einem neuen, speziellen Erfrischungsgetränk, welches auf Basis einer...
scharbat.de Blog Gibt´s Kaufen Shop Getränk Scharbat Entdecke Energiekj
82 Dienstleistung der Kanzlei Steffens Rechtsanwalt
14195
Berlin
Der Rechtsanwalt Karl-Heinz Steffens ist auch Fachanwalt für Bank- uind Kapitalmarktrecht und hat umfassende Erfahrung in Bank-...
rasteffens.de Bank Steffens Kanzlei Kapitalmarktrecht Fonds Schiffsfonds Berlin Kapitalanlagerecht
83 Yvonne Benschneider unabhänige Beraterin von Dr. Kosmetikprodukte
14089
Berlin
Effektkosmetik mit Sofortwirkung und einer tiefergehenden, nachhaltigen Langzeitwirkung. Beratung und Networkmarketing, Beauty-Effekt-Parties in Berlin...
nochschoenerwerden.de
84 Jura Kaffeeautomaten Berlin Kaffeemaschinen
10407
Berlin
Jura Reparatur - Annahmestelle in Berlin Prenzlauer Berg Kahrmann`s Own Bötzowstraße 21 - 10407 Berlin - Prenzlauer Berg Öffnungszeiten:...
reparatur-jura-berlin.de
85 WOLTER | Fachanwalt für Arbeitsrecht Rechtsanwälte
10629
Berlin
Meine Berliner Fachanwaltskanzlei befasst sich ausschließlich mit Arbeitsrecht. Ich bin Fachanwalt für Arbeitsrecht und vertrete bundesweit sowohl...
kanzleiwolter.de/ Fachanwalt Arbeitsrecht Wolter | Prüfung Durchsetzung Erstellung Arbeitsverhältnis
86 Ärztlicher Notdienst Medlanes Allgemeinärztlicher Notdienst
10969
Berlin
Unser ärztlicher Bereitschaftsdienst bietet Ihnen fachärztliche Hilfe direkt zu Hause, an Ihrem Arbeitsplatz oder im Hotel. Wir...
medlanes.com/medlanes-allgemeinaerztlicher-notdienst-in-berlin/ Berlin Notdienst Medlanes Augenärztlicher Orthopädischer Allgemeinärztlicher Privatärztlicher Kinderärztlicher
87 Medlanes GmbH - Ärztlicher Bereitschaftsdienst Ärztlicher Bereitschaftsdienst
10969
Berlin
Medlanes bietet ärztliche Bereitschafts - und Notdienste in den meisten Großstädten Deutschlands. Der privatärztliche Notdienst wird von...
medlanes.com/medlanes-bereitschaftsdienst-in-berlin/ Berlin Notdienst Medlanes Admin Bereitschaftsdienst Da Agb En
88 Medlanes GmbH - Ärztlicher Notdienst Ärztlicher Notdienst
10969
Berlin
Medlanes bietet ärztlichen Notdienst von Bereitschaftsärzten und Kinderärzten (Kindernotdienst). Der privatärztliche Notdienst wird ebenfalls von Selbstzahlern übernommen....
medlanes.com/medlanes-kinderaerztlicher-notdienst-in-berlin/ Berlin Notdienst Medlanes Orthopädischer Bereitschaftsdienst Gynäkologischer notdienst Da Jobs
89 Global Investment - Schließfachvermietung in Berlin Investment
10711
Berlin
Bankschließfach mieten sicher & mit Versicherung Die Zeiten sind nicht mehr so sicher, wie vor vielen Jahren noch....
safes-berlin.de/ Global Investment Sicherheit Schutz Preisliste Berlin Aufbewahrung Geld
90 Ärztlicher Bereitschaftsdienst Medlanes Ärztlicher Bereitschaftsdienst
10969
Berlin
Medlanes bietet ärztliche Bereitschafts - und Notdienste in den meisten Großstädten Deutschlands. Der privatärztliche Notdienst wird von...
medlanes.com/medlanes-privataerztlicher-notdienst-in-berlin/ Berlin Notdienst Medlanes Kinderärztlicher Allgemeinärztlicher Orthopädischer Da Jobs
91 Brauchen Sie eine finanzielle Hilfe Geld Finanziell
12309
Berlin
Brauchen Sie eine finanzielle Hilfe? Bist du in irgendeiner Finanzkrise oder brauchst du Geld, um dein eigenes...
92 Kugelschreiber-Unikate Kunst
10117
Berlin
Kugelschreiber-Unikate aus schwarzem Ebenholz, manche mit Kristallen oder Gold. Jedes hat sein eigenes Design. Auswechselbare, in Schreibwarenhandlungen...
waltino.com Waltino Waltinos Sculptures Design Newsletters Each Mobile Walter
93 thewebmax Webdesign
10587
Berlin
thewebmax | Web Design & Web Development & SEO - Berlin...
thewebmax.de Design Berlin Development Web Contact Streubel Charlottenburger Ufer
94 Ärztlicher Notdienst Medlanes Ärztlicher Notdienst
10969
Berlin
Unser ärztlicher Bereitschaftsdienst bietet Ihnen fachärztliche Hilfe direkt zu Hause, an Ihrem Arbeitsplatz oder im Hotel. Wir...
medlanes.com/medlanes-aerztlicher-notdienst-in-berlin/ Berlin Notdienst Medlanes Admin Gynäkologischer ärztlicher Dermatologischer Agb
95 Berliner Umzüge e.K. Umzug
13353
Berlin
Als Berliner Umzüge haben wir uns als Ziel gesetzt, für die Zufriedenheit all unserer Kunden zu sorgen. Schon...
berlinerumzuege.de Umzug Berlin Umzüge Berliner Fotos Umzugsfirma Liste Google
96 DJ Sash Brandenburg DJ
12355
Berlin
DJ für die Region Brandenburg...
dj-sash-brandenburg.de Dj Brandenburg Hochzeits Event Sash Erhalten Scrollen Webseite
97 BERLINMEDIAGROUP Berlin Medienunternehmen
10117
Berlin
BERLINMEDIAGROUP - Ihr Partner für Konzeption, Großformatdruck, Druck, Werbetechnik, Displays und Realisierung. Als Werbeagentur mit über zehn...
berlinmediagroup.de/standorte/berlin.html
98 BERLINMEDIAGROUP Berlin Medienunternehmen
10117
Berlin
BERLINMEDIAGROUP - Ihr Partner für Konzeption, Großformatdruck, Druck, Werbetechnik, Displays und Realisierung. Als Werbeagentur mit über zehn...
berlinmediagroup.de/standorte/berlin.html
99 BERLINMEDIAGROUP Berlin Medienunternehmen
10117
Berlin
BERLINMEDIAGROUP - Ihr Partner für Konzeption, Großformatdruck, Druck, Werbetechnik, Displays und Realisierung. Als Werbeagentur mit über zehn...
berlinmediagroup.de/
100 BERLINMEDIAGROUP Berlin Medienunternehmen
10117
Berlin
BERLINMEDIAGROUP - Ihr Partner für Konzeption, Großformatdruck, Druck, Werbetechnik, Displays und Realisierung. Als Werbeagentur mit über zehn...
berlinmediagroup.de/
101 BERLINMEDIAGROUP Berlin Medienunternehmen
10117
Berlin
BERLINMEDIAGROUP - Ihr Partner für Konzeption, Großformatdruck, Druck, Werbetechnik, Displays und Realisierung. Als Werbeagentur mit über zehn...
berlinmediagroup.de/
102 Mineralwasser Testsieger Onlineshop
13086
Berlin
Dieser Ratgeber informiert seine Leser über die besten Abfüller und Quellen von Mineralwasser....
mineralwasser-testsieger.de/ Mineralwasser Test Ratgeber Apollinaris Merkur Gerolsteiner Tönissteiner Liebenwerda
103 Tritt - Case in Toskana Tourismus Reisen
10997
Berlin
Tritt – Case in Toscana vermittelt eine große Variation an Unterkünften; ob Ferienhaus, Pension oder doch ein...
tritt-toskana.de/ Toskana Toskanade Ferienwohnungen Agriturismo Toskana@tritt Strandurlaub Urlaub Unterkunft
104 USB - Umzugsservice-Berlin - Halteverbot Berlin Umzug
10555
Berlin
Den Umzug bzw. die Baustelle rechtzeitig planen! Wenn Sie umziehen, sollten Sie im Vorfeld das Szenarium gedanklich...
umzugsservice-berlin.com Halteverbot Offnen Umzug Berlin Umzugsservice Hamburg Agb Halteverbotszone
105 Jura Reparaturen Berlin Marzahn Hellersdorf Kaffeeautomaten
12621
Berlin
Reparatur - Annahmestelle in Berlin Marzahn - Hellersdorf Cafe Klatsch Kaulsdorf Mädewalder Weg 35 12621 Berlin Kaulsdorf Di - So: ...
kaffeemaschinen-reparatur-berlin.info
106 Jura Reparaturen Berlin Marzahn Hellersdorf Kaffeeautomaten
12621
Berlin
Reparatur - Annahmestelle in Berlin Marzahn - Hellersdorf Cafe Klatsch Kaulsdorf Mädewalder Weg 35 12621 Berlin Kaulsdorf Di - So: ...
kaffeemaschinen-reparatur-berlin.info
107 Möblierte Apartments & Wohnungen Immobilien
12621
Berlin
Möblierte Apartments & Wohnungen direkt vom Eigentümer...
das-apartment-berlin.de Erfahren Mail Rückrufservice Apartments Moderne Liebevoll Prenzlauerschließen Vorgehensweise
108 Nassrasierer Testsieger Drogerie
13086
Berlin
Auf diesem Ratgeber können sich alle Verbraucher über die Vorteile und Nachteile von Nassrasierern informieren. Erleichtert wird...
nassrasierer-testsieger.de/ Gillette Nassrasierer Wilkinson Sword Platz Rasierer Hydro Fusion
109 Asahi Bonsai -Kruttasch GbR Garten Online-Shop
10623
Berlin
Asahi Bonsai ist ein Bonsai Spezialist und Online-Shop mit Hauptsitz in Berlin. Asahi Bonsai bietet eine enorme...
asahi-bonsai.de/ Bonsai Versandkosten Kaufen Cm Pflegetipp Wacholder Mädchenkiefer
110 Unfallversicherung Test Versicherung
13086
Berlin
Wir stellen euch die Anbieter und Policen von Unfallversicherungen vor. Durch die Veröffentlichung von Testergebnissen werden Vorteile...
unfallversicherungen-tests.de/ Unfallversicherung Besten Testhellip Laut Unfallversicherungen Ratgeber Bu Testet
111 La Casa del Habano Berlin Tabak Onlineshop
10623
Berlin
„La Casa del Habano“ ist mit „Herzog am Ludwigsplatz“ und „Herzogs am Hafen“ ein von Zigarren Herzogs...
zigarren-herzog.com/de/ Zigarren Robusto Herzog Hafen Versandkosten Punch Upmann Kiste
112 Zigarren Herzog am Ludwigsplatz Tabak Onlineshop
10719
Berlin
„Herzog am Ludwigsplatz“ ist neben „Herzog am Hafen“ und „La Casa del Habano“ ein von den Zigarren...
zigarren-herzog.com/de/ Zigarren Robusto Herzog Hafen Montecristo Punch Upmann Kiste
113 Herzogs Zigarrenlager am Hafen GmbH & Tabak Onlineshop
10245
Berlin
Bis heute bleibt Zigarren Herzog das einzige Zigarrenhaus Deutschlands, das von einem echten Hombre Habanos geleitet wird....
zigarren-herzog.com/en/ Cigars Robusto Montecristo Box Shipping Punch Upmann Herzog
114 Hauptstadt CrossFit in Mitte Sport Fitness
10115
Berlin-Mitte
Hauptstadt Crossfit bietet zwei zentrale Crossfitboxen, eines davon liegt direkt in Berlin Mitte. Unterrichtet von Sportexperten und...
info@hauptstadt-crossfit.de Crossfit Berlin Hauptstadt Box Probetraining Training Kostenloses Mitglied
115 Hauptstadt CrossFit in Charlottenburg-Wilmersdorf Sport Fitness
10715
Berlin
In Berlin bietet Hauptstadt Crossfit zwei Crossfitboxen, verfügbar in Charlottenburg-Wilmersdorf und direkt in Berlin Mitte, zentraler gehts...
hauptstadt-crossfit.de/ Crossfit Berlin Hauptstadt Box Probetraining Training Werde Mitglied
116 Planika Kamine Wohnen &
13583
Berlin
Die auf Planika Kamine präsentierten Outdoor Ethanol Kamine sind Produkte von höchster Qualität. Dadurch wird die sichere...
planikakamine.de/ Z Y
117 Jazzband Jazz Royal Jazzband Für
10405
Berlin
Jazzband Berlin: „Jazz Royal – Das königliche Jazzerlebnis“ untermalt Events wie Gala Dinner, Stehempfang und Hochzeit musikalisch....
jazzroyal.de/ Z Y
118 Berlinstadtservice Tourismus
13597
Berlin
Berlinstadtservice ist das Hauptstadtportal Berlin und spiegelt die gesamte Bandbreite des Berliner Stadtlebens wieder. Unsere Informationen richten...
berlinstadtservice.de/ [] Berlin Hauptstadtportal Berliner Berlinstadtservice Nahverkehr Hotels Umweltzone
119 Brautkleider Brautmode
10789
Berlin
Wir haben für Sie eine schöne Auswahl an Brautkleidern zusammengestellt. Jedes unserer Brautkleider zeichnet sich durch ein...
matsouri.de Designer Couture Lookbook Abendkleider Brautkleider Spitzenkleid Quotvickyquot Abendkleid
120 Brautkleider Brautmode
10789
Berlin
Wir haben für Sie eine schöne Auswahl an Brautkleidern zusammengestellt. Jedes unserer Brautkleider zeichnet sich durch ein...
matsouri.de
121 Brautkleider Brautmode
10789
Berlin
Wir haben für Sie eine schöne Auswahl an Brautkleidern zusammengestellt. Jedes unserer Brautkleider zeichnet sich durch ein...
matsouri.de
122 kellerfrei.com Anzeigenportal Für
12623
Berlin
kellerfrei – das kostenlose Portal für Lagerflächen aller Art: Keller, Stellplatz, Garage, Stauraum, Lager, Self Storage kellerfrei ist...
kellerfrei.com/
123 Fensterreparatur Berlin Fensterreparatur

Berlin
Riss oder Steinschlag im Fenster? Sind die Dichtungen porös? Oder schließen ihre Fenster nicht mehr richtig? Die Fensterreparatur Berlin bemüht...
fensterreparatur-berlin.de/ Berlin Fensterreparatur Fenster ✅ Türen Anruf Wartung Inhalt
124 Dringend Geld brauchen? Wir können dir Darlehen Kredit
10115
Berlin
Dringend Geld brauchen? Wir können dir helfen! Bist du durch die aktuelle Situation in Schwierigkeiten oder drohst dir...
125 HELIKUM-SECURITY Sicherheitsdienst
13469
Berlin
helikum-security.de/ Berlin überspringen Navigation Security Securityde Helikum Uns Brandenburg
126 Praxis für Arbeitspsychologische Beratung Psychologische Beratung
10825
Berlin
Ich betrachte nicht nur einzelne Befindungssymptome, sondern sehe immer den ganzen Menschen. Gern begleite ich Sie auf...
praxis-marcusneuzerling.de
127 Praxis für Arbeitspsychologische Beratung Psychologische Beratung
10825
Berlin
Ich betrachte nicht nur einzelne Befindungssymptome, sondern sehe immer den ganzen Menschen. Gern begleite ich Sie auf...
praxis-marcusneuzerling.de
128 Praxis für Arbeitspsychologische Beratung Psychologische Beratung
10825
Berlin
Ich betrachte nicht nur einzelne Befindungssymptome, sondern sehe immer den ganzen Menschen. Gern begleite ich Sie auf...
praxis-marcusneuzerling.de
129 Rechtsanwalt Michael Rudnicki Rechtsanwälte
10623
Berlin
rudnicki-berlin.de/ Verkehrsrecht Berlin Strafrecht Charlottenburg Fachanwalt Straf Rudnicki Jahren
130 Avonprodukte Kosmetik Schmuck
10365
Berlin
Ich bin Avonberaterin in Berlin. NEU! Ihr könnt jetzt online bei mir bestellen, mich aber natürlich auch persönlich...
avon.de/store/silke
131 Personal Trainer Berlin RoRoCoach Robert Rode Personal Trainer
12459
Berlin
Mein Name ist Robert Rode und ich biete schon seit über 20 Jahren Personal Training in Berlin...
rorocoach.de/ ✓ Mental Coach Robert Rode Personal Trainer Artikel
132 Personal Trainer Berli RoRoCoach Robert Rode Personal Trainer
12459
Berlin
Mein Name ist Robert Rode und ich biete schon seit über 20 Jahren Personal Training in Berlin...
rorocoach.de/ ✓ Coach Mental Personal Rode Trainer Artikel Robert
133 Containerdienst und Abfallentsorgung für Berlin Containerdienst
13509
Berlin
Berlin ist eine Weltstadt und als solche im stetigen Wandel. Laufend werden Gebäude abgerissen und neu gebaut...
dino-container.de/
134 Containerdienst und Abfallentsorgung für Berlin Containerdienst
13509
Berlin
Berlin ist eine Weltstadt und als solche im stetigen Wandel. Laufend werden Gebäude abgerissen und neu gebaut...
dino-container.de/
135 Containerdienst und Abfallentsorgung für Berlin Containerdienst
13509
Berlin
Berlin ist eine Weltstadt und als solche im stetigen Wandel. Laufend werden Gebäude abgerissen und neu gebaut...
dino-container.de/
136 Allianz pro Schiene e.V. Bahnverkehr
10117
Berlin
Die Allianz pro Schiene e.V. ist ein Verkehrsbündnis zur Unterstützung des gefahrlosen und ökologischen Bahnverkehrs in der...
allianz-pro-schiene.de/ Allianz Pro Schiene Fakten Daten @schienenallianz Bahnhof Eisenbahner
137 Parkhotel St. Leonhard Hotel und
88662
Überlingen
Ankommen und Wohlfühlen, den Alltag vergessen. Genießen Sie das Ambiente eines erstrangigen Hotels, umgeben von einem 70 ha...
parkhotel-st-leonhard.de
138 Parkhotel St. Leonhard Hotel und
88662
Überlingen
Ankommen und Wohlfühlen, den Alltag vergessen. Genießen Sie das Ambiente eines erstrangigen Hotels, umgeben von einem 70 ha...
parkhotel-st-leonhard.de
139 Turan Messebau Messebau
12099
Berlin
Turan Messebau bietet hochwertiges Handwerk aus einer Hand: maßgeschneiderte Messestände und individuelle Ausstellungsbauten, Innenarchitektur für Läden, Büros...
turan-berlin.de Messebau Handwerk Turan Berlin Werkstätten Architektur Konzepte
140 Turan Messebau Messebau
12099
Berlin
Turan Messebau bietet hochwertiges Handwerk aus einer Hand: maßgeschneiderte Messestände und individuelle Ausstellungsbauten, Innenarchitektur für Läden, Büros...
turan-berlin.de
141 Turan Messebau Messebau
12099
Berlin
Turan Messebau bietet hochwertiges Handwerk aus einer Hand: maßgeschneiderte Messestände und individuelle Ausstellungsbauten, Innenarchitektur für Läden, Büros...
turan-berlin.de/
142 Turan Messebau Messebau
12099
Berlin
Turan Messebau bietet hochwertiges Handwerk aus einer Hand: maßgeschneiderte Messestände und individuelle Ausstellungsbauten, Innenarchitektur für Läden, Büros...
turan-berlin.de/
143 Schloss-Expert Schlüsseldienst Berlin Schloss-Expert Schlüsseldienst Berlin Schlüsseldienst
10785
Berlin
Schloss-Expert Schlüsseldienst Berlin Schlüsselnotdienst 24 Stunden Locksmith ist ein DIREKT-Schlüsseldienst. Türöffnung, Autoöffnung, Tresor öffnen, Türschloss und Schließzylinder wechseln...
schloss-expert.de Berlin Schlüsseldienst Türöffnung öffnen Tresor Schlüsselnotdienst Schluesselnotdienst Locksmith
144 Baustier Bauunternehmen
10623
Berlin
Wir bieten vom Rohbau bis zur Schlüsselfertigen Übergabe alle Baudienstleistung an. Bei Groß- und Kleinaufträgen, sei es...
baustier.de Fliesen Maler Reinigung Tapeten Innenglattputz Graffiti Bieten Webpräsenz
145 Entrümpelung Berlin 24recyclingdienst Entrümpelung
12051
Berlin
Entrümpelung Berlin 80 Euro pauschal Entrümpelungen sofort Keller Wohnung Möber Sperrmüll entrümpeln kurzfristig....
berlin24recyclingdienst.de Entrümpelung Berlin Sperrmüll Möbel Wohnung Keller Preis Sofort
146 pc-reparatur-berlin Pc-reparatur-berlin
10715
Berlin
pc-reparatur-berlin: -Testsieger in ganz Deutschland. -Kostenlose Abholung innerhalb Berlins -Service ab 19, 90€ -Bis zu 10% Rabatt -Ab 5€ Wartungsvertrag -24/7 Notdienst -Über 12...
pc-reparatur-berlin.com Reparatur Berlin Pc Support Einrichten Wartungsvertrag Netzwerk Computerviren
147 notebook-reparatur Notebook-reparatur
13585
Berlin
notebook-reparatur: -Testsieger in ganz Deutschland. -Kostenlose Abholung innerhalb Berlins -Service ab 19, 90€ -Bis zu 10% Rabatt -Ab 5€ Wartungsvertrag -24/7 Notdienst -Über 12...
notebook-reparatur.help Reparatur Berlin Notebook Support Dienstleistungen Wartungsvertrag Reparieren Netzwerk
148 computerviren-entfernen Computerviren-entfernen
10715
Berlin
computerviren-entfernen: -Testsieger in ganz Deutschland. -Kostenlose Abholung innerhalb Berlins -Service ab 19, 90€ -Bis zu 10% Rabatt -Ab 5€ Wartungsvertrag -24/7 Notdienst -Über 12...
computerviren-entfernen.de Reparatur Computerviren Berlin Entfernen Reparieren Center Dienstleistungen Ab
149 datenrettung-berlin Computer-Dattenrettung
10715
Berlin
datenrettung-berlin: -Testsieger in ganz Deutschland. -Kostenlose Abholung innerhalb Berlins -Service ab 19, 90€ -Bis zu 10% Rabatt -Ab 5€ Wartungsvertrag -24/7 Notdienst -Über 12...
datenrettung-berlin.co Reparatur Reparieren Berlin Datenrettung € Center Festplatte Karte
150 Rechtsanwalt Uwe Heichel Rechtsanwälte
10719
Berlin
rechtsanwalt-heichel.de Berlin Wohnungseigentumsrecht Wilmersdorf Heichel Rechtsanwalt Mietrecht Tempelhof Schöneberg
151 Protec Bau & Management - Sanitär Sanitär
13587
Berlin
Protec Bau & Management Ihr Handwerker und Bauplanungsbüro in Berlin, für Sanitär, Heizung, Bäderbau, TGA-Planung und Wohnungssanierung....
sanitaer-berlin.com Planung Tga Bäder Sanitär Heizung Bauleitung Management Protec
152 wlan-einrichten-berlin Internet
10715
Berlin
wlan-einrichten-berlin: -Testsieger in ganz Deutschland. -Kostenlose Abholung innerhalb Berlins -Service ab 19, 90€ -Bis zu 10% Rabatt -Ab 5€ Wartungsvertrag -24/7 Notdienst -Über 12...
wlan-einrichten-berlin.de/ Wlan Einrichten Berlin Laptop Notdienst Repariert Techniker Ihrem
153 Ladenbau Berlin Innenarchitektur Berlin Innenausbau Berlin AAB Raumkultur
13585
Berlin
Innenarchitektur vom Profi für Berlin und Brandenburg. Privat und gewerblich, Büro und Ladenlokal, barrierefreies und altengerechtes Wohnen....
aab-die-raumkultur.de Berlin Innenarchitektur Wohnen Ladenbau Leistungen Navigation Projektablauf Beratung
154 reichow-art online Galerie Kunstgalerie
12163
Berlin
Wir vertreten zeitgenössische Kunst junger internationaler Künstler. Die Werke entsprechen höchsten Ansprüchen und ausgesuchter Qualität. Der künstlerische...
reichow-art.de Alisa Basel Raimann Berlin Austellungen Galerie Künstler Art
155 Die Gottesanbeterin Tiere
10178
Berlin
Hier findest Du alle Informationen rund um Mantiden und ihr Verhalten. Auf Allgemeines, den Körperbau, die Lebensweise...
gottesanbeterin.org
156 Tischtennisplatte Test & Vergleich Sport
10178
Berlin
Jeder kennt es: Es ist endlich Sommer und man will nur raus an die frische Luft. Doch...
tischtennisplatte-test.org Tischtennisplatte Platte Outdoor Test Indoor Prüfen* Platten Netz
157 Immobilien in Berlin und Brandenburg Immobilienmakler
10117
Berlin
Wir von Immobilien in Berlin und Brandenburg bieten Ihnen als Immobilienmakler die Möglichkeit, Immobilien zu kaufen und...
ibb-immo.de Immobilien Berlin Brandenburg Datenschutzerklärung Immobilie Dringend Eigentümer Maik
158 NCP New Carparts liefert Zubehör zum Fachhandel Regale
10713
Berlin
Regale Reifenwagen Reifenkarre Reifenkarren, Regale und Transportwagen: für effiziente Abläufe beim Reifentransport und der Reifenlagerung Allein die Anzahl an...
reifenzubehoer-online.de/ Zubehör Einlagerung New Carparts Ncp Ihr Lagerung Montage
159 Möbeltaxi bietet günstige Transporte Miniumzüge Umzüge Transportunternehmen
13507
Berlin
Möbeltaxi Berlin - Das Original ist seit über 14 Jahren Ihr kompetenter und zuverlässiger Ansprechpartner für Kleintransporte...
moebeltaxi-berlin.de
160 Zahnmedizinisches Fachzentrum am Savignyplatz Dr. Czerwinski Zahnarzt
10623
Berlin
Wir stellen eine fachübergreifende und umfassende Beratung in den Mittelpunkt. Unser Ziel ist die bestmögliche Versorgung unserer...
zahnmedizinisches-fachzentrum-berlin.de/ Zmfs Zahnarzt Savignyplatz Charlottenburg Berlin Fachzentrum Patienten Behandlung
161 Arntberg Verpackungen Werbeartikel
13355
Berlin
Vertrauen Sie auf Arntberg als Ihren starken Partner für Werbemittel. Bedruckte Tragetaschen, Apotheker-Verpackungen, Zuckersticks uvm. finden Sie...
arntberg.de/ Zuckersticks Tragetaschen Erfrischungstücher Servietten Fruchtgummitüten Apotheken Verpackungen Tassendeckchen
162 Kuyo Verpackungen Verpackungen Werbeartikel
13597
Berlin
Egal, ob individuell bedruckte Zuckersticks, Erfrischungstücher, Servietten oder ToGo-Verpackungen: Kuyo besticht durch Qualität, und dies unter Berücksichtigung...
kuyo.de/ Verpackungen Zuckersticks Erfrischungstücher Tassendeckchen Servietten Kuyo Lohnabfüllung Togo
163 ESF Bestattungen und Trauerhilfe GmbH Bestattungen
10249
Berlin
Die ESF Bestattungen und Trauerhilfe GmbH und LK Bestattungs- und Friedhofsdienste GmbH aus Berlin verfügt über langjährige...
esf-bestattungen.de/ Daten Google Website Berlin Bestattungen Analytics Trauerhilfe Formalitäten
164 Anwalt Baurecht Berlin Advoprimum Rechtsanwalt
10719
Berlin
ADVOPRIMUM ist eine auf das Bau- und Immobilienrecht spezialisierte Rechtsanwaltskanzlei. Wir verfügen über hoch qualifizierte Experten und...
baurecht-anwalt24.de Baurecht Berlin Anwalt Bau Fachanwalt Immobilienrecht Architektenrecht Kanzlei
165 Jura Reparaturservice Berlin Kaffeeautomaten
10559
Berlin
Jura Kaffeemaschinen Reparatur Service und Kundendienst in Berlin Alt-Moabit 120 10559 Berlin Mo-Fr.8:00 - 18:00 Uhr...
kundendienst-jura-berlin.de
166 KitchenAid Reparatur Berlin Reparatur
12526
Berlin
DeLonghi Kaffeemaschinen Reparatur-Annahmestelle in Berlin Köpenick-Bohnsdorf Buntzelstr. 91 12526 Berlin - Köpenick Bohnsdorf Öffnungszeiten: Mo - Sa: 07:00...
reparatur-espressomaschine.de Reparatur Jura Delonghi Kitchenaid Gaggia Berlin Lapavoni
167 REDMARKETING - IHRE ONLINE MARKETING AGENTUR
10789
Berlin
Als Ihre Online Marketing Agentur in Berlin bieten wir Ihnen den richtigen Marketing-Mix aus kreativem Webdesign, ergebnisorientierter...
redmarketing.de/ Marketing Berlin Seo Agentur Webdesign Website Google Redmarketing
168 Bettertrust GmbH - Ihre führende PR PR Argentur
10117
Berlin
Als inhabergeführte internationale PR-Agentur mit Sitz in Berlin und Dependancen in München und Zürich, gehören wir zu...
bettertrust.de/ Informationen Pr Leistungen Agentur München Berlin Kommunikation Ceo
169 Popart STUDIO | Webdesign und Website Webdesign Website
10711
Berlin
EINE PROFESSIONELLE WEBDESIGN-AGENTUR FÜR DIE ERSTELLUNG VON WEBSITES UND ONLINE-SHOPS Unsere Dienstleistungen: → Web-Design: Die Dienstleistung des professionellen Web-Designs, umfasst...
popwebdesign.de/
170 Popart STUDIO | Webdesign und Website Webdesign Website
10711
Berlin
EINE PROFESSIONELLE WEBDESIGN-AGENTUR FÜR DIE ERSTELLUNG VON WEBSITES UND ONLINE-SHOPS Unsere Dienstleistungen: → Web-Design: Die Dienstleistung des professionellen Web-Designs, umfasst...
popwebdesign.de/
171 Spezielle Kosmetikbehandlungen wie Hydradermabrasion in Berlin Kosmetikstudio
13507
Berlin
Die ausgebildete Kosmetikerin, Heilpraktikerin und Krankenschwester Anja Zahn erarbeitet ein ganzheitliches Konzept, das über eine normale Kosmetikbehandlung...
kosmetikstudio-reinickendorf.de Haut Reinickendorf Kosmetikstudio Berlin Microdermabrasion Mitesser Behandlung Peeling
172 Möbeltaxi Berlin Transportunternehmen
13507
Berlin
Wir sind seit über 14 Jahren Ihr kompetenter und zuverlässiger Ansprechpartner für Kleintransporte aller Art egal ob...
moebeltaxi-berlin.de Mbeltaxi Transport Berlin Ikea Schrieb Bewertung Umzug Meinungen
173 Berolina Haushaltsgerätedienst Reparatur Haushaltsgeräte
10707
Berlin
berliner-waschmaschinenreparatur.de/ Berolina Reparatur Berlin Haushaltsgerätedienst Waschmaschinen Waschmaschine Uns Menü
174 Jura Espressomaschinen Kundendienst Berlin Kaffeemaschinen
10407
Berlin
Reparatur-Annahmestelle in Berlin Prenzlauer Berg Öffnungszeiten: Mo - Fr: 10:00 - 18:00 Uhr Sa - So: 11:00 -...
kaffeeautomaten-reparatur-berlin.de Reparatur Berlin Jura Delonghi Kundendienst Kaffeemaschine Kaffeeautomaten Saeco
175 DeLonghi Reparaturservice Berlin Reparatur
12209
Berlin
Kaffeemaschinen Reparatur Service und Kundendienst in Berlin Reparatur-Annahmestelle Oberhofer Weg 4 12209 Berlin - Lichterfelde Tel: 030 - 588 480 07 Öffnungszeiten: Mo...
kaffeeautomaten-service-berlin.de
176 RA Rainer Sebel Rechtsanwälte
10243
Berlin
Der erfahrene Volljurist Rechtsanwalt Rainer Sebel vertritt Privatpersonen wie auch Unternehmen insbesondere in den Rechtsgebieten Familienrecht, Arbeitsrecht...
kanzlei-sebel.de Arbeitsrecht Strafrecht Menü Rainer Sebel Friedrichshain Kanzlei Berlin
177 Hacke & Spitze | Das Fachgeschäft Tanzschuhe und
10961
Berlin
Hacke und Spitze ist ein großes Fachgeschäft für Tanzschuhe und Tanzbekleidung in Berlin-Kreuzberg. Das breitgefächerte Angebot...
hackeundspitze.de
178 Hacke & Spitze | Das Fachgeschäft Tanzschuhe und
10961
Berlin
Hacke und Spitze ist ein großes Fachgeschäft für Tanzschuhe und Tanzbekleidung in Berlin-Kreuzberg. Das breitgefächerte Angebot...
hackeundspitze.de
179 FiGD Fachinstitut für Informatik und Grafikdesign Weiterbildung
10407
Berlin
Wir sind ein bundesweit zertifizierter Bildungspartner für Fortbildungen und Intensiv-Qualifizierungen im Herzen Berlins – im Prenzlauer Berg....
figd.de Grafikdesign | Bildung Figd Fachinstitut Geförderte Buchhaltung Informatik
180 Domicile Innenausbau Tischlerei
12555
Berlin
Herstellung hochwertiger Möbel und Innenausbau aus Holzwerkstoffen in eigener Werkstatt. Vom Einzelmöbel bis zu komplexen Projekten, wie Wohnungsausbau...
domicile-online.de Z Y
181 Ernährungsberatung Gesundheit
10829
Berlin
Unabhängige Informationen über Medizin und ganzheitliche Gesundheit. Tipps und Rezepte für eine gesunde Ernährung. Ernährungsberatung. Empfehlung von...
das-gesundheitsplus.de Gesundheitsplus Gesundheit – See Moresee Less Ago Rezepte
182 Tischlerei Tischler
12555
Berlin
domicile-online.de Z Y
183 MS BAUAUSFÜHRUNG MALERMEISTERBETRIEB Maler
12621
Berlin
Wenn Sie auf der Suche nach einer Malerfirma aus Berlin sind, die qualitativ hochwertige Arbeiten anbietet, dann...
ms-bauausfuehrung.de
184 MS BAUAUSFÜHRUNG MALERMEISTERBETRIEB Maler
12621
Berlin
Wenn Sie auf der Suche nach einer Malerfirma aus Berlin sind, die qualitativ hochwertige Arbeiten anbietet, dann...
ms-bauausfuehrung.de
185 Bootsbörse Netboat Boote
12203
Berlin
Nationale und internationale Bootsbörse im Internet seit 1997. Besonders zu empfehlen für den Verkauf von Gebrauchtbooten. Hier...
netboat.com Fr Gebrauchtboote Boote Netboat Bootsbrse Bootsanzeigen Bersetzungsprogramm Seit
186 Rechtsanwalt Steffen Radlbeck Rechtsanwalt
12167
Berlin
Die Kanzlei ist auf dem Gebiet des Zivilrechts tätig. Schwerpunkte liegen auf dem Immobilienrecht, dem Miet- &...
anwalt-radlbeck.de Daten Google Radlbeck Website Steffen Berlin Fotoliacom Analytics
187 Dormis Ferienwohnungen Ferienhäuser
10783
Berlin
Wir sind eine dynamische Firma, die das Zusammenwirken zwischen dem Gast und dem Gastgeber erleichtern will, um...
dormis.com/ Nginx Services Booking Other Apartments Owners Policy How
188 Kaffeevollautomaten Reparatur Service Berlin Kaffeemaschinen Kaffeeautomaten
10559
Berlin
Jura DeLonghi Saeco Gaggia KitchenAid Reparatur Service Berlin Impressum Angaben gemäß § 5 TMG: KAFFEE BÄRLIN Haci Ahmet Bayram Alt-Moabit 120 10559 Berlin Kontakt: Telefon:...
kaffee-baerlin.de
189 Mietfair GmbH Mietrechtsberatung
10625
Berlin
Wir setzen uns für Deine Rechte ein Eine Wohnung in Berlin zu finden, die bezahlbar und attraktiv ist...
mietfair.de
190 13. TEXTILE ART BERLIN Textil
13355
Berlin
die TEXTILE ART BERLIN ist die größte Textilkunstmesse in Berlin: 110 Verkaufsstände, 32 Ausstellungen, 25 Workshops und...
textile-art-berlin.de Berlin Textile Workshops Modenschauen Ausstellungen Textilkunst Messe  »
191 Berolina Plastic Handels UG Verpackungsfolien
10627
Berlin
Der Konfigurator von BEROLINA plastic bietet Ihnen die Möglichkeit mit wenigen Klicks Ihre individuelle Folienverpackung zu gestalten....
verpackungsfolien-nach-mass24.de/ Berolina Folien Verpackungsfolien Folienkonfigurator Seitenfaltenbeutel Bestellung Konfiguration Maßen
192 Schuldenhilfe-Berlin | Ihre Schuldnerberatung mit Herz Schuldnerberatung
10117
Berlin
Wir haben uns auf die Königsklasse der Schuldnerberatung spezialisiert, die außergerichtliche Schuldenbereinigung. Werden Sie mit uns schuldenfrei ohne...
schuldenhilfe-berlin.de Schulden Berlin Insolvenz Schuldenhilfe Raus Schuldnerberatung Hilfe Sprechtage
193 Hörgeräte Hörgeräte
13469
Berlin
Hornig Hörgeräte Berlin - 3x in Berlin. Dirk Hornig, Hörgeräteakustiker mit Tüv Zertifikat lässt auch ihre Ohren...
hornig-hoeren.de/
194 Altkleiderverkauf Berlin Handel und
13127
Berlin
Altkleiderverkauf Bei uns finden Sie höchste unsortierte Qualität aus dem Raum Berlin. Container Sammelware aus Berlin zu Kilopreisen Unsortierte...
altkleiderverkaufberlin.com/ Altkleider Berlin Qualität Sammelware Altschuhe Unsortierte Mindestabnahmemenge Altkleiderverkauf
195 Anwalt Sozialrecht Berlin - Imanuel Schulz Sozialrecht
12043
Berlin
Kostenlose Hilfe im Sozialrecht (Hartz 4): Wir bieten Ihnen kostenlose Rechtsberatung im Sozialrecht (Hartz 4) im Rahmen...
rechtsanwalt-imanuel-schulz.de/sozialrecht-berlin-neukoelln/ Berlin Hartz Rechner Sozialrecht Prüfen Neukölln Jetzt… Anwalt
196 FARAWAYHOME Furnished Apartments Immobilien
10439
Berlin
Über FARAWAYHOME können Sie besten Serviced Apartments und möblierten Wohnungen z.B. in Berlin, Frankfurt, München oder Hamburg...
farawayhome.com
197 KitchenAid Reparatur Berlin Küchengeräte
10559
Berlin
KitchenAid Küchenmaschinen Service Berlin Impressum Angaben gemäß § 5 TMG: KAFFEE BÄRLIN Ahmet Bayram Alt-Moabit 120 10559 Berlin Kontakt: Telefon: 030 / 398 077 95 Telefax:...
kitchenaid-reparatur-service.de
198 Jura Kaffeeautomaten Reparatur Berlin Kaffeemaschinen
10559
Berlin
Reparatur-Service für Jura Kaffeemaschinen in Berlin...
jura-kundendienst-berlin.de
199 Jura Kaffeeautomaten Reparatur Berlin Kaffeemaschinen
10559
Berlin
Reparatur-Service für Jura Kaffeemaschinen in Berlin...
jura-kundendienst-berlin.de
200 Heilpraxis für Massage und Körpertherapie Massage und
12159
Berlin
Die Praxis für Massage und Körpertherapie liegt direkt am S-Bahnhof Friedenau in Schöneberg/Steglitz in ruhiger Lage. Ich...
heilpraxis-valenti-clari.de Z Y
201 Pflegeversicherung Heute Versicherung
13086
Berlin
Wir erklären, was alles wichtig für die private und gesetzliche Pflegeversicherung ist. Alle Testergebnisse stehen dem Leser...
pflegeversicherung-heute.de/ Pflegeversicherung Private Test Vergleich Freibetrag Besonderheiten Gesetzliche Krankenzusatz
202 Medizinstudium Schule
10117
Berlin
Ein Medizinstudium absolvieren? Für die optimale Vorbereitung ist Premedicine Berlin der Ansprechpartner. Egal ob es ein Medizinstudium im...
premedicine-berlin.de Medizinstudium Ausland Informationen Academy Vorbereitung Medical Berlin Zahnmedizin
203 günstige Transporte Umzüge & Entsorgungen Transporte &
13507
Berlin
Wir sind seit über 15 Jahren Ihr kompetenter und zuverlässiger Ansprechpartner für Kleintransporte aller Art egal ob...
moebeltaxi-berlin.de Mbeltaxi Transport Ikea Berlin Schrieb Bewertung Umzug Meinungen
204 Fotostudio Fotografie
12555
Berlin
cross space studio
205 Woodford Trailers in Berlin Firmen
13359
Berlin
Entdecken Sie die große Auswahl an Anhänger Woodford. Wir haben Ihren Anhänger, vom Dreiseitenkipper bis zum...
autotrailer-berlin.de Woodford Geschlossene Anhänger Trailer Rl Galaxy Geschlossen
206 Unsichtbare Zahnspange bei den Zahnärzten am Zahnarzt
10785
Berlin
Schiefe Zähne ade! Mit der unsichtbaren Zahnspange (Invisalign) können Sie in kurzer Zeit Ihre Zähne wieder in...
zahnaerzte-am-potsdamer-platz.de Berlin Zähne Zahnarzt Prophylaxe Praxis Leistungen Schnarchen Bleaching
207 Kampfkunst Selbstverteidigung
88662
Überlingen
serradaescrima.de Domain United Portfolio Domains Registriert Platzhalter Rechte Einstellungen
208 Fenster-Komm Fensterbau
13509
Berlin
fenster-komm.net/ Fenster Daten Google Komm Website Türen Berlin Analytics
209 Kfz-Gutachter Berlin und Brandenburg Kfz-Gutachter
10551
Berlin
Auf der Suche nach einem schnellen und erfahrenen Kfz-Gutachter in Berlin und Brandenburg? Besuchen Sie kfzgutachterberlin.net und...
kfzgutachterberlin.net/ Kfz Berlin Gutachter Fahrzeugs Wertgutachten Unfallgutachter Gutachten Brandenburg
210 Lieblingsbrille Augenoptik Augenoptiker
14199
Berlin
lieblingsbrille-augenoptik.de Gleitsichtbrille Monatslinsen L Sehstärke Augenoptik Ihr Lesebrille N
211 Barrierefreies Bad Barrierefrei
12437
Berlin
Seniorengerecht und Behindertengerechter Umbau Barrierefreies Bauen, Planen & Modernisieren für gehandicapte Menschen. Menschen mit einem Handicap / gehandicapt, sind leistungsschwächere...
handicap-buscher.de Menschen Wohnung Wanne Arbeiten Barrierefreies Handicap Nun Plötzlich
212 Heilpraktiker Wanitschek & Vigl Berlin Heilpraktiker
12047
Berlin
Herzlich willkommen auf unserer Präsenz auf stadtbranche.de. Sind Sie auf der Suche nach einem Heilpraktiker/ einer Heilpraktikerin...
sebastianvigl.de
213 Heilpraktiker Wanitschek & Vigl Berlin Heilpraktiker
12047
Berlin
Herzlich willkommen auf unserer Präsenz auf stadtbranche.de. Sind Sie auf der Suche nach einem Heilpraktiker/ einer Heilpraktikerin...
sebastianvigl.de
214 Profitabel Forex Handeln und als Day Finanzen Trading

Berlin
Als Trader von zu Haus arbeiten und mit hoher Unabhängigkeit die finanziellen Ziele erreichen. Genau diese Möglichkeiten...
maniforex.de Forex Trading Strategie Trader Finde Psychologie Traden Risiko
215 Vital Umzüge Transporte Logistic
13347
Berlin
Über uns/ unser Unternehmen Wir verstehen uns als Dienstleister, für den die Kundenzufriedenheit an erster Stelle steht. Bei...
vital-umzuege.de Berlin Umzüge Umzug Vital Wedding Günstig Umzugsfirma Transport
216 Studio Pur Fotogen GmbH Fotostudio
10249
Berlin
studio-pur-fotogen.de/ Studio Fotogen Preise Pur Kindercasting Bilder Bewerbungsfotos Berlin
217 Glaserei Thiel GmbH Glaserei
12555
Berlin
berlin-glaserei-thiel.de/ Glaserei Berlin Thiel Köpenick Mahlsdorf Umgebung Kunstglaserei Glas
218 Schneeball GmbH Winterdienst Grünanlagenpflege
12349
Berlin
In Zukunft zufrieden! Als Unternehmen, mit einem anderen Konzept, gilt es viele Punkte zu beachten und Herausforderungen zu...
schneeball-gmbh.de Winterdienst Berlin Information_ Schneeball Berliner Notdienst Unternehmen Berlintelefon
219 Pylones Geschenkartikel
12163
Berlin
Pylones stiftet Unruhe in der Welt der Geschenke: wir schütteln sie durch, erfinden sie neu, geben ihnen...
pylones.com
220 Pylones Geschenkartikel
10719
Berlin
Pylones stiftet Unruhe in der Welt der Geschenke: wir schütteln sie durch, erfinden sie neu, geben ihnen...
pylones.com
221 Pylones Geschenkartikel
10178
Berlin
Pylones stiftet Unruhe in der Welt der Geschenke: wir schütteln sie durch, erfinden sie neu, geben ihnen...
pylones.com
222 Agentur 247 Limousinenservice
10719
Berlin-Wilmersdorf
Wir bieten mit unserer Agentur Privatpersonen, Geschäftsleuten und Prominenten einen komfortablen Shuttle Service bzw. Limousinenservice an...
agentur247.de Berlin Agentur Uns Mobilitätslösungen Services Bieten Flughafentransfer Außerhalb
223 Edition Monhardt Verlag
12163
Berlin
Edition Monhardt ist ein neuer unabhängiger Berliner Verlag für Lyrik, kurze Prosa, Essayistik und Kunst. Gegenwartsliteratur aus...
monhardt.de Monhardt Berlin Edition Warenkorb Mein Striebel Buchhandel Bernhard
224 Klaviere Berlin Klaviergeschäft
10585
Berlin
Das Pianohaus Listmann ist seit vielen Jahren der Ansprechpartner rund um Klaviere in Berlin. Ein Klavier kaufen, Klavier...
pianohaus-berlin.com Berlin Klavier Klaviere Flügel Brandenburg Schimmel Listmann Pianohaus
225 Watershed Packaging DE Dienstleistung
10965
Berlin
Watershed DE produziert Schrumpfschlauchetiketten und bedruckte Verpackung. Sehen Sie sich unser wundervolles Portfolio von flexiblen Verpackungen an....
watershed-packaging.de/
226 Starklasers.com Laser
10115
Berlin
Starklasers.com ist eine professionelle Laserpointer-Shop, mit allen Arten von Laser-Ausrüstung: grüner Laser, roter Laser, blauer Laser, gelber...
starklasers.com/ Laserpointer Laser Mw Grün Blau Rot Nm €
227 Hipster Escape e.K. Unterhaltung
10247
Berlin
hipster-escape-berlin.de Escape Spiel Hipster Party Rätseln Games Wohnung Buchung
228 Partyservice Berlin Bauern-Kate.de Partyservice Berlin Bauern-Kate.de Partyservice Berlin
10589
Berlin
Partyservice Berlin Bauern-Kate.de Seit 1981 sind wir nun schon als erfahrener Dienstleister im Bereich Partyservice-Berlin und Catering in...
partyserviceberlin.org/ Büffet Berlin Partyservice Bauern Catering Kalte Rustikales Büffets
229 Krupa Sicherheitsdienst GmbH aus Berlin Sicherheitsdienst Security
12203
Berlin
Die Krupa Sicherheitsdienst GmbH aus Berlin ist Ihr seriöser, kompetenter und vertrauenswürdiger deutschlandweiter Partner. Dienstleistungen: Security, Wachschutz, Veranstaltungsschutz...
krupa-sicherheitsdienst.de Berlin Sicherheitsdienst Security Wachschutz Sanitter Brandwachen Krupa Sicherheit
230 jobtensor Jobbörse
10435
Berlin
Mit dem Ziel einer optimierten Online-Jobsuche dient die Internetplattform jobtensor als Vermittler zwischen Arbeitgebern und interessierten Bewerbern...
jobtensor.com Jobtensor Job Forschung Luft Finde Informatik Preise Linkedin
231 Immer aktuelle Schrottpreise bei Hein Schrotthandel Schrotthandel -
15566
Schöneiche bei Berlin
Sie bekommen bei Hein Schrotthandel GmbH stets faire und transparente Schrottpreise geliefert, sie sind tagesaktuell und wir...
hein-schrotthandel.de Schrotthandel Schrott Schrottpreise Entsorgung Ihrem Hein Ankauf Metallschrott
232 Müller & Kollegen Rechtsanwälte Anwalt
13595
Berlin
rechtsanwaelte-berlin.com Kollegen Müller Rechtsanwälte Berlin Arbeitsrecht Mietrecht Groß Hakenfelde
233 Rechtsanwalt Steffen Radlbeck Rechtsanwalt
12167
Berlin
Meine Kanzlei hat sich auf dem Gebiet des Immobilienrechts spezialisiert und hat über zehn Jahre erfolgreich Mandanten...
anwalt-radlbeck.de
234 Rechtsanwalt Steffen Radlbeck Rechtsanwalt
12167
Berlin
Meine Kanzlei hat sich auf dem Gebiet des Immobilienrechts spezialisiert und hat über zehn Jahre erfolgreich Mandanten...
anwalt-radlbeck.de
235 Research Personal Personalberatung
10405
BERLIN
Personalberatung in Berlin gesucht? Dann ist WPR der Spezialist . Das Unternehmen WPR bietet Unterstützung für Rekrutierungsmaßnahmen...
wpr-research.de Manager Wm Festanstellung Operations Research Jobs Real Department
236 Tiont Berlin Entrümpelungen
10117
Berlin
Entrümpelungen Tiont Berlin Komplett Service pauschal sofort Wohnungsauflösung Sperrmüll Haushaltsauflösungen zum Festpreis Keller Entrümpelung Dienst...
tiont.de Entrümpelung Berlin Tiont Notdienst Entrümpelungen Sperrmüll Keller Express
237 Rechtsanwalt Dr. Christopher Kasten Rechtsanwalt
10777
Berlin
anwalt-kasten.de/ Daten Google Berlin Familienrecht Kasten Fotoliacom Website Christopher
238 Sperrmüll Berlin Entsorgung
13347
BERLIN
Das Unternehmen Kraftzone ist der richtige Partner wenn es um die Wohnungsauflösung geht. Durch Erfahrung und Know-How...
kraftzone.de Partner Dip Aengevelt Berlin Vermittelt Sperrmüll Magdeburg Entrümpelung
239 Hager & Partner GbR Rechtsanwälte und Rechtsanwalt
10629
Berlin
Wer die Kanzlei Hager & Partner betritt, begegnet fünf erfahrenen Juristen. Was sie verbindet, ist ihre Leidenschaft...
kanzlei-hager.de/ Hager Partner Rechtsanwalt Berlin Erbrecht Kanzlei Team Georg
240 030 Datenrettung Berlin Datenrettung
13187
Berlin
Datenrettung und Datenwiederherstellung von Festplatte, NAS, RAID-Servern, SSD sowie Flash-Speichern und Handy....
030-datenrettung.de Datenrettung Festplatte Ssd Nas Festplatten Server Berlin Usb
241 List and Sell - Webdesign Marketing Webdesign Agentur
12439
Berlin
Ihrem Fullservice-Anbieter rund um eBay- und Amazon-Shops sowie eCommerce-Lösungen. Sie haben ein Produkt? Wir kümmern uns um...
listandsell.de Design Shop Amazon Webshops Leistungen Optimierung Beratung Ebay
242 Vedis Indisches Restaurant Cocktailbar Prenzlauer Berg Indische Restaurants
10437
Berlin
Seien Sie herzlich eingeladen, das romantische, exotische und warme Ambiente im Vedis zu genießen. Direkt in Berlin...
vedis.berlin Restaurant Vedis Berlin Indisches Prenzlauer Berg Indian Küche
243 Entrümpelung24 Berlin Entrümpelung Wohnungsauflöung
13347
Berlin
Als professionelle Firma für Entrümpelungen und Entsorgungen aus Berlin übernehmen für gerne für Sie Ihre Wohnungsauflösung sowie...
entruempelung24.berlin Entrümpelung Berlin Umzug Malerarbeiten Entsorgung Umzugsservice Aufbau Möbel
244 Eventfotografie Berlin | Valentin Paster Eventfotograf
12353
Berlin
Hinterlassen Sie eine Spur! Ein Event ist ein gut durchdachtes und sorgfältig geplantes Ereignis. Bei der Eventfotografie setzen...
berlin-eventfotograf.de/ Hochzeit Interieur Galerie Eventfotograf Events Europaweit Jobs Berlin
245 LoveMoments | Hochzeitsfotograf Valentin Paster aus Hochzeitsfotograf
12353
Berlin
Falls Ihr in Berlin oder Europa heiraten möchtet und gerade auf der Suche nach dem richtigen Hochzeitsfotografen seid, dann...
lovemoments.de Hochzeitsreportage Hochzeit Bilder Liebe Euch Berlin Hochzeitsfotograf Hochzeitsalbum
246 Hypnoanalyse Hypnosetherapie Gesundheit
13189
Berlin
Hypnoanalyse, die moderne Therapieform, die Hypnose und traditionelle Therapiemethoden vereint. Für schnelle und anhaltende Erfolge bei Depressionen...
lammerding-hypnose.de Hypnosetherapie Berlin | Hypnoanalyse Pankow Lebenskrisenkurzzeittherapie Depressionängsten Klientenzentrierte
247 http: www.maytoni.de Handel
10178
Berlin
Lampen & Leuchten Großhandel Verkauf vom Hersteller. Das umfassende Angebot an Kronleuchtern wird ständig durch neue Modelle...
maytoni.de Wholesale Chandeliers Crystal Lighting Modern Europe Street Classic
248 http: www.maytoni.de Handel
10178
Berlin
Lampen & Leuchten Großhandel Verkauf vom Hersteller. Das umfassende Angebot an Kronleuchtern wird ständig durch neue Modelle...
maytoni.de Wholesale Chandeliers Crystal Lighting Europe Modern Street Classic
249 Kopierladen Copyshop
10405
Berlin
Wir sind Dein Kopierladen. Preiswert, ­zu­verlässig und schnell. Du findest uns ­4 mal in Berlin oder im...
kopierladen-berlin.de/ Kopierladen Berlin Prenzlauer Berg Pankow Papier Aufkleber Sa–
250 Kopierladen Copyshop
10247
Berlin
Wir sind Dein Kopierladen. Preiswert, ­zu­verlässig und schnell. Du findest uns ­4 mal in Berlin oder im...
kopierladen-berlin.de/ Kopierladen Berlin Prenzlauer Papier Berg Pankow Aufkleber Kopien
251 Kopierladen Copyshop
13187
Berlin
Wir sind Dein Kopierladen. Preiswert, ­zu­verlässig und schnell. Du findest uns ­4 mal in Berlin oder im...
kopierladen-berlin.de/ Kopierladen Berlin Prenzlauer Pankow Berg Papier Buchbindungen Aufkleber
252 Copyshop Copyshop
13088
Berlin
Wir sind Dein Kopierladen. Preiswert, ­zu­verlässig und schnell. Du findest uns ­4 mal in Berlin oder im...
kopierladen-berlin.de/ Kopierladen Berlin Prenzlauer Papier Berg Pankow Weissensee Buchbindungen
253 orderbird - iPad-Kassensystem für die Gastronomie Software
10969
Berlin
orderbird ist das Nr. 1 iPad Kassensystem für die Gastronomie. Über 6500 Restaurants, Cafés, Bars und andere...
orderbird.com English Deutsch ✓ Kassensystem De Blog Ipad Presse
254 Classic55 Oldtimervermietung Oldtimervermietung
12527
Berlin
Wir vermieten mit Chauffeur perfekt restaurierte amerikanische Oldtimer der 50er Jahre. Diese werden gerne für Film, Hochzeiten...
classic55.de Berlin Oldtimer Hochzeitsauto Hochzeit Cadillac Jahre Wagen Hochzeitsfotograf
255 Rechtsanwaltskanzlei Kuletzki Rechtsanwalt
12187
Berlin
Rechtsanwalt Stephan Kuletzki und Rechtsanwältin Corinna Mnich der Rechtsanwaltskanzlei Kuletzki sind Ihre kompetenten Ansprechpartner in allen juristischen...
rechtsanwaltkuletzki.de Kuletzki Rechtsanwalt Arbeitsrecht Verkehrsrecht Vertragsrecht Berlin Rechtsanwältin Kanzlei
256 Hochzeitsfotograf in Berlin - Fotos Eurer Hochzeitsfotograf
12101
Berlin
Fotos Eurer Hochzeit – Euer Hochzeitsfotograf in Berlin für gefühlvolle Hochzeitsfotografie und emotionale Hochzeitsreportagen. Traumhafte Hochzeitsreportagen in Berlin...
fotos-eurer-hochzeit.de Hochzeitsreportage Berlin Hochzeitsfotograf Euch Trauung Boudoir Wedding Kleine
257 Berlin Entrümpelungen Entrümpelung Wohnungsauflöung
13347
Berlin
Für eine gründliche und reibungslose Entrümpelung stehen wir mit unserem Namen. Von Haushaltsauflösungen über Keller und Büroauflösungen...
berlin-entruempelungen.de/ Berlin Entrümpelungen Malerarbeiten Umzugsservice Umzüge Umzug Preise Haushaltsauflösung
258 Dr. med. Natalie Reytan Gesundheit
10117
Berlin
Ein umfassendes Spektrum bietet die private Praxis für Dermatologie Dr. Reytan in Berlin Mitte an. In der...
hautarztpraxisberlin.de – Hautarztpraxis Kosmetik Akne Allgemein Therapie Kindern Beratung
259 Hellsehen und Wahrsagen Esoterik
10969
Berlin
Sofortberatung unter: 09003 – 101016 (1, 52EUR/Min) Ich bin ein hellsichtiges Medium und arbeite schon langjährig als spirituelle...
orphina.de Kartenlegen Magie_ _hellsichtiges Phone ~dotdeb+ Jenseitskontakte Wahrsagen Esoterik
260 Fakten zum Thema Mineralwasser Nahrungsmittel
13086
Berlin
Auf der hier genannten Seite, werden Anbieter und Abfüller von Mineralwasserquellen vorgestellt und entsprechend bewertet....
mineralwasser-testsieger.de/ Mineralwasser Medium Gerolsteiner Testsieger Wasser Test Vergleich Stiftung
261 PEC Reinigungsmaschinen Berlin GmbH Reinigungsmaschinen
13055
Berlin
PEC Reinigungsmaschinen Berlin GmbH ist Ihr zuverlässiger Partner wenn es um die Vermietung und Kauf von Reinigungstechnik...
reinigungsmaschinen-berlin.de/ Berlin Reinigungsmaschinen Scheuersaugmaschinen Industriesauger Hochdruckreiniger Vermietung Reinigungstechnik Zubehör
262 MiAna GmbH & Co. KG Mode
10829
Berlin
Unser Onlineshop vertreibt Produkte der Marke GRETCHEN, welche als berliner Accessoire Brand gegründet wurde, mit dem Ziel...
mygretchen.com/shop/ Gretchen Gloves Berlin Anne Schmitt Summer Christin Purses
263 Die Vollkasko Heute Versicherung
13086
Berlin
Auf dieser Seite werden die Vorteile und mögliche Nachteile von Anbietern der Vollkaskoversicherung vorgestellt. Durch Testberichte und...
vollkasko-heute.de/ Vollkasko En Angeboten Langeempfehlung Möglichkeit Vollkaskoschutz Gelangen Mindern
264 MPU-Vorbereitung online bei mentavio.com Psychologie
12437
Berlin
mentavio bietet professionelle MPU-Vorbereitung und psychologische Beratung per Internet an. Mit nur wenigen Klicks können Sie bei...
mentavio.com/mpu-vorbereitung Z Y
265 Rechtsanwalt Jan Bartholl Rechtsanwalt
10629
Berlin
Der Anwalt für Reiserecht bietet Rechtsberatung in Fällen der Anspruchsverfolgung von Entschädigung bei Flugverspätung, Flugannullierung oder Flugänderung. Die...
rechtsanwalt-bartholl.de Bartholl Kanzlei Reiserecht Services Rechtsanwalt Lewandowski Legal Recht
266 Rechtsanwalt Jan Bartholl Rechtsanwalt
10629
Berlin
Der Anwalt für Reiserecht bietet Rechtsberatung in Fällen der Anspruchsverfolgung von Entschädigung bei Flugverspätung, Flugannullierung oder Flugänderung. Die...
rechtsanwalt-bartholl.de Bartholl Kanzlei Reiserecht Rechtsanwalt Services Lewandowski Legal Recht
267 Rechtsanwalt Jan Bartholl Rechtsanwalt
10629
Berlin
Der Anwalt für Reiserecht bietet Rechtsberatung in Fällen der Anspruchsverfolgung von Entschädigung bei Flugverspätung, Flugannullierung oder Flugänderung. Die...
rechtsanwalt-bartholl.de Bartholl Kanzlei Reiserecht Recht Services Lewandowski Legal Rechtsanwalt
268 Rechtsanwalt Jan Bartholl Rechtsanwalt
10629
Berlin
Der Anwalt für Reiserecht bietet Rechtsberatung in Fällen der Anspruchsverfolgung von Entschädigung bei Flugverspätung, Flugannullierung oder Flugänderung. Die...
rechtsanwalt-bartholl.de/ Bartholl Kanzlei Reiserecht Legal Rechtsanwalt Lewandowski Services Recht
269 Bergemann & Weidner Rechtsanwälte Bergemann & Weidner Rechtsanwälte Rechtsanwälte
13407
Berlin
Die Rechtsanwaltskanzlei Bergemann & Weidner wurde in den 70er Jahren im Norden Berlins gegründet. Seit 2001 ist...
bergemann-weidner.de
270 Steinkühler – Kanzlei für Arbeits- und Rechtsanwalt
10625
Berlin
Wir sind ein 6-köpfiges Team hochspezialisierter und erfahrener Anwälte. Dank bundesweiter und internationaler Mandate erweitern wir täglich...
steinkuehler-legal.com/ Reihe Platz Leistungen Steinkühler Kanzlei Gründer Arbeitnehmer Unternehmer
271 Pinkcube Werbeartikel Werbeartikel
10243
Berlin
Online Werbeartikel bestellen bei Pinkcube Wir sind Pinkcube. Wir liefern Ihnen Werbeartikel über sehr benutzerfreundliche Webshops. Wir machen...
pinkcube.de Logo ✔ Bedrucken Günstig Werbeartikel Werbemittel Berlin Artikel
272 DOLMETSCHERSERVICE Dolmetscher
13407
Berlin
DOLMETSCHERSERVICE M.A. Konferenzdolmetscherin, allgemein beeidigte Dolmetscherin und ermächtigte Übersetzerin für die Berliner Gerichte und Notare. Sprachen: Englisch &...
dolmetscherservice.org Agb – Dolmetscherservice Honorar Deutsch Profil Leistungen Jeder
273 Digitale Beratung Digitalagentur
13359
Berlin
Erreichen Sie Ihre Kunden zielgenau im Internet: Wir optimieren und vermarkten Ihre Webpräsenz und machen Sie sichtbar...
digitaleberatung.com Kunden Digitale Mittelstand Beratung Agentur Leistungen Unternehmen Blog
274 A . Müller Umzug Berlin günstiger Umzüge
10117
Berlin
A . Müller ist Ihre Umzugsfirma, Umzugsunternehmen zum Umzugskosten sparen bei Umzug nach Berlin , bei Umzug...
tesu-umzug.berlin Umzug Berlin Lager München Packmaterial Hamburg Irland Frankfurt
275 Erfahrungen24.eu Bewertungen
13403
Berlin
Erfahrungen24 bietet ein intuitives System zum Lesen und Abgeben von Bewertungen für Online Shops, Dienstleister, Produkte und...
erfahrungen24.eu/ Test Erfahrungen Erfahrung Reviews Erfahrungsberichte Shops Bewertungen Preisvergleich
276 THE BRETTINGHAMS GmbH Internetagentur
10629
Berlin
Internetagentur für digitale Lösungen aus Berlin. Full-Service Digitalagentur für Strategie, Webdesign, TYPO3 Programmierung und Online Marketing....
brettingham.de Internetagentur Berlin Services Marketing Unternehmen Agentur Brettinghams Marken
277 Dudelsack Unterricht in Berlin Musikunterricht
10247
Berlin
Dudelsack Unterricht für Totalanfänger bis Fortgeschrittene, für Kinder (ab 10 Jahre), Jugendliche und Erwachsene in Berlin. > Professioneller...
dudelsackunterricht.jimdo.com Unterricht Berlin Dudelsack Info Z
278 Alex Entrümpelung Berlin Entrümpelung
10243
Berlin - Friedrichshain
Entrümpelung Berlin Die Entrümpelungs-Profis von Alex Entrümpelung Berlin helfen Ihnen schnell und unkompliziert bei Ihrer Entrümpelung in Berlin....
alex-entruempelung.de Berlin Entrümpelung Leistungen Ankauf Gartenpflege Wohnungsauflösung Uns Zuverlässig
279 CAPLAN & GREEN Executive-Search
13627
Berlin
Caplan & Green ist das Talent Management und Executive Search Unternehmen mit der größten Marktbreite. Unsere Berater unterstützen nationale...
caplangreen.com Executive Green Caplan Talent | Geht Partner Nächsten
280 CAPLAN & GREEN Talent Management
13627
Berlin
Caplan & Green ist das Talent Management und Executive Search Unternehmen mit der größten Marktbreite. Unsere Berater unterstützen nationale...
caplangreen.com Green Executive Caplan | Talent Geht Fach Managers
281 PRESTIGE Kosmetikakademie Kosmetikschule
10713
Berlin
Wir sind eine DEKRA zertifizierte Bildungsakademie und Mitglied beim BfD Bundesverband der Fachkosmetiker/-innen in Deutschland. Mit der DEKRA-...
prestige-akad.de Prestige Ausbildung Kosmetikakademie Wellness Dozenten Kosmetik Bildung Schulung
282 Apple Reparatur Berlin Apple Service
10707
Berlin
Ihr Mac oder iPhone macht mal wieder nicht das, was es soll? - Kein Problem, wir von...
apple-reparatur-berlin24.de/ Reparatur Berlin Apple Bewertungen Rufen Agb Joomla Falls
283 PC und Notebook Reparatur Berlin Pc und
10707
Berlin
Sie suchen einen kompetenten, kundenorientierten Service, der dazu noch preiswert ist? Dann sind wir, PC-Reparatur-Berlin24, Ihr Ansprechpartner...
pc-reparatur-berlin24.de/ Pc Reparatur Berlin Fachmann Hilfe Potsdam | Mac
284 Videoüberwachung Einbau Berlin & Umland Videoüberwachung
10707
Berlin
Wollen Sie wissen, wer ein- und ausgeht oder bei Ihnen klingelt? Wollen Sie von überall auf der...
xn--videoberwachung-berlin24-zsc.de/ Videoüberwachung Berlin Umland überwachungssysteme Ama Essen Kameraüberwachung Düsseldorf
285 DJ Sascha B DJ

Berlin
professioneller DJ Service in ganz Deutschland...
dj-sascha-b.de Sascha Dj | Professioneller Hochzeiten Events Anfrage Hochzeit
286 iSpodBerlin Webdesign
12349
Berlin
Professionelle und aktuelle Websites sind ein Muss für Gründer, Startups, Selbstständige und Unternehmen Ihre Web-, Blog - ...
ispod-webagentur.de/ | Website Erstellen Webagentur Anfang Texte Professionelle Fairen
287 iSpodBerlin Webdesign
12349
Berlin
Professionelle und aktuelle Websites sind ein Muss für Gründer, Startups, Selbstständige und Unternehmen Ihre Web-, Blog - ...
ispod-webagentur.de/ | Erstellen Website Webagentur Webdesign Websitescontent Firmenwebsite Socialmedia
288 Ratenkredits-Vergleiche Finanzen
13086
Berlin
Wir stellen unterschiedliche Anbieter von Darlehen und Krediten vor. So können Kreditnehmer das tatsächliche Leistungsniveau erkennen. Alle...
ratenkredits-vergleiche.de/ Vergleich Ratenkredit Vergleichen Aktuell Unserem Vergleichsportal Angebot Angebote
289 Waschmaschine Abholung Berlin Entrümpelung
10117
Berlin
Sperrmüll Abholung in Berlin Komplett Service Entrümpelungen aller Art sofort Möbel Sperrholz Waschmaschine Abholung Berlin Keller Entrümpelung...
xn--sperrmllabholung-berlin-hpc.org Berlin Sperrmüllabholung Sperrmüll Waschmaschine Abholung Möbel Berlinorg Elektrogeräte
290 Hochzeitsfotograf in Berlin - Fotos eurer
12101
Berlin
Fotos Eurer Hochzeit – Euer Hochzeitsfotograf in Berlin für gefühlvolle Hochzeitsfotografie und emotionale Hochzeitsreportagen. Traumhafte Hochzeitsreportagen in Berlin...
fotos-eurer-hochzeit.de Hochzeitsreportage Berlin Hochzeitsfotograf Trauung Boudoir Euch Preise Begleitung
291 Detektei AC online Detekteien
14057
Berlin
Ihr professionellen IT-Dienstleister - Detektei AC Lösungen für Verbesserungen Konkrete Lösungen zum einem erfolgreichen IT-Sicherheitsmanagement und Verbesserungen anzubieten, würde...
detektei-ac.de
292 Detektei AC online Detekteien
14057
Berlin
Ihr professionellen IT-Dienstleister - Detektei AC Lösungen für Verbesserungen Konkrete Lösungen zum einem erfolgreichen IT-Sicherheitsmanagement und Verbesserungen anzubieten, würde...
detektei-ac.de
293 Detektei AC online Detekteien
14057
Berlin
Ihr professionellen IT-Dienstleister - Detektei AC Lösungen für Verbesserungen Konkrete Lösungen zum einem erfolgreichen IT-Sicherheitsmanagement und Verbesserungen anzubieten, würde...
detektei-ac.de Detektei Privatdetektive Observationen Informationen Familie Consulting Ermittlungen Ermitteln
294 Detektei AC online Detekteien
14057
Berlin
Ihr professionellen IT-Dienstleister - Detektei AC Lösungen für Verbesserungen Konkrete Lösungen zum einem erfolgreichen IT-Sicherheitsmanagement und Verbesserungen anzubieten, würde...
detektei-ac.de Detektei Privatdetektive Informationen Wirtschaftsdetektei Preiswerte Ermittlungen Blog Preise
295 Detektei AC online Detekteien
14057
Berlin
Ihr professionellen IT-Dienstleister - Detektei AC Lösungen für Verbesserungen Konkrete Lösungen zum einem erfolgreichen IT-Sicherheitsmanagement und Verbesserungen anzubieten, würde...
detektei-ac.de Detektei Privatdetektive Recherche Preiswerte Ac | Observation Fingiertemermitteln
296 Detektei AC online Detekteien
14057
Berlin
Ihr professionellen IT-Dienstleister - Detektei AC Lösungen für Verbesserungen Konkrete Lösungen zum einem erfolgreichen IT-Sicherheitsmanagement und Verbesserungen anzubieten, würde...
detektei-ac.de
297 Detektei AC online Detekteien
14057
Berlin
Ihr professionellen IT-Dienstleister - Detektei AC Lösungen für Verbesserungen Konkrete Lösungen zum einem erfolgreichen IT-Sicherheitsmanagement und Verbesserungen anzubieten, würde...
detektei-ac.de Privatdetektive Detektei Ermitteln Privat | Wirtschaftsdetektei Familie Ermittlungen
298 Histavino Wein
10997
Berlin
Die Seite Histavino ist für Menschen interessant, die trotz ihrer Histaminintoleranz nicht auf einen guten Tropfen Wein...
histavino.com Lebensmittel Wein Histamingeprüfter Histamin Weine Histavino Gluten Essig
299 Zahnarzt für Zahnimplantate Berlin Mitte Zahnarzt Oralchirurgie
10785
Berlin
Zahnarzt für Zahnimplantate in Berlin Das Zahnarztzentrum am Potsdamer Platz in Berlin Mitte besteht aus einem erfahrenen Team...
zahnarzt-am-potsdamer-platz.de/ Berlin Prophylaxe Zahnarzt Zahnmedizin Invisalign Potsdamer Parodontitis Behandlung
300 KOR7 MEDIA Marketing
10587
Berlin
KOR7 MEDIA ist eine Agentur für digitales Marketing und Content Produktion. Wir steigern Ihren Unternehmens- und Markenwert...
kor7media.de Instagram Marketing Influencer Media Social Content Agentur Produktion

Kleinanzeigen, Kommentare und Mitfahrgelegenheit Berlin

+ Kommentar oder Kleinanzeige für Berlin eintragen!

301 Home Augenarztpraxis im
10783
Berlin
Augenarztpraxis im Ärzte Centrum Bülowstraße
aerzte-buelowstrasse.de
302 Albers DAS SPORTRESTAURANT Albers Wettboerse GmbH Albers
10783
Berlin
Großzügig konzipiert ist das Albers Sportrestaurant der Treffpunkt aller Besucher des Pferdesportparks BerlinKarlshorst. Der aufmerksame
albers-restaurant.de Albers Berlin Restaurant
303 Home
10783
Berlin
Kultur FREIES MUSEUM BERLIN
artfactory-berlin.de
304 Weihnachtsmarkt auf dem Winterfeldtplatz Berlin
10783
Berlin
Der traditionelle Weihnachtsmarkt auf dem Winterfeldtplatz ist einzigartig und an den Adventssonntagen geöffnet.
weihnachtsmarkt-winterfeldtplatz.de Berlin Weihnachtsmarkt Winterfeldtplatz
305 Formular.de Tipps Formular.de ist ein Angebot der Formblitz AG
10783
Berlin
Auf Formular.de finden Sie umfangreiche Informationen zu juristischen Themen wie Mietvertrag Arbeitsvertrag Patientenverfügung
formular.de
306 Cafe Peri Start
10783
Berlin
Homepage of Cafe Peri
cafe-peri.de
307 Czollek consult Willkommen! Leah
10783
Berlin
Diversity Dialoge Mediatorin Trainerin Dozentin Konflikte produktiv und zufriedenstellend lösen Kommunikation Dialog Unternehmen Kommunikationskultur
czollek-consult.de Leah Carola Czollek
308 PROFORMA Corporate Design Gesellschaft für Unternehmenskommunikation mbH & Co. KG Design
10783
Berlin
Corporate Design Agentur Berlin Agentur für Unternehmenskommunikation WebEntwicklungen und Beratung. Für Unternehmen
proforma.de Design Gestaltung Corporate
309 Business Development Germany German
10783
Berlin
We bring your business on the German market ? contact us today!
businessdevelopmentgermany.de German Companies German Marketing
310 DJ Frank DJService DJ
10783
Berlin
Dj Frank Berlin DJService für Partys Feste Hochzeiten ...
dj-frank-berlin-brandenburg.de DJ Berlin Brandenburg Party Hochzeit
311 Berlin Taekwondo Willkommen Berlinsan Taekwondo Sportverein e.V. Adnan
10783
Berlin
Olympic Sports Center Berlinsan Taekwondo e.V. Adnan Karabulut
berlintaekwondo.de Adnan Karabulut Taekwondo Berlin
312 Wohnungsauflösung Berlin 030 wohnungsauflösung
10783
Berlin
Wohnungsauflösung Berlin günstig und schnell von Complett Räumung 030 261 01 714
berlin-wohnungsaufloesung.de Wohnungsauflösung Berlin Wohnungsauflösungen Entrümpelung Entrümpelungen
313 RAe Böhm MeyerDulheuer §§
10783
Berlin
Rechtsanwälte Rechtsanwalt Matthias Böhm Notar Helmuth MeyerDulheuer RA RAe §
boehmmeyerdulheuer.de §§ § Rechtsanwälte
314 Astrid Elisabeth Stebich
10783
Berlin
Astrid Elisabeth Stebich Make up Artist Friseurmeisterin aus Berlin. Make up Haare
elice-beth.de
315 Home www.berlinevangelisch.de Gesellschaft für Unternehmenskommunikation mbH & Co. KG Abgeltungssteuer
10783
Berlin
www.berlinevangelisch.de ? Das ServicePortal der Evangelischen Kirche in Berlin.
berlin-evangelisch.de Abgeltungssteuer Advent Austritt Bach Berlin
316 Berlin Apartments Potsdamer Str Berlin
10783
Berlin
Apartments in Berlin nähe Potsdamer Platz für Gruppenreisen Gruppenunterkunft
berlin-aparts.de Berlin Apartments Berlin Gruppenreise
317 Bar Voyage barvoyages bar
10783
Berlin
Bar Café Kleinkunstbühne
barvoyage.de Bar Berlin Kleinkunst Berlin
318 Home ? Kunstsaele Berlin Kunstsaele
10783
Berlin
Die Kunstsaele Berlin verbinden Galerie Sammlung und Kulturprojekte an einem Ort. Neben den wechselnden
kunstsaele.de Kunstsaele Oehmen Bergmeier
319 WerbeartikelAgentur für Fahrradsattelbezüge
10783
Berlin
Kultkeks ist Ihr Partner für individuelle Werbemittel und Werbegeschenke. Unser Sortiment reicht von der Handysocke
kultkeks.de
320 TRIO PALMERA Salsa
10783
Berlin
Seit nunmehr 26 Jahren ist das TRIO PALMERA unterwegs um landesweit und über die Landesgrenzen
josefinol.de Salsa Cumbia Merengue
321 Home Labbow Personalleasing e.K.
10783
Berlin
Personalberatung und dienstleistungen
labbow-personalleasing.de
322 Marian Kiss Marian
10783
Berlin
Marian Kiss Film Berlin Filmemacherin Filmmaker Regiesseurin Director
mariankiss.de Marian Kiss Film
323 Marianne Rosenberg | RoseWeb Public Image GmbH Marianne
10783
Berlin
Die offizielle Website von Marianne Rosenberg mit aktuellen Infos SongDownloads Biografie Diskografie
rosenberg.de Marianne Rosenberg Pop
324 MännerMinne e.V. Erster schwuler choir
10783
Berlin
MännerMinne e.V. Erster schwuler Männerchor Berlin gegründet 1987 Mitglied im Berliner Sängerbund.
maennerminne.de Choir Chorus Gay
325 | MARTINA DOEHRING | c/o Formblitz AG Martina
10783
Berlin
Dies ist die offizielle Website der Sopranistin Martina Doehring
martinadoehring.de Martina Doehring Sängerin
326 EVA GmbH EVA GmbH
10783
Berlin
KFZ Reparatur oder Ausfuhrversicherung:sofort in unserem OnlineShop. Auch Gebrauchtwagengarantie und Finanzierung für Privatpersonen und Händler
eva-evb.de
327 Diversitygendertraining.de joomla
10783
Berlin
Joomla! dynamische PortalEngine und ContentManagementSystem
energydeal.de Joomla Joomla
328 :: Keding / ESS Keding / ESS Elektronische Sicherheitssysteme GmbH / Keding GmbH & Co. KG sicherheitssystem
10783
Berlin
ESS GMBH Planung Lieferung Montage Inbetriebnahme von elektronischen Signal und Anzeigeanlagen
ess-sicherheit.de Sicherheitssysteme Alarmanlagen Brandmeldetechnik Brandmelder Brandmeldeanl
329 Hauptstadtplan | interaktiver stadtplan Adler & Schmidt GmbH Bundeshauptstadt
10783
Berlin
Interaktiver häusergenauer Stadtplan der Berliner Innenstadt. Suchmöglichkeit nach den Kategorien Sehenswürdigkeiten Kultur Regierungsbauten
hauptstadtplan.de Bundeshauptstadt Berlin Hauptstadt Bundesregierung Reichstag
330 Home GmbH & Co. KG ML4
10783
Berlin
Personalleasing ML4 Personalmanagement GmbH Co.
ml4-dienstleistungen.de ML4 ML4Personalmanagement ML4
331 Keding GmbH Co.KG Integral
10783
Berlin
IntegralSecurity Integralsecurity Integral Security Integral Security Antennentechnik und Sicherheitstechnik Alarmanlagen Brandmeldeanlagen Einbruchmeldeanlagen Videoüberwachung und mehr)
keding.de Integral Security IntegralSecurity Integralsecutity Integral
332 Start Kauffeld und
10783
Berlin
Kauffeld und Jahn
kauffeldundjahn.de
333 Willkommen bei Pascha Grill joomla
10783
Berlin
Joomla! dynamische PortalEngine und ContentManagementSystem
pascha-grill.de Joomla Joomla
334 PartytechnikBerlin Verleih von Berlin
10783
Berlin
Partytechnik Berlin verleiht Lichttechnik und Tontechnik für Eure Party/Veranstaltung
partytechnik-verleih-berlin.de Berlin Partytechnik Verleih Party Verleih
335 Home
10783
Berlin
Tierärzte Tierarztpraxis Marianne Gass
petstation.de
336 Willkommen bei perko profundus! Perko
10783
Berlin
perko profundus
perko-profundus.de Perko Gudrun Profundus Wissenschaftscoach Education
337 Ludger Jungnitz Men's Maenner
10783
Berlin
Ludger Jungnitz Men's Care Men's Studies
mensstudies.de Maenner Lebensqualitaet Gesundheit
338 Berlin Apartments Potsdamer Str Berlin
10783
Berlin
Apartments in Berlin nähe Potsdamer Platz für Gruppenreisen Gruppenunterkunft
cityapartsberlin.de Berlin Apartments Berlin Gruppenreise
339 HumanistischSystemische Beratung Frank systemisch
10783
Berlin
Erkennen und Auflösen von Verstrickungen Familienstellen Psychodrama Gestaltherapie Trauma
frankstamer.de Systemisch Familienstellen Aufstellung
340 Flowers of life Flowers
10783
Berlin
Flowers of life richtet sich an alle Menschen die Begleitung Gesellschaft oder eine persönliche
flowers-of-life.de Flowers Of Life Brigitte
341 INTEGRAL SECURITY Sicherheitstechnik Keding GmbH & Co. KG IntegralSecurity
10783
Berlin
Sicherheitstechnik von Integral Security dem deutschlandweiten Firmenverbund für Sicherheitstechnik (Alarmanlagen Brandmeldeanlagen Einbruchmeldeanlagen
integralsecurity.de IntegralSecurity Sicherheitstechnik Integral
342 IJam.de ? mediendesign Webdesign
10783
Berlin
10 Schritte zur eigenen Website | iJam.de Mediendesign
ijam.de Webdesign Mediendesign Homepage
343 Startseite » Gesine Palmer » Herzlich Willkommen auf Gesine
10783
Berlin
Dr. Gesine Palmer leitet das Berliner Büro für besondere Texte. Die Religionsphilosophin bietet Kommunikationsberatung und
gesine-palmer.de Gesine Palmer Redenschreiben
344 Politikmanagement mit Gitta Stieber Politikmanagement
10783
BERLIN
Gitta Stieber Berlin Politikmanagement Qualifizierung und Weiterbildung die Sie in sozialen
gittastieber.de Politikmanagement Kommunikation SoftSkills
345 Gift Music Gift Music GmbH Weltmusik
10783
Berlin
Ein kleines Weltmusiklabel aus Berlin
giftmusic.de Weltmusik Label Berlin
346 GEAG Immobilienverwaltung Berlin:Wir verwalten GEAG Immobilienverwaltungs GmbH Wirtschaft
10783
Berlin
GEAG Immobilienverwaltungs GmbH: kompetente Verwaltung und Betreuung von Immobilien in Berlin Brandenburg Sachsen
geag-berlin.de Wirtschaft Immobilien Immobilienverwaltung
347 Business Development Germany German
10783
Berlin
We bring your business on the German market ? contact us today!
business-development-germany.de German Companies German Marketing
348 Moritz Tilman Achelis | rechtsanwalt
10783
Berlin
Rechtsanwalt Arbeitsrecht Achelis Baurecht Architektenrecht Grundstücksrecht Wohnungseigentumsrecht Medizinrecht
ra-achelis.de Rechtsanwalt Arbeitsrecht Achelis
349 RDM: Startseite Landesverband Berlin und Brandenburg e.V. rdm
10783
Berlin
RDM Ring Deutscher Makler Landesverband Berlin und Brandenburg e.V.
rdm-berlin-brandenburg.de Rdm Ring Deutscher
350 Startseite Willkommen
10783
Berlin
Willkommen:  
hd-computer24.de
351 Rita Leinenweber · Astrologie Astrologie
10783
Berlin
Ich freue mich Ihnen meine Kenntnisse in Astrologie Massage energetischen Heilweisen
ritaleinenweber.de Astrologie Horoskop Geburtshoroskop
352 GEAG Immobilienverwaltung Berlin:Wir verwalten GEAG Immobilienverwaltungs GmbH Wirtschaft
10783
Berlin
GEAG Immobilienverwaltungs GmbH: kompetente Verwaltung und Betreuung von Immobilien in Berlin Brandenburg Sachsen
sabinespehr.de Wirtschaft Immobilien Immobilienverwaltung
353 Rundum Ich Ihr massage
10783
Berlin
Massage Ernährungsberatung Fitness und Personal Training Hypnosetherapie in Berlin für Privatkunden
rundum-ich.de Massage Ernährung Hypnose
354 Astrologische Gesundheits und Lebensberatung Astrologie
10783
Berlin
Astrologische Gesundheits und Lebensberatung Yvonne v. Bechtolsheim: Astrologie Reiki Ernährungsberatung und Radionik in
schwarzer-second-hand-shop.de Astrologie Reiki Ernährungsberatung
355 Roger Thilo EDV Service Roger
10783
Berlin
Wir bieten ITLösungen im Businessbereich für alle Branchen und Unternehmensgrößen. innovativ zuverlässig
rthilo.de Roger Thilo EDV Service
356 PROBase easy PROFORMA GmbH & Co. KG CMS
10783
Berlin
Mit PROBase easy erstellen wir individuell hochwertige Webauftritte Sie brauchen nur noch die Texte
pro-base-easy.de CMS ContendManagemnetSystem Contend
357 Sm hope ick Kindermode
10783
berlin
Die Teilnahme am Wettbewerb ?Meine Heimat? auf der Kreativplattform Dawanda.de war Anlass Designs zu
smhope.de Kindermode
358 LOOK22 Home LOOK22 LOOK22
10783
Berlin
LOOK22 MediaService ~ zielgruppenoptimiertes Webdesign ~ aussagekräftige Fotografie ~ perfekte Grafik ~ treffsichere Texte ~
look22.de LOOK22 MediaService Internet Fotografie Grafik
359 Raumdesignerin .Silke Smida. kunst
10783
Berlin
Art by Silke Smida composed drawings find new places!
raumdesignerin.de Kunst Design Graffiti Wandtattoos Acryl
360 BEGINE Treffpunkt und Frauen
10783
Berlin
Interkulturelles Frauenkulturzentrum Künstlerinnenförderung Konzerte Ausstellungen Potsdamer Str. 139 BerlinSchöneberg
begine.de Frauen Lesben Frauencafé
361 Complett Räumung | Wohnungsauflösung wohnungsauflösung
10783
Berlin
Wohnungsauflösung Berlin günstig und schnell von Complett Räumung 030 261 01 714
complett-berlin.de Wohnungsauflösung Berlin Wohnungsauflösungen Entrümpelung Entrümpelungen
362 Contravision breaking news contra medienwerkstatt e.v. ContraVision
10783
berlin
short film festival in berlin germany march 20th to march 28th
contravision.de ContraVision Cinema Contra
363 Doktus.de Dokumente uploaden FORMBLITZ AG doktus
10783
Berlin
Hier findet man Dokumente zu allen Themen und kann Dokumente suchen verwalten
doktus.de Doktus
364 | MARTINA DOEHRING | c/o Formblitz AG Martina
10783
Berlin
Dies ist die offizielle Website der Sopranistin Martina Doehring
martina-doehring.de Martina Doehring Sängerin
365 Wolfgang Kommerell | kommerell.de Wolfgang
10783
Berlin
Website von Wolfgang Kommerell: Segeln Fotografie.
kommerell.de Wolfgang Kommerell Fotografie
366 Marianne Rosenberg | RoseWeb Public Image GmbH Marianne
10783
Berlin
Die offizielle Website von Marianne Rosenberg mit aktuellen Infos SongDownloads Biografie Diskografie
roseclub.de Marianne Rosenberg Pop
367 Linux auf CD/DVDR linux
10783
Berlin
LinuxDistributionen auf CDR und DVDR tuxpost.de Shop
tuxpost.de Linux Iso Shop
368 Home Texts and Birgit
10783
Berlin
Dr. Birgit Hollenbach brings language and science together. Her university studies of translation and biochemistry
textsandtranslations.de Birgit Hollenbach Translation
369 .:|Stadtrundfahrten|Originelle Alternative Stadtrundfahrt|Berliner Dialekt Berlin
10783
Berlin
| BerlinerSchnauze Stadtrundfahrten | Alternative Stadtrundfahrt im Berliner Dialekt | Mundart sehr Orginelles Geschenk
berliner-schnauze.de Berlin Stadtrundfahrt Stadtrundfahrten Information Private
370 Übersetzer Deutsch Rumänisch Rumänisch
10783
Berlin
Übersetzungen Deutsch Rumänisch Dolmetscher für Rumänisch in Berlin profesionelle Übersetzung kundenorientiert
turbatu-translations.de Rumänisch Übersetzer Deutsch Rumänisch
371 Home / tausendschwarz.de Angebot
10783
Berlin
HomepageTitel Berlin
tausendschwarz.de Angebot Kompetenz Beratung
372 Subversionen.de | praeludium
10783
Berlin
??? Beuys + Agnoli
subversionen.de
373 Betreutes Wohnen in Demenz betreutes
10783
Berlin
Der FAW e.V. begleitet und verwaltet ambulant betreute Wohngemeinschaften für Menschen mit Demenz.
verein-faw.de Betreutes Wohnen Demenz Wg
374 TRIO PALMERA Salsa
10783
Berlin
Seit nunmehr 26 Jahren ist das TRIO PALMERA unterwegs um landesweit und über die Landesgrenzen
trio-palmera.de Salsa Cumbia Merengue
375 Astrologische Gesundheits und Lebensberatung Astrologie
10783
Berlin
Astrologische Gesundheits und Lebensberatung Yvonne v. Bechtolsheim: Astrologie Reiki Ernährungsberatung und Radionik in
sternen-klar.de Astrologie Reiki Ernährungsberatung
376 Italienische Weine Online Weine
10783
Berlin
Vinila Weine aus Italien. Wer via eCommerce in Deutschland die besten italienischen Weine online
vinila.de Weine Wein Aus Italien
377 NAS Planung Baumanagement Nas Planung & Baumanagement GmbH & Co. KG Berlin
10783
Berlin
NAS Planung Baumanagement GmbH Co. KG Telefon +49 (0)30. 216 95 45
xn--nas-planungsbro-cwb.de Berlin Ahmet Nas
378 AllmendeKontor Gemeinschaftsgarten Allmende-Kontor e.V.
10783
Berlin
Allmende = Gemeingut = Commons: Berliner AllmendeKontor Gemeinschaftsgarten und eine der größten Hochbeetanlagen der
allmende-kontor.de
379 Beste Hunde: OnlineMagazin für
10783
Berlin
Das Online Hundemagazin mit aktuellen Artikeln zu Gesundheit Ernährung Erziehung und Verhalten
bestehunde.de
380 Berliner Schlagerfest 2012 berliner
10783
Berlin
Das Berliner Schlagerfest geht in die 2. Runde.
berliner-schlagerfest.de Berliner Schlagerfest 2012 Schlagerfest Berlinmitte
381 Birgit Schlieps Birgit
10783
Berlin
Urban Sculpture. Die Künstlerin Birgit Schlieps arbeitet mit dem urbanen Raum als Phantom Mythos
birgitschlieps.de Birgit Schlieps Kunst
382 Startseite Willkommen
10783
Berlin
Willkommen:  
ep-store.de
383 Business Development Germany German
10783
Berlin
We are the leading German Marketing Company bringing your business on the German market. Our
cockpit-germany.de German Companies German Marketing
384 Coworkingberlinsquarehaus.de coworkingberlinsquarehaus Webseite! Square Haus am Nollendorfplatz GmbH
10783
Berlin
SquareHaus work meet share collaborate coworking büros konferenzraum
coworking-berlin-squarehaus.de
385 Business Development Germany German
10783
Berlin
We are the leading German Marketing Company bringing your business on the German market. Our
dashboard-germany.de German Companies German Marketing
386 Herzlich Willkommen Willkommen Forner + Forner GbR
10783
Berlin
Als kreatives und innovatives Unternehmen für Beratung und Kommunikation möchten wir Sie als vertrauensvoller Partner
ff-beratung.de
387 Home SchwarzweißFotogr
10783
Berlin
Neue Wege Neue Sichten Neue Fotografien Du möchtest besser wahrnehmen und kreativ sein
fotografisch-sehen-lernen.de SchwarzweißFotografie Konzeptfotografie Fotografisch
388 Fotostudio Altman. Hochzeit Wettbewerb Studioalex.de
10783
Berlin
Suchen Sie einen professionellen Fotografen mit über 25 Jahre Erfahrung in der Fotografie? Dann sind
fotostudioalex.de Studioalex.de Hochzeit Wettbewerb Meine Traumhochzeit!
389 DIF | Dit is mirapodo ? operated by myToys.de GmbH
10783
Berlin
DAS Berliner Modeblog zu Fashiontrends und Modesünden Parties und Veranstaltern Designern und Kollektionen
dit-is-fashion.de
390 Heilpraxis Susanne Weis Heilpraxis
10783
Berlin
Heilpraxis Susanne Weis
heilpraxisweis.de Heilpraxis KLANGTHERAPIE HOMÖOSYNERGETIK AUSLEITUNG ERNÄRUNG
391 BAKUNAPOLI BakuNapoli
10783
Berlin
BAKUNAPOLI.Aserbaidschanische und italienische Küche.
baku-napoli.de BakuNapoli Restaurant Berlin Aserbaidschanische Küche
392 Kristina Jacoby Startseite Ghostwriter
10783
Berlin
Kristina Jacoby unterstützt Autoren bei der Erstellung ihrer Bücher
kristinajacoby.de Ghostwriter Ghostwriting Wissenschaftliches
393 Startseite Klinisches Krebsregister Klinisches Krebsregister für Brandenburg und Berlin gGmbH Klinisches
10783
Berlin
Informationen zur klinischen Krebsregistrierung in Brandenburg
kkrbb.de Klinisches Krebsregister Brandenburg
394 Kniggeinberlin.de Willkommen bei Knigge
10783
Berlin
Gesellschaftlicher Schliff selbstsicheres und stilvolles Auftreten ist heute wichtiger denn je. Jeder kann Benehmen
knigge-in-berlin.de Knigge Seminare KniggeSeminare Benehmen Benimmkurse
395 PROJECT318 photography
10783
Berlin
Homepage für die Vernissage / Ausstellung PROJECT318 der SRH Hochschule der populären Künste (hdpk).
project318.de Photography Design Motion
396 Ludger Jungnitz Prozessbegleitung Prozessbegleitung
10783
Berlin
Prozessbegleitung Berlin Ludger Jungnitz
prozessbegleitung-berlin.de Prozessbegleitung Coaching Projekte
397 SPAM Magazin SPAM
10783
Berlin
SPAM Magazin Ausgabe 01
spam-music.de SPAM; Magazin Musik
398 Text Julia Richter
10783
Berlin
Erstklassige Unternehmenskommunikation Texte und Konzepte in Berlin
text-juliarichter.de
399 ReBuy der einfache An reBuy reCommerce GmbH gebraucht
10783
Berlin
An und Verkauf für gebrauchte Handys Tablets Videopiele Filme CDs
rebuy.de Gebraucht Kaufen Gebraucht Verkaufen
400 Pasta e Più Startseite Frische
10783
Berlin
Frische Pasta in Berlin
pasta-e-piu.de Frische Pasta Berlin Raviolli Ghnochi
401 Aktuelles Bürgerinitiative
10783
Berlin
Stadtplanung von unten Stadtentwicklung TempelhofSchoeneberg Berlin
stadtplanung-von-unten.de Bürgerinitiative Bürgerbegehren Bürgerentscheid Anwohnerversammlung Gleisdr
402 Taxi Bildungscenter Berlin Treffpunkt Bildung GmbH Taxischein
10783
Berlin
Wir schulen seit 18 Jahren erfolgreich auf die Ortskundeprüfung mit eigenem ständig aktuellem
taxi-bildungscenter.de Taxischein PSchein Taxifahrer Fahrgastbeförderung Ortskundeprüfung
403 Studio NiMa Produktion Mode Kauffeld und Jahn GbR
10783
Berlin
Vom Entwurf bis zur Produktion. Mode und Textil. Studio NiMa ist in der Bekleidungsindustrie
studionima.de
404 Schuhe Online Shop myToys, mirapodo und ambellis - Shops der myToys.de GmbH
10783
Berlin
Schöner Schuhe shoppen ? riesige Auswahl für Damenschuhe ? Herrenschuhe ? und Kinderschuhe ? Bestellen
mirapodo.de
405 Yoga in Kreuzberg Yoga
10783
Berlin
Yoga in Berlin an Ihrem Arbeitsplatz oder besuchen Sie YogaKurse in Berlin Kreuzberg mit
yoga-und-massage.de Yoga Am Arbeitsplatz Yoga
406 MyToys | Alles für myToys, mirapodo und ambellis - Shops der myToys.de GmbH
10783
Berlin
myToys Ihr OnlineShop für Spielzeug Kindermode Babyausstattung und vieles mehr. Über 100.000
mytoys.de
407 Werbung auf dem Sattelschoner|
10783
Berlin
Sattelschützer als Werbemittel: Bedrucken Sie Sattelbezüge mit Ihrem Logo. Individuelle Gestaltungsmöglichkeiten Lieferung nach drei
kultsattel.de
408 Finest Whisky Shop Whisky
10781
Berlin
Unsere Philosophie ist es hochwertige seltene und alte Flaschen der verschiedensten Destillen und Abfüller
finestwhisky.de Whisky Verkauf Berlin
409 Black meadow music production Martin Klein und Christian Kociolek GbR
10781
Berlin
black meadow music production is a label situated in Berlin.
black-meadow.de
410 Immocollect.de by Portal Financecollect Immocollect.de by Portal Financecollect GmbH Immocollect.de
10781
Berlin
Immobilienangebote von Immocollect.de by Portal Financecollect GmbH
immocollect.de Immocollect.de By Portal Financecollect GmbH
411 Simply : pr + simply
10781
Berlin
simply : die PR und Marketing Agentur für erklärungsbedürftige Produkte! fon +49 (0) 30. 21
agentur-simply.de Simply Public Relation
412 Ashtanga Yoga Schule Berlin Ashtanga
10781
Berlin
Ashtanga Yoga Schule in Berlin Schöneberg am Winterfeldtplatz Pallasstr. 89 10781 Berlin
ashtangayogaschoeneberg.de Ashtanga Yoga Berlin Schöneberg
413 Rosenscharf und Edelsüß Catering ZOE
10781
Berlin
Restaurant ZOE Berlin. Asiatische und mediterrane Küche zwischen Hackeschem Markt und Alexanderplatz in Berlin Mitte.
aromamanufaktur.de ZOE Restaurant Lounge
414 Online Marketing: Wissen
10781
Berlin
Endlich von Online Marketing profitieren. Portal Ratgeber für erfolgreiches Internetmarketing mit Grundlagen Tipps
omkt.de
415 :: NATURKOSMETIK CALLA
10781
Berlin
Fachgeschäft für Naturkosmetik und Naturwaren. Kosmetische Behandlungen nach Dr. Hauschka und M.Gebhardt.
calla-naturkosmetik.de
416 Architektur Planung Beratung
10781
berlin
Architekten Hannover Berlin Architekturplanung Bauberatung Projektentwicklung Wertermittlung Architektur architectura nova
chocmoc.de
417 ChristianErdmann.de Christian
10781
Berlin
Willkommen auf der privaten Site von Christian Erdmann. Erfahren Sie mehr über meine Dozententäigkeit und
christian-erdmann.de Christian Erdmann Dozent Verwaltungsrecht Doppik.kom.bb
418 Christine Ordnung | Home xxxxx
10781
Berlin
xxxxx
christine-ordnung.de Xxxxx
419 CORINO 4 MEN CorinoArt
10781
Berlin
Photographer for beauty nude art fashion faces lingerie interieur
corino4men.de CorinoArt Photography Fotografie
420 Claudia Scholl Aktuelle Claudia
10781
Berlin
Claudia Scholl Buchkonzeption Gestalterische Konzepte Kinderkunstprojekte Illustration und Corporate Design
claudia-scholl.de Claudia Scholl Berlin Kartonzauber Grafikdesign
421 URBANIS Startseite URBANIS GmbH URBANIS
10781
Berlin
Herzlich willkommen bei der URBANIS GmbH
bvg-holding.de URBANIS Berlin Unternehmen
422 Home Chatwins Chatwin
10781
Berlin
CHATWINS: Bücher rund ums Reisen gibt es hier nach Ländern und Kontinenten sortiert. Reisen heißt:
chatwins.de Chatwin Chatwins Bruce Chatwin A
423 52. DeutschFranzösisches Volksfest Schaustellerverband Berlin e.V. Deutsch
10781
Berlin
Das mit Abstand größte jährliche Volksfest in Berlin Willkommen auf über 40.000m² Erlebnisfläche!
deutsch-franzoesisches-volksfest.de Deutsch Französisches Volksfest Laune
424 Beateberlin AGENTUR FÜR EVENTS beateberlin
10781
Berlin
beateberlin Agentur für Events und Stadterlebnisse in Berlin und Umgebung
beateberlin.de Beateberlin Agentur Agency
425 Berliner Berufsverband der Gesundheitsaufseher/Hygieneinspektoren BBGH
10781
Berlin
Der Berliner Berufsverband der Gesundheitsaufseher/Hygieneinspektoren stellt sich vor und bietet Informationsmaterial rund um den öffentlichen
bbghev.de BBGH BVH Hygiene
426 Organisationsberater Berater für Bio
10781
Berlin
Unternehmensberater für Ökologische Landwirtschaft (Biolandbau) und Biomarkt (Biohandel) ? Experte für Bio Lebensmittel und Biolandbau
bio-projektmanagement.de Bio Lebensmittel Bioprodukte
427 BeGreen Netzwerk für nachhaltiges beGreen Netzwerk für nachhaltiges Wirtschaften e.V. Verein
10781
Berlin
Alles Wissenswerte von der Historie über Ergebnisse Veranstaltungen und neueste Trends bis hin zur
begreen-net.de Verein Mitgliedschaft Beitrittserklärung
428 IOB Internationale OmnibusBetreibergesellschaft ZOB
10781
Berlin
ZOB Zentraler Omnibusbahnhof Berlin an Funkturm und Messegelände:
berlinzob.de ZOB Zentraler Omnibusbahnhof Berlin APC
429 Blauwerke verlag # groschenhefte blauwerke
10781
Berlin
Verlag aus Berlin fuer konkrete Literatur und konkrete Wissenschaft. Gebrauchstexte für die Westentasche.
blauwerke-berlin.de Blauwerke Blauwerke Berlin
430 Werbe und Vertriebsmangement GSW
10781
Berlin
Die “ FIGARO news” sind das GSW Club Magazin für die Mieter der GSW Immobilien
effektivwerbung24.de GSW Club Figaro News
431 Elena nehrmann promotion
10781
Berlin
Kultur Kommunikation
elenanehrmann.de Promotion P.r. Pr
432 MACKE Boutique Berlin
10781
Berlin
Mode ist Kultur Entsprechend diesem Motto bieten wir Ihnen stil und anspruchsvolle Mode und
macke-berlin.de
433 DigitalphotoBerlin Foto
10781
Berlin
Phototechnik Fehling Fotografie Bearbeitung Entwicklung Vergrößerung von Diabildern Digitalfotografien
digitalphoto-berlin.de Foto Fotografie Photo
434 Diethard Küster Regisseur
10781
Berlin
Diethard K¸ster Regisseur Produzent Autor Regie Produktion
diethard-kuester.de
435 HOME MEDIATION
10781
Berlin
ALEXANDER STAUBACH | MEDIATION | STAUBACHBERATUNG
staubach-beratung.de MEDIATION | KONFLIKT | KONFLIKTKLÄRUNG
436 BEOBOOKS Bücher aus Bücher
10781
Berlin
BEOBOOKS Bücher aus Serbien Katarina Belovukovic
beo-books.de Bücher Serbien
437 Bettina Willumeit | Styling bettina
10781
Berlin
innovatives kundenorientiertes Fashion Styling für die Bereiche Werbung Editorialproduktionen und Onlinevermarktung
bettina-willumeit.de Bettina Willumeit Stylistin
438 HOME
10781
Berlin
HOME
kunsttherapieraum.de
439 Joomla Toplist Hauptseite joomla
10781
Berlin
Dies ist die deutsche JoomlaTopseitenliste. Hier finden Sie die wahrscheinlich besten Seiten die mit
joomla-toplist.de Joomla Toplist Best
440 Jugendhilftweiter.de Jugend
10781
Berlin
Modellprojekt Jugendräte: Eine Homepage von den Jugendräten des Modellprojekts Jugendräte von Berlin SchönebergNord
jugend-hilft-weiter.de Jugend Hilft Weiter
441 LumpenPrinzessin ... Kinderkleidung Kinderkleidung
10781
Berlin
Die LumpenPrinzessin bietet seit über 15 Jahren Alles für Baby und Kind in gut erhaltener
lumpenprinzessin.de Kinderkleidung Kindermode Kinderschuhe
442 Herzlich Willkommen auf LittleThailand.de thai
10781
Berlin
Die neuesten und beliebtesten ThaiMassagen ThaiRestaurants Shops und mehr Mit vielen Bewertungen
little-thailand.de Thai Verzeichnis übersetzer Shops Restaurants
443 Evelyn Bornemann Berlin Berlin
10781
Berlin
Evelyn Bornemann in Berlin Physiotherapie Psychotherapie (HPG) Coach nach der TippingMethode hilft
evelyn-bornemann.de Berlin Physiotherapie Psychotherapie
444 ||| EuroKaukAsia     EuroKaukAsia e.V.
10781
Berlin
KaukasischEuropäischer Kultur und Wissenschaftsverin e.V.
eurokaukasia.de
445 Excelle.consulting | Produktions und excelle.consultin
10781
Berlin
excelle.consulting bietet kundenindividuelle Lösungen zu Fragen der strategischen Unternehmensentwicklung und der Gestaltung operativer Leistungsstrukturen sowie
excelle-consulting.de Excelle.consulting Excelle Excelle.de
446 F/21 Büro für Nora
10781
Berlin
f/21 Büro für Zukunftsfragen ist Beratungsinstitut und Denkfabrik. f/21 beobachtet die Gegenwart identifiziert
f-21.de Nora Stampfl Nora S. Stampfl
447 MEHR ALS STERNE |
10781
Berlin
Natalia Domagala
mehr-als-sterne.de
448 Investieren wie die Superreichen Investieren
10781
Berlin
Wie auch Sie schnell und einfach die Investments der Superreichen finden die nur ein
superreichtum.de Investieren Geld Anlegen
449 Mediation in Diversity Mediation
10781
Berlin
Mediation in Konfliktfällen Preisgünstige Mediationsausbildung nach anerkannten Standards von Bundesverbänden oder erfahrene Mediatoren? Kontaktieren
meddiv.de Mediation Berlin Mediationsausbildung Berlin
450 Jura Service Berlin | kaffeevollautomat
10781
Berlin
Jura Service Berlin| Kaffeemaschine u. Kaffeeautomat ReparturWartung u. Kundendienst in Berlin.Reparaturen von Kaffeemaschinen u.
jura-service-berlin.de Kaffeevollautomaten Reparatur Jura Service Kaffeemaschinen
451 Kanzlei Klaus Koblitzek homepage
10781
Berlin
homepage dokument webpage page web netz
kanzlei-koblitzek.de Homepage Dokument Webpage Page Web
452 Kanzlei Rechtsanwalt Böcker joomla
10781
Berlin
Joomla! dynamische PortalEngine und ContentManagementSystem
kanzleiboecker.de Joomla Joomla
453 Rechtsanwaltskanzlei und Notariat Michael Rechtsanwalt
10781
Berlin
Rechtsanwaltskanzlei und Notariat Michael Müller Rechtsanwalt und Notar Michael Müller in Berlin Schöneberg berät
kanzlei-mmueller.de Rechtsanwalt Notar Berlin
454 Schauspieler Coaching Berlin Karin
10781
Berlin
Mit dem KarriereTraining für Schauspieler durchstarten und dranbleiben. Die eigene Karriere lustvoll und aktiv gestalten.
karin-kleibel.de Karin Kleibel PR
455 LumpenPrinzessin ... Kinderkleidung Kinderkleidung
10781
Berlin
Die LumpenPrinzessin bietet seit über 15 Jahren Alles für Baby und Kind in gut erhaltener
kind-in-berlin.de Kinderkleidung Kindermode Kinderschuhe
456 Claudia Scholl Aktuelle Claudia
10781
Berlin
Claudia Scholl Buchkonzeption Gestalterische Konzepte Kinderkunstprojekte Illustration und Corporate Design
kartonzauber.de Claudia Scholl Berlin Kartonzauber Grafikdesign
457 Krups | Siemens | aeg
10781
Berlin
Krups | Siemens | AEG | ReparaturServiceWartung und Kundendienst in Berlin.Kaffeemaschinen und Kaffeevollautomaten
kaffeemaschine-reparatur.de Aeg Krups Siemens Kaffeevollautomaten Kaffeemaschinen
458 Home
10781
Berlin
Elzers Seiten zum Wohnungseigentumsrecht
oliverelzer.de
459 Patwork
10781
Berlin
Feinmechanik
pat-work.de
460 Peter Bruns Homepage Peter
10781
Berlin
Homepage von Peter Bruns
peterbruns.de Peter Bruns Cello
461 Rechtsanwälte PfaffHofmann u. Lee Rechtsanwalt
10781
Berlin
Die Rechtsanwaltskanzlei PfaffHofmann u. Lee legal Rechtsanwaltsgesellschaft bietet eine und zielorientierte Beratung. Schwerpunkt Wirtschaftsrecht z.B.
phl-legal.de Rechtsanwalt Rechtsanwaltskanzlei Arbeitsrecht
462 ..::Phoenix Lounge::.. Phoenix
10781
Berlin
Phoenix Lounge. Bar Restaurant Cafe in Schöneberg.
phoenix-lounge.de Phoenix Lounge Phoenix
463 Physimetron Elektronische Messtechnik Transimpedanzvers
10781
Berlin
Rauscharme analoge und digitale elektronische Messtechnik
physimetron.de Transimpedanzverstärker Pikoamperemeter Vorverstärker
464 Mobilienberlin.de living
10781
Berlin
mobilien: die schönen dinge zum leben wohnen und arbeiten! besuchen sie uns in berlinschöneberg...
mobilien-berlin.de Living Wohnen Wohnaccessoires
465 Otto Events Veranstaltungstechnik veranstaltungstec
10781
Berlin
Otto Events organisiert Ihre Veranstaltung in Berlin Brandenburg und Potsdam. Wir vermieten Veranstaltungstechnik
ottoevents.de Veranstaltungstechnik Berlin Potsdam
466 Naturheilpraxis im Hofbogen behandlung
10781
Berlin
Naturheilkunde Praxis Hofbogen Heilung Anwendung Rheuma Therapie Heilpraktiker
heilpraktikerin-schoeneberg.de Behandlung Therapie Körper
467 HALBE STUNDEN // HALF Kurzfilm
10781
Berlin
Film
halbestunden.de Kurzfilm Leere Familie
468 Flamencomeetsclassic flamenco
10781
Berlin
flamencomeetsclassic ist ein Tanztheater aus Berlin das klassische Texte Flamencomusik und Tanz zu
flamenco-meets-classic.de Flamenco Tanz Tanztheater
469 Flats Co. Flats & Co. GmbH Waldmannstr.
10781
Berlin
Eigentumswohnungen Waldmannstr. 3 BerlinLankwitz
flatsandco.de Waldmannstr. 3
470 Praxis für integrale Medizin Integral
10781
Berlin
Arztpraxis Dr. Martin Bosch BerlinSchöneberg
integralmedicine.de Integral Medicine Arztpraxis
471 Startseite
10781
Berlin
Anwälte Steuerberater PSInkasso
inkasso-in-berlin.de
472 Gerd Brendel | Journalist Gerd
10781
Berlin
Gerd Brendel Journalist
gerdbrendel.de Gerd Brendel Journalist
473 Autorin Martina Gneist CBT
10781
Berlin
Autorin Martina Gneist Projekte und Philosophie
gn-konzepte.de CBT WBT Lernkonzepte
474 Startseite hanslux Open
10781
Berlin
Beratung und Dienstleistungen für Computer Netze und ITSicherheit unter Verwendung von OpenSource Produkten
hanslux.de Open Source Freie Software
475 Theater Hans Wurst Nachfahren Grüffelo
10781
Berlin
Hans Wurst Nachfahren Theater für Kinder und Erwachsene in BerlinSchöneberg zeigt Spielplan
hasn-wurst-nachfahren.de Grüffelo Puppentheater Berlin
476 Organisationsberater Berater für Bio
10781
Berlin
Unternehmensberater für Ökologische Landwirtschaft (Biolandbau) und Biomarkt (Biohandel) ? Experte für Bio Lebensmittel und Biolandbau
handel-und-wandel.de Bio Lebensmittel Bioprodukte
477 Fachanwalt für Arbeitsrecht Berlin Fachanwalt
10781
Berlin
Fachanwalt für Arbeitsrecht Erbrecht und Versicherungsrecht in Berlin sowie Notar Berlin. Kanzlei Gäbelein
gaebelein-veith.de Fachanwalt Arbeitsrecht Versicherungsrecht
478 DFRV Regionalgruppe Berlin
10781
Berlin
| Website der Regionalgruppe Berlin des Deutschen Fundraising Verbands
fundraisingverband-berlin.de
479 Fußballwörterbuch in 7 Sprachen
10781
Berlin
FußballWörterbuch in 7 Sprachen: Homepage des Buches von Kaya Yildirim
fussballwoerterbuch.de
480 Felicitas Jacobs Theaterpädagogin Theater
10781
Berlin
Ich biete vielfältige theaterpädagogische Qualifikationen als Ausbildung oder Fortbildung initiiere theatrale Prozesse und entwickle
felicitasjacobs.de Theater Pädagogik Spiel
481 Organisationsberater Berater für Bio
10781
Berlin
Unternehmensberater für Ökologische Landwirtschaft (Biolandbau) und Biomarkt (Biohandel) ? Experte für Bio Lebensmittel und Biolandbau
conradthimm.de Bio Lebensmittel Bioprodukte
482 Startseite constant balance Fußpflege
10781
Berlin
Heilsame Behandlungen für Körper Geist und Seele Fußpflege Massagen und Heilarbeit
constant-balance.de Fußpflege Wellness Entspannung
483 Organisationsberater Berater für Bio
10781
Berlin
Unternehmensberater für Ökologische Landwirtschaft (Biolandbau) und Biomarkt (Biohandel) ? Experte für Bio Lebensmittel und Biolandbau
consultantfororganictrade.de Bio Lebensmittel Bioprodukte
484 Querschnitt Weine
10781
Berlin
Querschnitt Weine Weinhandlung in BerlinSchöneberg
querschnitt-weine.de
485 Startseite
10781
Berlin
Rechtsanwältin Sylvia PfaffHofmann: Ihr Recht in guten Händen! Spezialgebiete: Europarecht Einbuergerungsrecht und Asylverfahrensrecht
rechtsanwaeltinpfaff-hofmann.de
486 Praya ThaiMassage Startseite Massage
10781
Berlin
Praya ThaiMassage Ihre Praxis in Berlin bietet professionelle Physiotherapie und Massagen als therapeutisches
prayathai.de Massage Praxis
487 Startseite
10781
Berlin
Anwälte Steuerberater PSInkasso
ps-inkasso-berlin.de
488 Kanzlei Rechtsanwalt Böcker joomla
10781
Berlin
Joomla! dynamische PortalEngine und ContentManagementSystem
rechtsanwaltskanzlei-24.de Joomla Joomla
489 Fachanwalt Strafrecht Rechtsanwalt Fachanwalt
10781
Berlin
Fachanwalt Strafrecht Rechtsanwalt Feldkamp Berlin
rechtsanwaltskanzlei24.de Fachanwalt Strafrecht Rechtsanwalt
490 Reinigung360.de | Professionelle Gebäudereinigung Reinigung
10781
Berlin
Gebäudereinigung Büroreinigung Bauendreinigung Glassreinigung Laborreinigung Praxisreinigung Spezialreinigung Teppichreinigung
reinigung360grad.de Reinigung Reinigung Berlin
491 REISEDIENST WITTER: Tolle Reisen. Witter
10781
Berlin
REISEDIENST WITTER: Tolle Reisen. Viel Vergnügen!
reisedienst-witter.de Witter Reisedienst REISEDIENST
492 Schiek Sports Germany Bodybuilding Schiek
10781
Berlin
Offizieller Distributor Schiek Sports in Deutschland erhältlich Schiek Sports Schiek Sport Handschuhe
schiek-store.de Schiek Sport Handschuhe
493 Schiek Sports Germany offizieller Schiek
10781
Berlin
Offizieller Distributor von Schiek Produkten in Deutschland Fitness Bodybuilding Zubehör Fitnesshandschuhe Zughilfen Handgelenkschutz Bandagen
schiek-germany.de Schiek Fitnesshandschuhe Trainingsgürtel
494 HOME
10781
Berlin
Schulshirt Schulkleidung Schuluniform TShirts PoloShirts Sweatshirts Kapuzenshirts Kleidung Uniform Schule Freizeit Caps
scoolchic.de
495 Senioren Beratung Berlin Seniorenberatung
10781
Berlin
Seniorenberatung Berlin
senioren-beratung-berlin.de Seniorenberatung Pflegeheimberatung Neue
496 Datenschutzanalyse externer Datenschutzbeauftragter PrivCom Datenschutz GmbH Datenschutz
10781
Berlin
Wir organisieren als externe Datenschutzbeauftragte mit DatenschutzAudits Schulungen und Sicherheitstests datenschutzkonforme und sichere Prozesse.
privcom.de Datenschutz Audits Datensicherheit
497 PROMINENTENBAU© Prominentenbau
10781
Berlin
Erwachsene bauen mit LEGO Elementen für Kinder
prominenten-bau.de Prominentenbau Prominent DAI Lego Hellweg
498 PME PME
10781
Berlin
PME ProBau Management und Entwicklungsgesellschaft mbH
pme-gmbh.de PME ProBau Management Entwicklungsgesellschaft
499 Startseite
10781
Berlin
Rechtsanwältin Sylvia PfaffHofmann: Ihr Recht in guten Händen! Spezialgebiete: Europarecht Einbuergerungsrecht und Asylverfahrensrecht
recht24-berlin.de
500 IOB Internationale OmnibusBetreibergesellschaft ZOB
10781
Berlin
ZOB Zentraler Omnibusbahnhof Berlin an Funkturm und Messegelände:
iob-berlin.de ZOB Zentraler Omnibusbahnhof Berlin APC
501 Nina Petrick ? Autorin Nina
10781
Berlin
Nina Petrick freie Autorin für Kinder und Jugendbücher Belletristik und Kurzgeschichten. Ihr Jugendbuch
nina-petrick.de Nina Petrick Autorin
502 Digital Innovation Facilitator GuentherLange GmbH digitale
10781
Berlin
Mit Design Thinking systematisch zu kreativen Problemlösungen für das InternetBusiness: Jens Otto Lange moderiert Ideen
jensottolange.de Digitale Innovation Kreativität
503 Berlinatnight.de :: Stadtmagazin für Musikkalender
10781
Berlin
NightlifeGuide für Berlin: Clubs Bars Parties Tickets Kinoprogramm Konzerte
berlinatnight.de Musikkalender Movie Genießen
504 Www.djembeberlin.de
10781
Berlin
Du möchtest die westafrikanische Trommel Djembe spielen lernen. Hier findest du eine Liste von Lehrern
djembe-berlin.de
505 Naturheilpraxis im Hofbogen behandlung
10781
Berlin
Naturheilkunde Praxis Hofbogen Heilung Anwendung Rheuma Therapie Heilpraktiker
hofbogen.de Behandlung Therapie Körper
506 Theater Hans Wurst Nachfahren Grüffelo
10781
Berlin
Hans Wurst Nachfahren Theater für Kinder und Erwachsene in BerlinSchöneberg zeigt Spielplan
hans-wurst-nachfahren.de Grüffelo Puppentheater Berlin
507 Berliner Berufsverband der Gesundheitsaufseher/Hygieneinspektoren BBGH
10781
Berlin
Der Berliner Berufsverband der Gesundheitsaufseher/Hygieneinspektoren stellt sich vor und bietet Informationsmaterial rund um den öffentlichen
hygieneinspektoren.de BBGH BVH Hygiene
508 Kanzlei Rechtsanwalt Böcker joomla
10781
Berlin
Joomla! dynamische PortalEngine und ContentManagementSystem
kanzlei-boecker.de Joomla Joomla
509 ..::Phoenix Lounge::.. Phoenix
10781
Berlin
Phoenix Lounge. Bar Restaurant Cafe in Schöneberg.
phoenixlounge.de Phoenix Lounge Phoenix
510 Rosenscharf und Edelsüß Catering ZOE
10781
Berlin
Restaurant ZOE Berlin. Asiatische und mediterrane Küche zwischen Hackeschem Markt und Alexanderplatz in Berlin Mitte.
rosenscharf-edelsuess.de ZOE Restaurant Lounge
511 Tucanu Webseiten leicht Jürgen
10781
Berlin
tucanu der Weg zur eigenen Homepage leicht zu haben einfach zu bedienen
tucanu.de Jürgen Kubens Beratung
512 Nicolai Thärichen Komponist Arrangeur Thärichens
10781
Berlin
Nicolai Thärichen Komponist Arrangeur Pianist Aktuelles 2009 Thärichens Tentett Konzerte
thaerichen.de Thärichens Tentett Konzerte Myspace
513 Felicitas Jacobs Theaterpädagogin Theater
10781
Berlin
Ich biete vielfältige theaterpädagogische Qualifikationen als Ausbildung oder Fortbildung initiiere theatrale Prozesse und entwickle
theaterpaedagogische-kunst.de Theater Pädagogik Spiel
514 URBANIS Startseite URBANIS GmbH URBANIS
10781
Berlin
Herzlich willkommen bei der URBANIS GmbH
urbanis-berlin.de URBANIS Berlin Unternehmen
515 Ihre Website erstellen
10781
Berlin
Alles rund um die Website. Vorkonfiguriert oder maßgeschneidert für lokale Unternehmen aus Dienstleistung Handwerk
spreelink.de
516 Studio la voce Sängerin
10781
Berlin
Stefania Erzmoneit Habsburgerstrasse 5 10781 Berlin fon: 03021 99 68 23 fax:
studiolavoce.de Sängerin Sängerin Klang
517 Home Andrea Schlinkert Queer
10781
Berlin
Dies ist die Seite von Andrea Schlinkert Tanzlehrerin und Djane in Berlin.
tangoschlampen.de Queer Tango Queer Argentino
518 Willkommen auf der Startseite Tango
10781
Berlin
Tango Rueda eine Begegnung in vier Takten in Berlin
tangorueda.de Tango Rueda Berlin
519 VIEV | NEW
10781
Berlin
VIEV ? das sind Wagner Werner ein deutschchilenisches Designerkollektiv aus Berlin.
viev.de
520 Excelle.consulting | Produktions und excelle.consultin
10781
Berlin
excelle.consulting bietet kundenindividuelle Lösungen zu Fragen der strategischen Unternehmensentwicklung und der Gestaltung operativer Leistungsstrukturen sowie
excelle.de Excelle.consulting Excelle Excelle.de
521 Wanderreisen Pierolt Wanderreisen
10781
Berlin
Wanderreisen Pierolt Wandern im Spreewald Hüttenwanderung in den Lienzer Dolomiten Wandern rund
wanderreisen-pierolt.de Wanderreisen Pierolt Wandern Im
522 SammlungsVerkauf coupon
10781
Berlin
Webdealscout Suche deine Gutscheine Deals und Rabatte
webdealscout.de Coupon Gutschein Geschenk
523 Theo G. Gilbers Sexualpädagoge
10781
Berlin
Sexualpädagogische Fortbildung für pädagogische und psychosoziale Fachkräfte
theogilbers.de Sexualpädagoge Und Sexualtherapeut
524 Schmuckmanufaktur Berlin Goldschmiedin Schmuckmanufaktur
10781
Berlin
Schmuckmanufaktur Berlin Goldschmiedin Schmuck Trendart
schmuckmanufaktur-berlin.de Schmuckmanufaktur Berlin Goldschmiedin
525 LumpenPrinzessin ... Kinderkleidung Kinderkleidung
10781
Berlin
Die LumpenPrinzessin bietet seit über 15 Jahren Alles für Baby und Kind in gut erhaltener
schuhchen.de Kinderkleidung Kindermode Kinderschuhe
526 Robert Berghoff Berlin robert
10781
Berlin
Mit einfachem Blick auf die Dinge: Bildgestaltender Kameramann Director Of Photography Cinematographer
robertberghoff.de Robert Berghoff Filme
527 Schuldnerberatung Berlin Schuldenberatung Berlin Schuldnerberatung
10781
Berlin
? Schuldnerberatung Berlin vom Anwalt Privatinsolvenz Restschuldbefreiung Verbraucherinsolvenz Schuldenberatung Verbraucherinsolvenzverfahren. Rechtsanwalt Pillig Berlin
restschuldbefreiung.de Schuldnerberatung Berlin Privatinsolvenz Restschuldbefreiung Schuldenberatu
528 HOME
10781
Berlin
Schulshirt Schulkleidung Schuluniform TShirts PoloShirts Sweatshirts Kapuzenshirts Kleidung Uniform Schule Freizeit Caps
schulschick.de
529 Home ? Goldschmiede Schmuckbotschaften
10781
Berlin
Goldschmiede Schmuckbotschaften aus Berlin entwirft individuellen Schmuck!
schmuck-gewecke.de
530 Startseite
10781
Berlin
Anwälte Steuerberater PSInkasso
schygulla-inkasso.de
531 Gabriele Steiner Praxis für Ärztin
10781
Berlin
Gabriele Steiner Praxis für Homöopathie am Winterfeldtplatz in BerlinSchöneberg Ärztin für Allgemeinmedizin
steiner-gabriele.de Ärztin Homöopathie Homoeopathie
532 Stephan Szasz Startseite Über
10781
Berlin
Ich bin Stephan Szasz aus Berlin und erzähle euch auf dieser Webseite ein paar Geschichten
stephan-szasz.de Über Mich Hobby
533 Patwork
10781
Berlin
Feinmechanik
viosk.de
534 52. DeutschFranzösisches Volksfest Schaustellerverband Berlin e.V. Deutsch
10781
Berlin
Das mit Abstand größte jährliche Volksfest in Berlin Willkommen auf über 40.000m² Erlebnisfläche!
volksfest-berlin.de Deutsch Französisches Volksfest Laune
535 Apartment Dr. Claudia Malzfeldt
10781
Berlin
Startseite
westerlandapartment.de
536 Wirtschaftsmediatoren Berlin Wirtschaftsmediat
10781
Berlin
Wirtschaftsmediatoren Berlin
wirtschaftsmediatoren-berlin.de Wirtschaftsmediator Mediator Madiation Spannagel Eckolt
537 Home Musik
10781
Berlin
Kinderlieder Wir Kinder vom Kleistpark gute Musik für Kinder Konzerte für Kinder
wirkindervomkleistpark.de Musik Für Kinder Kinderkonzerte
538 Ölmühle Berlin Olivenöl
10781
Berlin
Olivenöl aus der ölmühle Berlin Schöneberg. Bei uns finden Sie ein Sortiment von über 60 meist
xn--lmhleberlin-qfb4f.de Olivenöl Olivenholz Balsamico
539 Home
10781
Berlin
Sachverständiger von der Handwerkskammer Berlin öffentlich bestellter und vereidigter Sachverständiger für das Dachdeckerhandwerk Steildacheindeckungen
xn--stutenbumer-heinz-wqb.de
540 Brautkleider alles für Kalamov und Kalamova GbR
10781
Berlin
Bei uns finden Sie moderne und günstige Brautkleider Abendmode Accessoires Dessous. Schneller
weddingssecrets.de
541 Anke Sevenich | Schauspielerin
10781
berlin
Anke Sevenich gehört zu den besten wenn auch eher unauffälligen Schauspielerinnen des deutschen Fernsehens
anke-sevenich.de
542 Restaurant AltÖsterreich Startseite Restaurant
10781
Berlin
Restaurant AltÖsterreich heißt: Echtes Wiener Schnitzel duftende Frittatensuppe eine ordentliche Portion Kaiserschmarrn oder
alt-oesterreich.de Restaurant AltÖsterreich Alt
543 Startseite Queer
10781
Berlin
Musikversierte und begeisterte Djane mit breitgefächertem Musikrepertoire für jegliche Anlässe buchbar. Ob Standard und Lateinmusik
andrea-schlinkert.de Queer Tango Queer Argentino
544 Welcome to Berlin Gym aktiv
10781
Berlin
Auf diesen Seiten findet Ihr alle Informationen rund um den Verein Berlin Gym ? Verein
berlin-gym.de Aktiv Fitness Kampfsporttraning
545 Berliner Berufsverband der Gesundheitsaufseher/Hygieneinspektoren BBGH
10781
Berlin
Der Berliner Berufsverband der Gesundheitsaufseher/Hygieneinspektoren stellt sich vor und bietet Informationsmaterial rund um den öffentlichen
bhbbev.de BBGH BVH Hygiene
546 Bing Ma Communication China
10781
Berlin
Neue Seite
bingma.de China Business Marketing
547 Schreibcoaching in Berlin Schreibcoaching
10781
Berlin
Schreibcoaching: Sie schreiben gerade an einer wissenschaftlichen Abschlußarbeit? Bringen Sie sich mit Schreibcoaching wieder in
faden-verloren.de Schreibcoaching Wissenschaftliche Abschlussarbeit
548 Ferienhaus Wittingen
10781
Berlin
Ferienhaus Wittingen
ferienhaus-wittingen.de
549 Organisationsberater Berater für Bio
10781
Berlin
Unternehmensberater für Ökologische Landwirtschaft (Biolandbau) und Biomarkt (Biohandel) ? Experte für Bio Lebensmittel und Biolandbau
consultantorganictrade.de Bio Lebensmittel Bioprodukte
550 Home
10781
Berlin
Brandenburger Tor Variationen mit FotoGalerie TorVariationen Brandenburg Berlin Logo
brandenburger-torheiten.de
551 Floorwalker.de Einfach. Schnell. floorwalker
10781
Berlin
Ein Floorwalker bietet nicht nur bei der Einführung neuer Software effektiven Support sondern auch
floorwalker.de Floorwalker Floorwalking Office
552 FHING Aktuell Werbung
10781
Berlin
für heute ist nichts geplant
fhing.de Werbung Postkarte Schwul
553 Restaurant AltÖsterreich Startseite Restaurant
10781
Berlin
Restaurant AltÖsterreich heißt: Echtes Wiener Schnitzel duftende Frittatensuppe eine ordentliche Portion Kaiserschmarrn oder
diodata-restaurant.de Restaurant AltÖsterreich Alt
554 Startseite House of House of Queer Sisters e.V. Queer
10781
Berlin
Wir sind Sisters und Guards die Gutes tun und dies überall wo wir gebraucht
house-of-queer-sisters.de Queer Sisters Schwulen
555 OnlineShop Bastelkits. Made
10781
Berlin
Wir haben ein Kit entwickelt mit dem man gleich loslegt in dem gute
bastelkits.de
556 Linda Sixt Linda
10781
Berlin
Linda Sixt
linda-sixt.de Linda Sixt
557 Lofts Co. Lofts & Co. GmbH lofts
10781
Berlin
Lofts Co. Best in Lofts!
loftsandco.de Lofts Berlin Dachwohnung Berlin
558 Antiquariat Mertens und Pomplun Antiquariat Mertens & Pomplun GbR Antiquariat
10781
Berlin
Antiquariat antiquarische Bücher OriginalPhotographien Fotografie Plakate Landkarten Luxuspapier
mp-rarebooks.de Antiquariat Antiquarische Bücher
559 MR Patterns Willkommen Nähen
10781
Berlin
Mr Patterns das Schnittstudio fuer SelberMacher
mrpatterns.de Nähen Schnittmuster Schnittkurs
560 Psychotherapie und Coaching in
10781
Berlin
Sie suchen einen Psychotherapeuten oder Coach in Berlin? Sie sind in einer schwierigen privaten oder
monika-holz.de
561 Gaastra Napapijri Diesel online Markenmode
10781
Berlin
Fashiontex 24 Online Shop. Ihr Designer Online Shop mit Markenbekleidung wie Gaastra Jacke Poloshirt
fashiontex24.de Markenmode Gaastra Napapijri
562 Heilpraktikerin in Berlin Schöneberg Homöopathie
10781
Berlin
Isabel Blume Heilpraktikerin Klassische Homöopathie und Shiatsu in Berlin
isabel-blume.de Homöopathie Klassische Homöopathie
563 Http://www.KinderladenKonfetti.de
10781
Berlin
Mitten im Schöneberger Winterfeldtkiez in Berlin liegt der kleine bunte Kinderladen Konfetti. Zwei Erzieherinnen
kinderladen-konfetti.de
564 MUTTER RESTAURANT BAR BERLIN thai
10781
Berlin
Die MUTTER in Berlin Schöneberg bietet vom Frühstück im Außenbereich thailändischer Küche und Cocktails
mutter-berlin.de Thai Bar Berlin Thaifood Frühstück
565 Zuhause Mundgerecht Magazin Save
10781
Berlin
MUNDGERECHT ist mehr als nur ein Magazin. Eigentlich sind wir ein soziales Startup mit einer
mundgerecht-magazin.de Save Food Nachhaltiges Essen
566 Home Siebergraphic Siebergraphic Berlin
10781
Berlin
siebergraphic macht die Grafik für Sie in Berlin Nürnberg und Umgebung. Egal was
siebergraphic.de Berlin Grafik Illustration
567 Schlüsseldienst Tempelhof Endpreise direkt Schlüsseldienst
10781
Berlin
Günstiger Schlüsseldienst für Tempelhof. Probleme mit Ihrem Türschloss? Kein Problem. Wir helfen kostengünstig schnell
schluesseldienst-tempelhof-berlin.de Schlüsseldienst Tempelhof Ihr Schlüsseldienst
568 StoppRitalin | Die ScherretMethode Wachstumsstörunge
10781
Berlin
Bei immer mehr Kindern und Jugendlichen in Deutschland stellen Ärzte Aufmerksamkeits und Hyperaktivitätsstörungen fest.
stopp-ritalin.de Wachstumsstörungen ADHS Ritalin StoppRitalin ScherretMethode
569 HOME
10781
Berlin
HOME
ulrikespeyerer.de
570 Wellfina Wellness Fitness Naturheilkunde
10781
Berlin
Angebot: Personal Training Ernährungsberatung Mesotherapie (Anti Aging) Kinesiologie Neuraltherapie Schröpfen
wellfina.de Naturheilkunde Heilpraktiker Personaltraining
StadtBranche.de Orts-Portrait von Berlin in Berlin. Die Themenseite zu Neueröffnungen, verkaufsoffene Sonntage, Gutscheine und Coupons in Berlin erhält 4 StadtBranche Punkte - Bewertet wird die Anzahl der Besucher dieser Themenseite. Stand: + Kontakt

Berlin
Berlin ist die Bundeshauptstadt der Bundesrepublik Deutschland und zugleich eines ihrer Länder. Die Stadt Berlin ist mit rund 3,5 Millionen Einwohnern die bevölkerungsreichste und mit 892 Quadratkilometern die flächengrößte Gemeinde Deutschlands sowie nach Einwohnern die zweitgrößte der Europäischen Union. Sie bildet das Zentrum der Metropolregion Berlin/Brandenburg und der Agglomeration Berlin . Der Stadtstaat unterteilt sich in zwölf Bezirke. Neben den Flüssen Spree und Havel befinden sich im Stadtgebiet kleinere Fließgewässer sowie zahlreiche Seen und Wälder.

LandkreisKreisfreie Stadt Berlin
BundeslandBerlin
Postleitzahl10783
Vorwahl030
Bahnhof
FinanzamtSchöneberg
Berlin Kreisfreie Stadt Berlin Berlin