optional Stadt:
Ort ›

Berlin › Kreisfreie Stadt Berlin › Berlin

Branchenbuch Berlin 10787 Berlin

Kreisfreie Stadt Berlin

Kostenloses Buch Tipps & Tricks für Arbeitswelt & Leben:

Erhalten Sie Ihr Buch "Tipps und Tricks für Arbeitswelt und Leben"
kostenlos per E-Mail als .pdf Datei:

1 Medizinstudium Schule
Ein Medizinstudium absolvieren? Für die optimale Vorbereitung ist Premedicine Berlin der Ansprechpartner. Egal ob es ein Medizinstudium im...
premedicine-berlin.de Medizinstudium Ausland Informationen Academy Vorbereitung Medical Berlin Zahnmedizin
2 günstige Transporte Umzüge & Entsorgungen Transporte &
Wir sind seit über 15 Jahren Ihr kompetenter und zuverlässiger Ansprechpartner für Kleintransporte aller Art egal ob...
moebeltaxi-berlin.de Mbeltaxi Transport Ikea Berlin Schrieb Bewertung Umzug Meinungen
3 Fotostudio Fotografie
cross space studio
4 Woodford Trailers in Berlin Firmen
Entdecken Sie die große Auswahl an Anhänger Woodford. Wir haben Ihren Anhänger, vom Dreiseitenkipper bis zum...
autotrailer-berlin.de Woodford Geschlossene Anhänger Trailer Rl Galaxy Geschlossen

Kostenloses Buch Tipps & Tricks für Arbeitswelt & Leben:

Erhalten Sie Ihr Buch "Tipps und Tricks für Arbeitswelt und Leben"
kostenlos per E-Mail als .pdf Datei:

5 Unsichtbare Zahnspange bei den Zahnärzten am Zahnarzt
Schiefe Zähne ade! Mit der unsichtbaren Zahnspange (Invisalign) können Sie in kurzer Zeit Ihre Zähne wieder in...
zahnaerzte-am-potsdamer-platz.de Berlin Zähne Zahnarzt Prophylaxe Praxis Leistungen Schnarchen Bleaching
6 Kampfkunst Selbstverteidigung
serradaescrima.de Domain United Portfolio Domains Registriert Platzhalter Rechte Einstellungen
7 Fenster-Komm Fensterbau
fenster-komm.net/ Fenster Daten Google Komm Website Türen Berlin Analytics
8 Kfz-Gutachter Berlin und Brandenburg Kfz-Gutachter
Auf der Suche nach einem schnellen und erfahrenen Kfz-Gutachter in Berlin und Brandenburg? Besuchen Sie kfzgutachterberlin.net und...
kfzgutachterberlin.net/ Kfz Berlin Gutachter Fahrzeugs Wertgutachten Unfallgutachter Gutachten Brandenburg
9 Lieblingsbrille Augenoptik Augenoptiker
lieblingsbrille-augenoptik.de Gleitsichtbrille Monatslinsen L Sehstärke Augenoptik Ihr Lesebrille N
10 Barrierefreies Bad Barrierefrei
Seniorengerecht und Behindertengerechter Umbau Barrierefreies Bauen, Planen & Modernisieren für gehandicapte Menschen. Menschen mit einem Handicap / gehandicapt, sind leistungsschwächere...
handicap-buscher.de Menschen Wohnung Wanne Arbeiten Barrierefreies Handicap Nun Plötzlich
11 Heilpraktiker Wanitschek & Vigl Berlin Heilpraktiker
Herzlich willkommen auf unserer Präsenz auf stadtbranche.de. Sind Sie auf der Suche nach einem Heilpraktiker/ einer Heilpraktikerin...
12 Heilpraktiker Wanitschek & Vigl Berlin Heilpraktiker
Herzlich willkommen auf unserer Präsenz auf stadtbranche.de. Sind Sie auf der Suche nach einem Heilpraktiker/ einer Heilpraktikerin...

Kostenloses Buch Tipps & Tricks für Arbeitswelt & Leben:

Erhalten Sie Ihr Buch "Tipps und Tricks für Arbeitswelt und Leben"
kostenlos per E-Mail als .pdf Datei:

13 Profitabel Forex Handeln und als Day Finanzen Trading

Als Trader von zu Haus arbeiten und mit hoher Unabhängigkeit die finanziellen Ziele erreichen. Genau diese Möglichkeiten...
maniforex.de Forex Trading Strategie Trader Finde Psychologie Traden Risiko
14 Vital Umzüge Transporte Logistic
Über uns/ unser Unternehmen Wir verstehen uns als Dienstleister, für den die Kundenzufriedenheit an erster Stelle steht. Bei...
vital-umzuege.de Berlin Umzüge Umzug Vital Wedding Günstig Umzugsfirma Transport
15 Studio Pur Fotogen GmbH Fotostudio
studio-pur-fotogen.de/ Studio Fotogen Preise Pur Kindercasting Bilder Bewerbungsfotos Berlin
16 Glaserei Thiel GmbH Glaserei
berlin-glaserei-thiel.de/ Glaserei Berlin Thiel Köpenick Mahlsdorf Umgebung Kunstglaserei Glas
17 Schneeball GmbH Winterdienst Grünanlagenpflege
In Zukunft zufrieden! Als Unternehmen, mit einem anderen Konzept, gilt es viele Punkte zu beachten und Herausforderungen zu...
schneeball-gmbh.de Winterdienst Berlin Information_ Schneeball Berliner Notdienst Unternehmen Berlintelefon
18 Pylones Geschenkartikel
Pylones stiftet Unruhe in der Welt der Geschenke: wir schütteln sie durch, erfinden sie neu, geben ihnen...
19 Pylones Geschenkartikel
Pylones stiftet Unruhe in der Welt der Geschenke: wir schütteln sie durch, erfinden sie neu, geben ihnen...
20 Pylones Geschenkartikel
Pylones stiftet Unruhe in der Welt der Geschenke: wir schütteln sie durch, erfinden sie neu, geben ihnen...
21 Agentur 247 Limousinenservice
Wir bieten mit unserer Agentur Privatpersonen, Geschäftsleuten und Prominenten einen komfortablen Shuttle Service bzw. Limousinenservice an...
agentur247.de Berlin Agentur Uns Mobilitätslösungen Services Bieten Flughafentransfer Außerhalb
22 Edition Monhardt Verlag
Edition Monhardt ist ein neuer unabhängiger Berliner Verlag für Lyrik, kurze Prosa, Essayistik und Kunst. Gegenwartsliteratur aus...
monhardt.de Monhardt Berlin Edition Warenkorb Mein Striebel Buchhandel Bernhard
23 Klaviere Berlin Klaviergeschäft
Das Pianohaus Listmann ist seit vielen Jahren der Ansprechpartner rund um Klaviere in Berlin. Ein Klavier kaufen, Klavier...
pianohaus-berlin.com Berlin Klavier Klaviere Flügel Brandenburg Schimmel Listmann Pianohaus
24 Watershed Packaging DE Dienstleistung
Watershed DE produziert Schrumpfschlauchetiketten und bedruckte Verpackung. Sehen Sie sich unser wundervolles Portfolio von flexiblen Verpackungen an....
25 Starklasers.com Laser
Starklasers.com ist eine professionelle Laserpointer-Shop, mit allen Arten von Laser-Ausrüstung: grüner Laser, roter Laser, blauer Laser, gelber...
starklasers.com/ Laserpointer Laser Mw Grün Blau Rot Nm €
26 Hipster Escape e.K. Unterhaltung
hipster-escape-berlin.de Escape Spiel Hipster Party Rätseln Games Wohnung Buchung
27 Partyservice Berlin Bauern-Kate.de Partyservice Berlin Bauern-Kate.de Partyservice Berlin
Partyservice Berlin Bauern-Kate.de Seit 1981 sind wir nun schon als erfahrener Dienstleister im Bereich Partyservice-Berlin und Catering in...
partyserviceberlin.org/ Büffet Berlin Partyservice Bauern Catering Kalte Rustikales Büffets
28 Krupa Sicherheitsdienst GmbH aus Berlin Sicherheitsdienst Security
Die Krupa Sicherheitsdienst GmbH aus Berlin ist Ihr seriöser, kompetenter und vertrauenswürdiger deutschlandweiter Partner. Dienstleistungen: Security, Wachschutz, Veranstaltungsschutz...
krupa-sicherheitsdienst.de Berlin Sicherheitsdienst Security Wachschutz Sanitter Brandwachen Krupa Sicherheit
29 jobtensor Jobbörse
Mit dem Ziel einer optimierten Online-Jobsuche dient die Internetplattform jobtensor als Vermittler zwischen Arbeitgebern und interessierten Bewerbern...
jobtensor.com Jobtensor Job Forschung Luft Finde Informatik Preise Linkedin
30 Immer aktuelle Schrottpreise bei Hein Schrotthandel Schrotthandel -
Schöneiche bei Berlin
Sie bekommen bei Hein Schrotthandel GmbH stets faire und transparente Schrottpreise geliefert, sie sind tagesaktuell und wir...
hein-schrotthandel.de Schrotthandel Schrott Schrottpreise Entsorgung Ihrem Hein Ankauf Metallschrott
31 Kryolipolyse Berlin Kosmetik
Das Unternehmen Medical Body Line führt jährlich erfolgreich hunderte von Kryolipolyse-Anwendungen durch und ist stolz darauf...
medical-body-line.de Kryolipolyse Fett Kälte Einfrieren Weg Berlin Medical Body
32 Müller & Kollegen Rechtsanwälte Anwalt
rechtsanwaelte-berlin.com Kollegen Müller Rechtsanwälte Berlin Arbeitsrecht Mietrecht Groß Hakenfelde
33 Rechtsanwalt Steffen Radlbeck Rechtsanwalt
Meine Kanzlei hat sich auf dem Gebiet des Immobilienrechts spezialisiert und hat über zehn Jahre erfolgreich Mandanten...
34 Rechtsanwalt Steffen Radlbeck Rechtsanwalt
Meine Kanzlei hat sich auf dem Gebiet des Immobilienrechts spezialisiert und hat über zehn Jahre erfolgreich Mandanten...
35 Research Personal Personalberatung
Personalberatung in Berlin gesucht? Dann ist WPR der Spezialist . Das Unternehmen WPR bietet Unterstützung für Rekrutierungsmaßnahmen...
wpr-research.de Manager Wm Festanstellung Operations Research Jobs Real Department
36 Tiont Berlin Entrümpelungen
Entrümpelungen Tiont Berlin Komplett Service pauschal sofort Wohnungsauflösung Sperrmüll Haushaltsauflösungen zum Festpreis Keller Entrümpelung Dienst...
tiont.de Entrümpelung Berlin Tiont Notdienst Entrümpelungen Sperrmüll Keller Express
37 Rechtsanwalt Dr. Christopher Kasten Rechtsanwalt
anwalt-kasten.de/ Daten Google Berlin Familienrecht Kasten Fotoliacom Website Christopher
38 Sperrmüll Berlin Entsorgung
Das Unternehmen Kraftzone ist der richtige Partner wenn es um die Wohnungsauflösung geht. Durch Erfahrung und Know-How...
kraftzone.de Partner Dip Aengevelt Berlin Vermittelt Sperrmüll Magdeburg Entrümpelung
39 Hager & Partner GbR Rechtsanwälte und Rechtsanwalt
Wer die Kanzlei Hager & Partner betritt, begegnet fünf erfahrenen Juristen. Was sie verbindet, ist ihre Leidenschaft...
kanzlei-hager.de/ Hager Partner Rechtsanwalt Berlin Erbrecht Kanzlei Team Georg
40 030 Datenrettung Berlin Datenrettung
Datenrettung und Datenwiederherstellung von Festplatte, NAS, RAID-Servern, SSD sowie Flash-Speichern und Handy....
030-datenrettung.de Datenrettung Festplatte Ssd Nas Festplatten Server Berlin Usb
41 List and Sell - Webdesign Marketing Webdesign Agentur
Ihrem Fullservice-Anbieter rund um eBay- und Amazon-Shops sowie eCommerce-Lösungen. Sie haben ein Produkt? Wir kümmern uns um...
listandsell.de Design Shop Amazon Webshops Leistungen Optimierung Beratung Ebay
42 Vedis Indisches Restaurant Cocktailbar Prenzlauer Berg Indische Restaurants
Seien Sie herzlich eingeladen, das romantische, exotische und warme Ambiente im Vedis zu genießen. Direkt in Berlin...
vedis.berlin Restaurant Vedis Berlin Indisches Prenzlauer Berg Indian Küche
43 Entrümpelung24 Berlin Entrümpelung Wohnungsauflöung
Als professionelle Firma für Entrümpelungen und Entsorgungen aus Berlin übernehmen für gerne für Sie Ihre Wohnungsauflösung sowie...
entruempelung24.berlin Entrümpelung Berlin Umzug Malerarbeiten Entsorgung Umzugsservice Aufbau Möbel
44 Eventfotografie Berlin | Valentin Paster Eventfotograf
Hinterlassen Sie eine Spur! Ein Event ist ein gut durchdachtes und sorgfältig geplantes Ereignis. Bei der Eventfotografie setzen...
berlin-eventfotograf.de/ Hochzeit Interieur Galerie Eventfotograf Events Europaweit Jobs Berlin
45 LoveMoments | Hochzeitsfotograf Valentin Paster aus Hochzeitsfotograf
Falls Ihr in Berlin oder Europa heiraten möchtet und gerade auf der Suche nach dem richtigen Hochzeitsfotografen seid, dann...
lovemoments.de Hochzeitsreportage Hochzeit Bilder Liebe Euch Berlin Hochzeitsfotograf Hochzeitsalbum
46 Hypnoanalyse Hypnosetherapie Gesundheit
Hypnoanalyse, die moderne Therapieform, die Hypnose und traditionelle Therapiemethoden vereint. Für schnelle und anhaltende Erfolge bei Depressionen...
lammerding-hypnose.de Hypnosetherapie Berlin | Hypnoanalyse Pankow Lebenskrisenkurzzeittherapie Depressionängsten Klientenzentrierte
47 http: www.maytoni.de Handel
Lampen & Leuchten Großhandel Verkauf vom Hersteller. Das umfassende Angebot an Kronleuchtern wird ständig durch neue Modelle...
maytoni.de Wholesale Chandeliers Crystal Lighting Modern Europe Street Classic
48 http: www.maytoni.de Handel
Lampen & Leuchten Großhandel Verkauf vom Hersteller. Das umfassende Angebot an Kronleuchtern wird ständig durch neue Modelle...
maytoni.de Wholesale Chandeliers Crystal Lighting Europe Modern Street Classic
49 Kopierladen Copyshop
Wir sind Dein Kopierladen. Preiswert, ­zu­verlässig und schnell. Du findest uns ­4 mal in Berlin oder im...
kopierladen-berlin.de/ Kopierladen Berlin Prenzlauer Berg Pankow Papier Aufkleber Sa–
50 Kopierladen Copyshop
Wir sind Dein Kopierladen. Preiswert, ­zu­verlässig und schnell. Du findest uns ­4 mal in Berlin oder im...
kopierladen-berlin.de/ Kopierladen Berlin Prenzlauer Papier Berg Pankow Aufkleber Kopien
51 Kopierladen Copyshop
Wir sind Dein Kopierladen. Preiswert, ­zu­verlässig und schnell. Du findest uns ­4 mal in Berlin oder im...
kopierladen-berlin.de/ Kopierladen Berlin Prenzlauer Pankow Berg Papier Buchbindungen Aufkleber
52 Copyshop Copyshop
Wir sind Dein Kopierladen. Preiswert, ­zu­verlässig und schnell. Du findest uns ­4 mal in Berlin oder im...
kopierladen-berlin.de/ Kopierladen Berlin Prenzlauer Papier Berg Pankow Weissensee Buchbindungen
53 orderbird - iPad-Kassensystem für die Gastronomie Software
orderbird ist das Nr. 1 iPad Kassensystem für die Gastronomie. Über 6500 Restaurants, Cafés, Bars und andere...
orderbird.com English Deutsch ✓ Kassensystem De Blog Ipad Presse
54 Classic55 Oldtimervermietung Oldtimervermietung
Wir vermieten mit Chauffeur perfekt restaurierte amerikanische Oldtimer der 50er Jahre. Diese werden gerne für Film, Hochzeiten...
classic55.de Berlin Oldtimer Hochzeitsauto Hochzeit Cadillac Jahre Wagen Hochzeitsfotograf
55 Rechtsanwaltskanzlei Kuletzki Rechtsanwalt
Rechtsanwalt Stephan Kuletzki und Rechtsanwältin Corinna Mnich der Rechtsanwaltskanzlei Kuletzki sind Ihre kompetenten Ansprechpartner in allen juristischen...
rechtsanwaltkuletzki.de Kuletzki Rechtsanwalt Arbeitsrecht Verkehrsrecht Vertragsrecht Berlin Rechtsanwältin Kanzlei
56 Hochzeitsfotograf in Berlin - Fotos Eurer Hochzeitsfotograf
Fotos Eurer Hochzeit – Euer Hochzeitsfotograf in Berlin für gefühlvolle Hochzeitsfotografie und emotionale Hochzeitsreportagen. Traumhafte Hochzeitsreportagen in Berlin...
fotos-eurer-hochzeit.de Hochzeitsreportage Berlin Hochzeitsfotograf Euch Trauung Boudoir Wedding Kleine
57 Berlin Entrümpelungen Entrümpelung Wohnungsauflöung
Für eine gründliche und reibungslose Entrümpelung stehen wir mit unserem Namen. Von Haushaltsauflösungen über Keller und Büroauflösungen...
berlin-entruempelungen.de/ Berlin Entrümpelungen Malerarbeiten Umzugsservice Umzüge Umzug Preise Haushaltsauflösung
58 Dr. med. Natalie Reytan Gesundheit
Ein umfassendes Spektrum bietet die private Praxis für Dermatologie Dr. Reytan in Berlin Mitte an. In der...
hautarztpraxisberlin.de – Hautarztpraxis Kosmetik Akne Allgemein Therapie Kindern Beratung
59 Hellsehen und Wahrsagen Esoterik
Sofortberatung unter: 09003 – 101016 (1, 52EUR/Min) Ich bin ein hellsichtiges Medium und arbeite schon langjährig als spirituelle...
orphina.de Kartenlegen Magie_ _hellsichtiges Phone ~dotdeb+ Jenseitskontakte Wahrsagen Esoterik
60 Fakten zum Thema Mineralwasser Nahrungsmittel
Auf der hier genannten Seite, werden Anbieter und Abfüller von Mineralwasserquellen vorgestellt und entsprechend bewertet....
mineralwasser-testsieger.de/ Mineralwasser Medium Gerolsteiner Testsieger Wasser Test Vergleich Stiftung
61 PEC Reinigungsmaschinen Berlin GmbH Reinigungsmaschinen
PEC Reinigungsmaschinen Berlin GmbH ist Ihr zuverlässiger Partner wenn es um die Vermietung und Kauf von Reinigungstechnik...
reinigungsmaschinen-berlin.de/ Berlin Reinigungsmaschinen Scheuersaugmaschinen Industriesauger Hochdruckreiniger Vermietung Reinigungstechnik Zubehör
62 MiAna GmbH & Co. KG Mode
Unser Onlineshop vertreibt Produkte der Marke GRETCHEN, welche als berliner Accessoire Brand gegründet wurde, mit dem Ziel...
mygretchen.com/shop/ Gretchen Gloves Berlin Anne Schmitt Summer Christin Purses
63 Die Vollkasko Heute Versicherung
Auf dieser Seite werden die Vorteile und mögliche Nachteile von Anbietern der Vollkaskoversicherung vorgestellt. Durch Testberichte und...
vollkasko-heute.de/ Vollkasko En Angeboten Langeempfehlung Möglichkeit Vollkaskoschutz Gelangen Mindern
64 MPU-Vorbereitung online bei mentavio.com Psychologie
mentavio bietet professionelle MPU-Vorbereitung und psychologische Beratung per Internet an. Mit nur wenigen Klicks können Sie bei...
mentavio.com/mpu-vorbereitung Z Y
65 Rechtsanwalt Jan Bartholl Rechtsanwalt
Der Anwalt für Reiserecht bietet Rechtsberatung in Fällen der Anspruchsverfolgung von Entschädigung bei Flugverspätung, Flugannullierung oder Flugänderung. Die...
rechtsanwalt-bartholl.de Bartholl Kanzlei Reiserecht Services Rechtsanwalt Lewandowski Legal Recht
66 Rechtsanwalt Jan Bartholl Rechtsanwalt
Der Anwalt für Reiserecht bietet Rechtsberatung in Fällen der Anspruchsverfolgung von Entschädigung bei Flugverspätung, Flugannullierung oder Flugänderung. Die...
rechtsanwalt-bartholl.de Bartholl Kanzlei Reiserecht Rechtsanwalt Services Lewandowski Legal Recht
67 Rechtsanwalt Jan Bartholl Rechtsanwalt
Der Anwalt für Reiserecht bietet Rechtsberatung in Fällen der Anspruchsverfolgung von Entschädigung bei Flugverspätung, Flugannullierung oder Flugänderung. Die...
rechtsanwalt-bartholl.de Bartholl Kanzlei Reiserecht Recht Services Lewandowski Legal Rechtsanwalt
68 Rechtsanwalt Jan Bartholl Rechtsanwalt
Der Anwalt für Reiserecht bietet Rechtsberatung in Fällen der Anspruchsverfolgung von Entschädigung bei Flugverspätung, Flugannullierung oder Flugänderung. Die...
rechtsanwalt-bartholl.de/ Bartholl Kanzlei Reiserecht Legal Rechtsanwalt Lewandowski Services Recht
69 Bergemann & Weidner Rechtsanwälte Bergemann & Weidner Rechtsanwälte Rechtsanwälte
Die Rechtsanwaltskanzlei Bergemann & Weidner wurde in den 70er Jahren im Norden Berlins gegründet. Seit 2001 ist...
70 Steinkühler – Kanzlei für Arbeits- und Rechtsanwalt
Wir sind ein 6-köpfiges Team hochspezialisierter und erfahrener Anwälte. Dank bundesweiter und internationaler Mandate erweitern wir täglich...
steinkuehler-legal.com/ Reihe Platz Leistungen Steinkühler Kanzlei Gründer Arbeitnehmer Unternehmer
71 Pinkcube Werbeartikel Werbeartikel
Online Werbeartikel bestellen bei Pinkcube Wir sind Pinkcube. Wir liefern Ihnen Werbeartikel über sehr benutzerfreundliche Webshops. Wir machen...
pinkcube.de Logo ✔ Bedrucken Günstig Werbeartikel Werbemittel Berlin Artikel
72 Dolmetscher Dolmetscher
DOLMETSCHERSERVICE Konferenzdolmetschen, Gesprächs- und Begleitdolmetschen M.A. Konferenzdolmetscherin, Dolmetscherin und ermächtigte Übersetzerin am Landgericht Berlin für die Sprachen Englisch und...
dolmetscherservice.org Agb – Dolmetscherservice Honorar Deutsch Profil Leistungen Jeder
73 Digitale Beratung Digitalagentur
Erreichen Sie Ihre Kunden zielgenau im Internet: Wir optimieren und vermarkten Ihre Webpräsenz und machen Sie sichtbar...
digitaleberatung.com Kunden Digitale Mittelstand Beratung Agentur Leistungen Unternehmen Blog
74 A . Müller Umzug Berlin günstiger Umzüge
A . Müller ist Ihre Umzugsfirma, Umzugsunternehmen zum Umzugskosten sparen bei Umzug nach Berlin , bei Umzug...
tesu-umzug.berlin Umzug Berlin Lager München Packmaterial Hamburg Irland Frankfurt
75 Erfahrungen24.eu Bewertungen
Erfahrungen24 bietet ein intuitives System zum Lesen und Abgeben von Bewertungen für Online Shops, Dienstleister, Produkte und...
erfahrungen24.eu/ Test Erfahrungen Erfahrung Reviews Erfahrungsberichte Shops Bewertungen Preisvergleich
76 THE BRETTINGHAMS GmbH Internetagentur
Internetagentur für digitale Lösungen aus Berlin. Full-Service Digitalagentur für Strategie, Webdesign, TYPO3 Programmierung und Online Marketing....
brettingham.de Internetagentur Berlin Services Marketing Unternehmen Agentur Brettinghams Marken
77 Dudelsack Unterricht in Berlin Musikunterricht
Dudelsack Unterricht für Totalanfänger bis Fortgeschrittene, für Kinder (ab 10 Jahre), Jugendliche und Erwachsene in Berlin. > Professioneller...
dudelsackunterricht.jimdo.com Unterricht Berlin Dudelsack Info Z
78 Alex Entrümpelung Berlin Entrümpelung
Berlin - Friedrichshain
Entrümpelung Berlin Die Entrümpelungs-Profis von Alex Entrümpelung Berlin helfen Ihnen schnell und unkompliziert bei Ihrer Entrümpelung in Berlin....
alex-entruempelung.de Berlin Entrümpelung Leistungen Ankauf Gartenpflege Wohnungsauflösung Uns Zuverlässig
79 CAPLAN & GREEN Executive-Search
Caplan & Green ist das Talent Management und Executive Search Unternehmen mit der größten Marktbreite. Unsere Berater unterstützen nationale...
caplangreen.com Executive Green Caplan Talent | Geht Partner Nächsten
80 CAPLAN & GREEN Talent Management
Caplan & Green ist das Talent Management und Executive Search Unternehmen mit der größten Marktbreite. Unsere Berater unterstützen nationale...
caplangreen.com Green Executive Caplan | Talent Geht Fach Managers
81 PRESTIGE Kosmetikakademie Kosmetikschule
Wir sind eine DEKRA zertifizierte Bildungsakademie und Mitglied beim BfD Bundesverband der Fachkosmetiker/-innen in Deutschland. Mit der DEKRA-...
prestige-akad.de Prestige Ausbildung Kosmetikakademie Wellness Dozenten Kosmetik Bildung Schulung
82 Apple Reparatur Berlin Apple Service
Ihr Mac oder iPhone macht mal wieder nicht das, was es soll? - Kein Problem, wir von...
apple-reparatur-berlin24.de/ Reparatur Berlin Apple Bewertungen Rufen Agb Joomla Falls
83 PC und Notebook Reparatur Berlin Pc und
Sie suchen einen kompetenten, kundenorientierten Service, der dazu noch preiswert ist? Dann sind wir, PC-Reparatur-Berlin24, Ihr Ansprechpartner...
pc-reparatur-berlin24.de/ Pc Reparatur Berlin Fachmann Hilfe Potsdam | Mac
84 Videoüberwachung Einbau Berlin & Umland Videoüberwachung
Wollen Sie wissen, wer ein- und ausgeht oder bei Ihnen klingelt? Wollen Sie von überall auf der...
xn--videoberwachung-berlin24-zsc.de/ Videoüberwachung Berlin Umland überwachungssysteme Ama Essen Kameraüberwachung Düsseldorf
85 DJ Sascha B DJ

professioneller DJ Service in ganz Deutschland...
dj-sascha-b.de Sascha Dj | Professioneller Hochzeiten Events Anfrage Hochzeit
86 iSpodBerlin Webdesign
Professionelle und aktuelle Websites sind ein Muss für Gründer, Startups, Selbstständige und Unternehmen Ihre Web-, Blog - ...
ispod-webagentur.de/ | Website Erstellen Webagentur Anfang Texte Professionelle Fairen
87 iSpodBerlin Webdesign
Professionelle und aktuelle Websites sind ein Muss für Gründer, Startups, Selbstständige und Unternehmen Ihre Web-, Blog - ...
ispod-webagentur.de/ | Erstellen Website Webagentur Webdesign Websitescontent Firmenwebsite Socialmedia
88 Ratenkredits-Vergleiche Finanzen
Wir stellen unterschiedliche Anbieter von Darlehen und Krediten vor. So können Kreditnehmer das tatsächliche Leistungsniveau erkennen. Alle...
ratenkredits-vergleiche.de/ Vergleich Ratenkredit Vergleichen Aktuell Unserem Vergleichsportal Angebot Angebote
89 Waschmaschine Abholung Berlin Entrümpelung
Sperrmüll Abholung in Berlin Komplett Service Entrümpelungen aller Art sofort Möbel Sperrholz Waschmaschine Abholung Berlin Keller Entrümpelung...
xn--sperrmllabholung-berlin-hpc.org Berlin Sperrmüllabholung Sperrmüll Waschmaschine Abholung Möbel Berlinorg Elektrogeräte
90 Hochzeitsfotograf in Berlin - Fotos eurer
Fotos Eurer Hochzeit – Euer Hochzeitsfotograf in Berlin für gefühlvolle Hochzeitsfotografie und emotionale Hochzeitsreportagen. Traumhafte Hochzeitsreportagen in Berlin...
fotos-eurer-hochzeit.de Hochzeitsreportage Berlin Hochzeitsfotograf Trauung Boudoir Euch Preise Begleitung
91 Detektei AC online Detekteien
Ihr professionellen IT-Dienstleister - Detektei AC Lösungen für Verbesserungen Konkrete Lösungen zum einem erfolgreichen IT-Sicherheitsmanagement und Verbesserungen anzubieten, würde...
92 Detektei AC online Detekteien
Ihr professionellen IT-Dienstleister - Detektei AC Lösungen für Verbesserungen Konkrete Lösungen zum einem erfolgreichen IT-Sicherheitsmanagement und Verbesserungen anzubieten, würde...
93 Detektei AC online Detekteien
Ihr professionellen IT-Dienstleister - Detektei AC Lösungen für Verbesserungen Konkrete Lösungen zum einem erfolgreichen IT-Sicherheitsmanagement und Verbesserungen anzubieten, würde...
detektei-ac.de Detektei Privatdetektive Observationen Informationen Familie Consulting Ermittlungen Ermitteln
94 Detektei AC online Detekteien
Ihr professionellen IT-Dienstleister - Detektei AC Lösungen für Verbesserungen Konkrete Lösungen zum einem erfolgreichen IT-Sicherheitsmanagement und Verbesserungen anzubieten, würde...
detektei-ac.de Detektei Privatdetektive Informationen Wirtschaftsdetektei Preiswerte Ermittlungen Blog Preise
95 Detektei AC online Detekteien
Ihr professionellen IT-Dienstleister - Detektei AC Lösungen für Verbesserungen Konkrete Lösungen zum einem erfolgreichen IT-Sicherheitsmanagement und Verbesserungen anzubieten, würde...
detektei-ac.de Detektei Privatdetektive Recherche Preiswerte Ac | Observation Fingiertemermitteln
96 Detektei AC online Detekteien
Ihr professionellen IT-Dienstleister - Detektei AC Lösungen für Verbesserungen Konkrete Lösungen zum einem erfolgreichen IT-Sicherheitsmanagement und Verbesserungen anzubieten, würde...
97 Detektei AC online Detekteien
Ihr professionellen IT-Dienstleister - Detektei AC Lösungen für Verbesserungen Konkrete Lösungen zum einem erfolgreichen IT-Sicherheitsmanagement und Verbesserungen anzubieten, würde...
detektei-ac.de Privatdetektive Detektei Ermitteln Privat | Wirtschaftsdetektei Familie Ermittlungen
98 Histavino Wein
Die Seite Histavino ist für Menschen interessant, die trotz ihrer Histaminintoleranz nicht auf einen guten Tropfen Wein...
histavino.com Lebensmittel Wein Histamingeprüfter Histamin Weine Histavino Gluten Essig
99 Zahnarzt für Zahnimplantate Berlin Mitte Zahnarzt Oralchirurgie
Zahnarzt für Zahnimplantate in Berlin Das Zahnarztzentrum am Potsdamer Platz in Berlin Mitte besteht aus einem erfahrenen Team...
zahnarzt-am-potsdamer-platz.de/ Berlin Prophylaxe Zahnarzt Zahnmedizin Invisalign Potsdamer Parodontitis Behandlung
100 KOR7 MEDIA Marketing
KOR7 MEDIA ist eine Agentur für digitales Marketing und Content Produktion. Wir steigern Ihren Unternehmens- und Markenwert...
kor7media.de Instagram Marketing Influencer Media Social Content Agentur Produktion
101 BU Sinnvollschutz Versicherung
Unsere Firma erklärt genau, ob und wann eine private Berufsunfähigekeitsversicherung sinnvoll ist. Wir stellen die Stärken und...
berufsunfaehigkeitsversicherungen-sinnvollschutz.de/ Berufsunfähigkeitsversicherung Sinnvoll Angebot Zum Sinnvollschutz Wann News Polizisten
102 Neue Dusch Oase an einem Tag Sanitär
Die Berliner Preis Revolution : Umbau Wanne zu Dusche - an einem Tag Preiswert und Fachgerecht :...
flache-dusche.de Z Y
103 Öltank-Service Tobias Obermann Tankentsorgung
Tankreinigung und Tankentsorgung zum Festpreis. Sauber, Schnell und Zuverlässig durch den Familienbetrieb aus Berlin. Mit Modernsten Maschinen...
oeltank-service.eu Demontage Preise Leistung öltank Tankdemontage Heizöltank Tobias Berlin
104 Entsorgo Containerdienst Entsorgung
Buche Deine Entsorgung oder Entrümpelung jetzt online! Bei Entsorgo.de kannst Du innerhalb von nur 3 Minuten die Kosten...
entsorgo.de/ Entrümpelung Haushaltsauflösung | ✓ Containerdienst Dresden Entsorgung Container
105 Schmuckankauf Berlin Lichterfelde Juwelier Haeger Juwelier
Möchten Sie Ihr Altgold verkaufen? Sind Sie im Besitz von altem Schmuck, Zahngold oder Industriegold? Dann überlegen...
juwelier-haeger.de/berlin Schmuck Gold Geschenke Diamanten Berlin Rolex Modi Vertrauen
106 Schmuckankauf Berlin Juwelier Haeger Juwelier
Sie möchten Platinschmuck veräußern? Sie wollen einen Ring verkaufen? Ihr alter Silberschmuck entspricht nicht mehr Ihrem Geschmack?...
juwelier-haeger.de/berlin Schmuck Gold Geschenke Diamanten Berlin Markenschmuck Freundschaftsringe Schmückendes
107 Schah Sedi und Schah Sedi Rechtsanwälte Rechtsanwalt
Schah Sedi und Schah Sedi ist eine der in Deutschland führenden Kanzleien auf dem Gebiet des Personenschadensrechts....
schah-sedi.de/ Schah Sedi Schmerzensgeld Büro Anfrage Navigation Kostenlose Rechtsanwälte
108 Fenster Reparaturen für Berlin und Brandenburg Fenster und
Berlin Reinickendorf
Ihr Berliner Servicepartner für Fenster Reparaturen/Umbau/Neubau/Wartungen für den gesamten Berliner Raum und Brandenburg. Seit nunmehr über 20...
fensterdurchblick.com Berlin Fenster Reparatur Fensterbau Tren Sonnenschutz Markisen Montage
109 Entrümpelung Berlin Entrümpelung
Entrümpelung vornehmen lassen – Ihr Ansprechpartner in Berlin Wir übernehmen sogar die Entrümpelung Ihres Grundstücks und sind jederzeit...
aflex.berlin Berlin Entrümpelung Aflex Entsorgung Wohnungsauflösung Dachboden Wohnung Sperrmüll
110 Antiquitäten Schmuck und Altgold Ankauf Berlin Antiquitäten
Antique Galerie: Hier können Sie Antiquitäten, Altgold, Schmuck und Diamanten in Berlin Lichterfelde verkaufen. Der Schmuckankauf der...
antiquegalerie.de/standorte/antiquitaeten-berlin-lichterfelde Antiquitäten Kurfürstendamm Berlin Händler Verkauf Ankauf Info@antiquegaleriede Finden
111 Antiquitäten Schmuck und Altgold Ankauf Berlin Antiquitäten
Antique Galerie: Hier können Sie Antiquitäten, Altgold, Schmuck und Diamanten in Berlin am Kurfürstendamm verkaufen. Der Schmuckankauf...
antiquegalerie.de/standorte/antiquitaeten-berlin Z Y
112 Pia Gabel Beratung Unternehmensberatung
Ludwigsfelde (Berlin)
Generalist unter den Beratern: Strategie, Organisation und Marketing. Beratungsthemen richten sich auf Wachstum, Innovation und Unternehmensgründung, Corporate...
piagabel.com Strategie Marketing Kundenfokussierte News Beratung Innovation Gabel Angebotsanfrage
113 Naturheilpraxis Anke Bentler Heilpraktikerin
Schöne Naturheilpraxis im Westphälischen Viertel von Moabit, in der Nähe vom Hansaplatz. Seit 2010 biete ich Akupunktur...
ahk-berlin.de Bentler Anke Naturheilpraxis Berlin Kynotherapie Homopathie Akupunktur Homöopathie
114 Vergleichs-Berichte Versicherung
Wir stellen auf dieser Seite unterschiedliche Vergleichs-Berichte und Tests von Versicherungen und Policen vor. Alle Tests können...
vergleichs-berichte.de/ Berichte Rente Vergleichs Gewerbe Riester Baufinanzierung Berufshaftpflicht Versicherungsvergleich
115 Augencremes-Testsieger Beauty
Wir stellen unterschiedliche Cremes von Hersteller für die Region der Augen vor. Erkennen Sie, welche Leistungsvariationen bestehen....
augencremes-testsieger.de/ Augencreme Anti Cream Augen Platz Augenpflege Falten Eye
116 Heiko Nusche Bauausführung GmbH Baugewerbe
Meisterbetrieb für Betonbau-, Maurer-, und Fliesenlegerarbeiten im Südosten der Hauptstadt Berlin. Ob Neubau, Umbau, Instandsetzung oder Modernisierung...
bauausfuehrung-berlin.de Berlin Bauausführungen Betonbauarbeiten Maurerarbeiten Bauausführung Fliesenlegerarbeiten Maurer Maurermeister
117 Container online sicher und günstig bestellen Containerservice
Containerdienst.de ist Ihr zuverlässiger Containerdienst und Containerservice zum Container mieten und Container bestellen bundesweit. Hier finden Sie...
containerdienst.de Container Entsorgen Holz Bauschutt Erdaushub Entsorgung Dachpappe Verpackungen
118 ml seodesign - mobile seo website Webdesign Mobile
Prof. Webdesign, Mobile SEO Website in Responsive Design, Google PageSpeed Test auf Mobile SEO-Optimierung für Mobilgeräte, Website Relaunch -...
mobile-seo.website/ Mobileseo Website Webdesign Oben Optimierung Seo Responsive Design
119 Saubere Tankreinigung und Demontage von Heizöltanks Tankschutz
Tankreinigung und Demontagen zum Festpreis. Sauber, Schnell und Zuverlässig durch den Familienbetrieb aus Berlin. Mit Modernsten Maschinen...
oeltank-service.eu Preise Leistung Tankdemontage Ablauf öltankreinigung Tankreinigung Demontage Tobias
120 der weg zur wunschyacht Beratung
Mit der richtigen Anwendung der Kybernetik finden sie ihren persönlichen weg zur passenden Yacht auch ohne Vorkenntnisse....
segelyacht-auswahl-berater.de Weg Yacht Code Wunschyacht Navigation Personal Rom Ermittelt
121 Sightseeing Point GmbH Stadtführungen
Es werden über 60 Stadtführungen zu Fuß, per Bus, Rad und Schiff in Berlin und Potsdam angeboten....
122 Fach- und Rechtsanwältin Gabriele Brandenburg Fach- und Rechtsanwältin Gabriele Brandenburg Rechtsanwalt
Anwaltskanzlei für Arbeitsrecht, Sozialversicherungsrecht, Steuerrecht und Gesellschaftsrecht in Berlin Friedenau-Steglitz direkt am U-Bahnhof Walther Schreiber-Platz. Rechtsanwältin Gabriele...
rabrandenburg.de Arbeitsrecht Sozialrecht Gesellschaftsrecht Steuerrecht Rechtsgebiete Unfallrecht Rechtsanwalt Brandenburg
123 Vollnarkose Zahnbehandlung Zahnklinik Zahnarzt
BERLIN-KLINIK ist ein staatlich zugelassenes Berliner Krankenhaus für die Fachbereiche MKG Mund- Kiefer- Gesichtschirurgie und Plastische Operationen....
berlin-klinik.de Berlin Klinik Master Implantologie Zahnarzt Gesellschaft Spezialist Klinik®
124 Eventschiff für Feier Party Incentive Tagung Schiffahrt
Berlin : Sightseeing | Feiern | Party | Tagung auf dem Wasser ! Herzlich willkommen an Bord zu...
eventschiff.eu Berlin Potsdam Bord Ahoi Boot Yachting Wasser Feier
125 argo.berlin Werbeagentur
Wir entwickeln mit Ihnen gemeinsam günstige Werbung für Ihr Unternehmen, die wirklich funktioniert. Facebookwerbung ...
126 Diamanten Ankauf Haeger Berlin Lichterfelde Juwelier
diamanten-haeger.de/diamantenankauf-berlin-lichterfelde Diamanten Ankauf Haeger Ertes Formular Leben Wie Schönen
127 Diamanten Ankauf Haeger Berlin Kurfürstendamm Juwelier
diamanten-haeger.de/diamantenankauf-berlin-kurfuerstendamm Diamanten Ankauf Haeger Edelmetalle Familie Diamantengroßhandel Wie Generationen
128 Versicherung 24 7 Finance
KFZ-Versicherung-Vergleich: Alle Angebote auf einen Blick Ihre jetzige Versicherung kostet Ihnen zuviel und bietet Ihnen nicht die Versicherungs-Leistungen...
versicherung-online-vergleich.net/ Versicherungen Garantieversicherung Grundsicherung Rente Versicherung Neuwagen Kfz Beiträge
129 Physiotherapie Myoreflextherapie Lymphdrainage Rückenschule Schwindeltherapie Atlastherapie Physiotherapie Krankengymnastik
Ich habe mich als Physiotherapeut selbstständig gemacht um mir Zeit für Sie zu nehmen. Mit einem individuell...
praxis-minarski.de Inhalte Seiten Gesundheit Daten Johannes Minarski Betreiber Behandlung
130 Fahrrad Flöckner am Alex - Cube Fahrradhandel
131 Haeger GmbH Goldankauf Berlin Lichterfelde Goldankauf
Die beiden Filialen von Goldankauf Haeger in der Hauptstadt stehen Ihnen jederzeit offen, wenn Sie Barren aus...
goldankauf-haeger.de/berlin Z Y
132 Franziska Oehler - DirektSEO Online Marketing
Bei DirektSEO in Berlin berate ich Sie individuell zu den Themen Suchmaschinenoptimierung (SEO), Suchmaschinenmarketing (SEM), zur Gestaltung...
direktseo.de/ Suchmaschinenoptimierung Marketing Social Media Suchmaschinenwerbung Analyse Beratung Webseite
133 Franziska Oehler - DirektSEO Online Marketing
Bei DirektSEO in Berlin berate ich Sie individuell zu den Themen Suchmaschinenoptimierung (SEO), Suchmaschinenmarketing (SEM), zur Gestaltung...
direktseo.de/ Suchmaschinenoptimierung Marketing Media Social Suchmaschinenwerbung Beratung Analyse Design
134 MANZEL Unternehmensentwicklung GmbH Unternehmensberatung
Die MANZEL Unternehmensentwicklung GmbH berät, begleitet und unterstützt aktiv mittelständische Unternehmen bei Gründung, bei Wachstum, strategischer Neuausrichtung...
manzel.de/ Berlin Unternehmensentwicklung Seminare Unternehmen Manzel Personalentwicklung Trainings Unternehmensberatung
135 F + S Software GmbH Software
Die F + S Software GmbH gilt als Spezialist für die Softwareentwicklung im Bereich Werkzeugverwaltung, Werkzeugmanagement und...
f-s.de/ Software Werkzeugverwaltung Lagerverwaltung Mobile Lösungen Werkzeugmanagement Logistik Management
136 Detektei
Detektei für den Raum Berlin....
detektei-aplus.de/dependancen/detektei-berlin.htm Berlin Detektei Plus Detektiv Detektive Ermittlungen Wirtschaftsdetektei Einsatzort
137 Messi Wohnung entrümpeln Entrümpelungen
Messi Wohnung entrümpeln lassen in Berlin Messie Haushaltsauflösungen sofort Räumungen Entrümpelungen....
whgreumung.de/ Berlin Wohnung Entrümpelung Messi Möbel Sperrmüll Preis Entrümpeln
138 Produktfotografie Berlin Fotografie
Photos4shops ist eine Full Service Foto Agentur in Berlin. Hier erhalten Unternehmen für Ihre Onlinepräsentation und für...
photos4shops.com Produktfotografie Glasware Chromware Lesen Packshot Legeware Berlin Agentur
139 Zauberkünstler Berlin Zauberer
Zauberei für Groß und Klein bietet der Zauberkünstler Fabian Schneekind aus Berlin. Der Zauberkünstler kann für folgendes gebucht...
fabianschneekind.de Google Website Berlin Analytics Erfassung Ip Daten Zauberer
140 DYWAG Projekt- u. Wohnungsbauverwaltungsgesellschaft mbH & DYWAG Projekt- u. Wohnungsbauverwaltungsgesellschaft mbH & Bauunternehmen
Wir bieten Ihnen einen zuverlässigen Baupartner Service im Neubau, in der Sanierung, im Bestand und in der...
dywag.de Bauunternehmen Wohnungsbau
141 beleuchtungdirekt.de Leuchtmittel Onlinehandel
Wenn man hochwertige und energiesparende LED Leuchtmittel benötigt, sollte man zuerst im Onlineshop von beleuchtungdirekt.de nachsehen. Wir...
beleuchtungdirekt.de/ Lampen Philips Leuchtstofflampen Lieferung Osram Email Energiesparlampen Led
142 Produktfotografie Berlin Fotografie
Photos4shops Berlin bietet deutschlandweit professionelle Produktfotografie für diverse Unternehmen im Bereich E-Commerce. Hier erhalten Sie qualitativ hochwertige...
photos4shops.com Packshot Glasware Berlin Hollow Agentur Produktfotografie Kleider Legeware
143 George & Partner mbB Rechtsanwälte Gesellschaftsrecht Rechtsanwalt
Die Kanzlei George&Partner ist Ihr Partner für Gesellschaftsrecht. Wir stehen Ihnen mit Rat und Tat zur Seite...
georgepartner.de/ Kanzlei George Gesellschaftsrecht = Fachanwalt Klienten Berlin Niels
144 Auto Ankauf und Export Berlin Auto Ankauf und Export Berlin Auto
Autoexport Berlin und Bundesweit Bei uns sind Sie auf der richtigen und sicheren Seite! Sie wollen Ihr...
ps-autoexport.de Auto Verkaufen Autoexport Ankauf Fahrzeuge Berlin Anbieten Probiere
145 Landsiedel NLP Training Berlin Bildung
NLP Ausbildung in Berlin, Weiterbildung, Erwachsenenbildung, Seminare zum Thema Persönlichkeitsentwicklung und Kommunikation mit NLP...
landsiedel-seminare.de/nlp/nlp-in-berlin.html Nlp Coach Tage Berlin Ausbildung Coaching Trainer Master
146 Hochzeitsfotograf in Berlin - Fotos eurer Hochzeitsfotograf in Berlin - Fotos eurer Hochzeitsfotograf
Hochzeitsfotograf in Berlin – Fotos Eurer Hochzeit Fotos Eurer Hochzeit – Der Hochzeitsfotograf in Berlin für gefühlvolle Hochzeitsfotos...
fotos-eurer-hochzeit.de Berlin Hochzeitsfotograf Hochzeit Galerie Preise Leistungen Hochzeitsblog Fotos
147 Pilch Dachbau GmbH Dachdeckerei
PILCH DACHBAU Ihr Dachdecker-Meisterbetrieb aus Berlin Wir lieben Dächer, wir lieben unsere Arbeit. Und so machen wir sie auch....
pilch-dachbau.de Berlin Einblasdämmung Pilch Dachdecker Dachbau Dachdeckerei Flachdachabdichtung Dachbegrünung
148 Heiraten in Dänemark — leicht und Hochzeitsplannung
Agentur Konstannta begleitet Kunden auf dem Weg zur schönen Heirat in Dänemark. Wir bieten schnelle Termine und...
konstannta.de/ Dänemark Heiraten Schnell Leicht Anerkennung Standesamt Legalisierung Deutschland
149 ATI Umzüge Umzugsunternehmen Berlin Umzugsfirma Berlin
ATI Umzüge Umzugsunternehmen aus Berlin. Wir führen kostengünstige Umzüge europaweit durch. Unsere Umzugsfirma bietet Ihnen faire Festpreisangebote...
ati-umzuege.de Berlin Info@ati Umzuegede Umzugsmaterial Halteverbot Zahlung Bestellen Entsorgung
150 Umzugshelfer Berlin | Das Original Umzug
Die Umzugshelfer Berlin sind Ihre familiengeführte und zuverlässige Umzugsfirma aus Berlin-Charlottenburg. Wir führen private und gewerbliche Umzüge...
umzugshelfer-berlin.de/ Berlin Umzugshelfer Umzugshilfe Seit ✔ ♥ Professionelles Rufen
151 Kristall Umzüge Berlin - Umzugsfirma Berlin Umzug
Sie benötigen ein professionelles Umzugsunternehmen in Berlin, welches sich rund um den Umzug, Lagerung und Entrümpelung in...
kristall-umzuege.de Berlin Umzug Umzüge Umzugsmaterial Wohnungsauflösung Umzugshelfer % Umzugsunternehmen
152 Ipilum Websolutions E- Commerce
Unser Kerngeschäftsfeld ist seit über 14 Jahren die Entwicklung unseres modularen Ipilum Shop Systems anhand der Bedürfnisse...
ipilum.com Commerce Shopsystem Ipilum Webdesign Hosting Re Solutions Folgen
153 Sperrmüllabholung Entrümpelungen Haushaltsauflösungen
Sperrmüllabholungen Recycling Dienst Lemt sofort Entsorgunsdienst Eilservice Müll Entrümpelungen Haushaltsauflösungen....
lemt.de/ Recycling Entrümpelung Lemt Berlin Müll Eilservice Sperrmüllabholung Keller
154 BellaVital Kosmetikstudio Berlin Kosmetikstudio
Kosmetikstudio Berlin: Unweit vom Kurfürstendamm werden Sie von Kopf bis Fuß verwöhnt. Bei BellaVital, dem Kosmetikstudio in...
bellavital.de Laser Kosmetikstudio Berlin Wellness Kosmetik Bellavital Kudamm Termin
155 Anwalt Familienrecht Berlin - Schulz & Anwalt Familienrecht
Anwalt Familienrecht Berlin - Schulz & Deutschmann: Rechtsberatung bei Scheidung, Sorgerecht und Unterhaltszahlungen! Sie haben einen Notfall...
anwalt-scheidung-familienrecht.de Familienrecht Anwalt Berlin Scheidung Sozialrecht Sorgerecht Kostenlose Scheidung Rechtsgebietefamilienrecht
156 EMS-Training in der fitbox Weissensee Personal Training
Die fitbox Weissensee ist der Partner den du gesucht hast. Direkt an der Tram Haltestelle Albertinenstraße. kannst...
fitbox.de Training Ems Artikel Personal Vorverkauf Trainer Fragen Trainingsablauf
157 Flink Umzüge und Lagerung Umzugsunternehen
Flink Umzüge aus Berlin ist für Sie zur Stelle, ob beim Umzug oder Transport von und nach...
flink-umzuege.de/ Umzüge Umzug Umzugsunternehmen Umzugshelfer Entrümpelung Umzugsmaterial Einlagerung Entsorgung
158 Heilpraktiker Marzahn-Hellersdorf Heilpraktiker
Die Heilpraktikerin Sabrina Pfützner sogrt wieder für Wohlbefinden durch alternative Behandlungsmöglichkeiten: Autoimmunerkrankungen, Burn-Out Symptomatiken, rheumatische Erkrankungen, Magen-Darm-Erkrankungen und...
gesundes-menschenleben.de Behandlung Naturheilpraxis Ernährung Homöopathie Sabrina Nns Pfützner Miasmatik
159 Steuerkanzlei Merla Steuerberater
Ihr Steuerberater in Berlin Charlottenburg-Wilmdersdorf - Steuerliche Beratung von Unternehmen - Steuerliche Beratung von Privatpersonen - Internationales Steuerrecht - Existenzgründerberatung...
steuerkanzlei-merla.de Berlin Steuerberater Merla Steuerkanzlei Charlottenburg Kanzlei Wilmersdorf Wilmdersdorf
160 Schachshop in Berlin Schach und
Seit 1980 von Heide Ketterling geführtes Spezialgeschäft für Schachbedarf, Schachfiguren, Schachbretter, Schachbücher, Schachcomputer, Schachprogramme, Schachsoftware...
elektroschach.de Elektroschach Schachuhren Eröffnung Mittelspiel Endspiel Schachcomputer Alte Neuheiten
161 Schachshop in Berlin Schach und
Seit 1980 von Heide Ketterling geführtes Spezialgeschäft für Schachbedarf, Schachfiguren, Schachbretter, Schachbücher, Schachcomputer, Schachprogramme, Schachsoftware...
elektroschach.de Elektroschach Endspiel Schachuhren Mittelspiel Eröffnung Pokale Literatur Pc
162 BW Bestwert Immobilien GmbH Immobilienmakler
Die BW Bestwert Immobilien GmbH ist Ihr kompetenter Partner in Sachen Denkmalimmobilien. Wir bieten Ihnen das volle...
bestwert.de Vertriebspartner Bestwertde Kapitalanlage Denkmalimmobilien Uns Lukrativen Bestwert Objekte
163 Steuerkanzlei Merla Steuerberater
Ihr Steuerberater in Berlin Charlottenburg Sie suchen einen Steuerberater in Berlin zur Unterstützung bei Ihrer Buchhaltung, Ihrer Steuererklärung...
steuerkanzlei-merla.de Berlin Steuerberater Merla Steuerkanzlei Kanzlei Charlottenburg Steuerberatung Erstgespräch
164 Zäune aus Polen Garten

Die Firma Ampanel gehört zu den erfahrensten polnischen Herstellern von hochwertigen Zäunen jeder Art. Seit mehreren Jahren...
ampanel.de Panel Zaun Moderne Zaunsysteme Zaunfelder Zäune Preisen Schreiben
165 Goldankauf Berlin Goldankauf Haeger GmbH Goldankauf
Der Goldankauf in Berlin: In vielen Haushalten schlummern Werte, die ihren Besitzern gar nicht bekannt sind. Möglich...
goldankauf-haeger.de/berlin Berlin Ankauf Goldmünzen Goldankauf Kaufen Verkaufen Anfahrt Goldbarren
166 Haushaltsauflösung und Entrümpelung Berlin Haushaltsauflösung
Entsorgungen und Wohnungsauflösungen mit der Haushaltsauflösung und Entrümpelung Berlin. Faire Preise und eine hohe Kompetenz zeichnet das...
haushaltsaufloesung-entruempelung-berlin.de Berlin Haushaltsauflösung Entrümpelung Zeit Entsorgung Denn Berlin * Berg
167 Jakob Bauer Infomarketing GbR DROHNE ZERFETZT
Jetzt Drohnen Versicherung abschliessen ➜ 100% Versicherungs-Schutz nach dt. Luftfahrt Gesetzgebung. JETZT Drohne oder Quadrocopter versichern....
versicherungdrohne.de/ Drohne Drohnen Versicherung Versichertedrohnede Haftpflichtversicherung Kaufen Nutzung Schaden
168 MOBIX mobile Diskothek Diskjockey
Mobix mobile Diskothek ist die mobile Disco mit professionellem DJ für jeden Anlass in Berlin und Brandenburg....
mobix-diskothek.de Berlin Dj Mobile Hochzeit Disco Diskothek Party Hochzeits
169 Dudelsack Unterricht in Berlin Musikunterricht
Dudelsack Unterricht für Totalanfänger bis Fortgeschrittene, für Kinder (ab 10 Jahre), Jugendliche und Erwachsene in Berlin Friedrichshain -...
facebook.com/dudelsackunterricht.berlin Erstellen Karriere Seiten Uns Registrieren Werbeanzeige Orte Lite
170 Mit Videocoaching IHK Wirtschaftsfachwirt werden Wirtschaftsfachwirt
Willkommen bei den Onlinelehrvideos von Dr. Marius Ebert - Mit effektiven Schnell-Lern-Systeme Prüfungen besser bestehen. Wir bieten...
wirtschaftsfachwirt-in-ihk.de Wirtschaftsfachwirt Lehrgang Wirtschaftsfachwirtin Geprüfter Videos Staatlich Ihk Prfung
Kosmetik Behandlungen mit wertvollen Wirkstoffen zur Hautbildverbesserung für Damen & Herren abgestimmt auf Ihre hautspezifischen Bedürfnisse....
kosmetik-institut-berlin.com Kosmetik Carisma Preise Maniküre Kosmetikbehandlungen Salon Fußpflege Kosmetikprodukte
172 Travestie Show Berlin Alleinunterhalter Partyservice

Sie möchten Ihre Gäste gekonnt unterhalten? Sie suchen das Besondere? Damit Ihre Veranstaltung ein voller Erfolg wird...
travestie-berlin.com/ Travestiekünstler Veranstaltung Moderation Izora Montaniere Live De Travestie
173 Velonest c o TenMedia UG (haftungsbeschränkt) Fahrrad
Velonest bietet einen Marktplatz für Fahrradfreunde. Auf dem Portal können Händler und Privatpersonen ihre Fahrräder kostenfrei inserieren....
velonest.com Fahrrad Fahrräder Gebrauchte Forum Gebraucht Markt Kaufen Hilfe
174 iPhone Handy Reparatur Berlin IPhone Handy
Möchten Sie Ihr iPhone reparieren lassen? Wir bieten Ihnen eine schnelle und zuverlässige Handy Reparatur. Günstig reparieren...
handy-reparatur-berlin.com Apple Iphone Samsung Galaxy Ipad Reparatur Sony Xperia
175 Autoreinigung Noack Autoreinigung
Möchten Sie Ihren PKW reinigen oder pflegen lassen? Wir bieten Ihnen die günstige Autoreinigung in Berlin. Unser...
autoreinigung-noack.de Berlin Nanoversiegelung Autopflege Fahrzeugaufbereitung Autoreinigung Noack Scheibenversiegelung Innenreinigung
176 Ausbildung Berlin Ausbildung Weiterbildung
Berufliche Veränderung gefällig? Wir bieten Ihnen Ausbildung, Weiterbildung und Umschulung, die unter anderem auch gefördert werden kann. In...
dub-berlin.de Berlin Ausbildung Bildung Umschulung Sozialassistent Uhr Frau Einzelhandel
177 Sperrmüll Berlin Entrümpelung
Benötigen Sie eine Entrümpelung und Entsorgung von Sperrmüll? Wir übernehmen die Entrümpelung aus Büro, Keller, Wohnungen und...
sperrmuell-entsorgung-entruempelung.de Berlin Sperrmüll Entrümpelung Entsorgung Messi Möbeltaxi Keller Firma
178 Sperrmüll Berlin Entrümpelung
Preiswert Sperrmüll in Berlin. Benötigen Sie eine Entrümpelung und Entsorgung von Sperrmüll? Wir übernehmen die Entrümpelung aus...
preiswert-sperrmuell-berlin.de Berlin Sperrmüll Entrümpelung Entsorgung Sperrmüllentsorgung Firma Kellerauflösung Sperrmüllabholung
179 Möbeltaxi Berlin Möbeltaxi
Ihr Möbeltaxi in Berlin für Möbeltransporte jeder Art. Die Firma Flitzer-Möbeltaxi steht Ihnen für Kleintransporte, Möbeltransporte, Miniumzüge...
moebeltaxi-moebeltransport-berlin.com Berlin Möbeltaxi Flitzer Möbeltransport Entrümpelung Entsorgung Möbeltransporte Kleintransporte
180 Möbeltaxi Berlin Möbeltaxi
Ihr Möbeltaxi in Berlin für Möbeltransporte jeder Art. Die Firma Flitzer-Möbeltaxi steht Ihnen für Kleintransporte, Möbeltransporte, Miniumzüge...
moebeltaxi-moebeltransport-berlin.com Berlin Möbeltaxi Flitzer Entrümpelung Möbeltransport Entsorgung Transport Kleintransporte
181 Kinderarzt Berlin Gesundheit
Der Kinderarzt Dr.Zia steht unseren jungen Patienten mit Kompetenz und Erfahrung zur Seite. Impfungen, Grippe, Vorsorge. Der...
kinderarzt-berlin-zia.de Berlin Kinderarztpraxis Kinderarzt Charlottenburg Jahre Monate Wilmersdorf Impfung
182 Kinderarzt Berlin Gesundheit
Der Kinderarzt Dr.Zia steht unseren jungen Patienten mit Kompetenz und Erfahrung zur Seite. Impfungen, Grippe, Vorsorge. Der...
kinderarzt-berlin-zia.de Berlin Kinderarztpraxis Kinderarzt Charlottenburg Jahre Monate Navigation Impfung
183 X Parking Flugreisen
Wer eine Flugreise von Berlin Tegel aus plant und einen Parkplatz benötigt, ist bei der Firma X...
flughafen-berlin-parkplatz.de Tegel Flughafen Parkplatz Berlin Parken Airport Reservierung Preise
184 United Leonidas Objektschutz &
Das Sicherheitsunternehmen aus Berlin, steht Ihnen für Ihren Objektschutz gerne zu Ihrer Verfügung. Ob Hotel, Gebäude, Ladenflächen...
security-objektschutz.com Objektschutz Berlin Sicherheitsunternehmen Brandschutz Erfüllt Objektschutzaufgaben Stunden Professionell
185 AGAS Hotel Berlin Hotel Berlin
Das Agashotel in Berlin, hat seinen Sitz in Berlin - Lichtenberg. Das Hotel verfügt über komfortable Hotelzimmer...
agashotel.de Berlin Hotel Agas Hauptstadt Buchen Urlaub Lichtenberg Aufenthalt
186 Steuerberater Berlin Steuerberater
Der Steuerberater in Berlin Lars Franke, ist ein zuverlässiger Steuerberater für Ihr Unternehmen. Ob Existenzgründer, Einzelunternehmen oder...
stb-franke.de Steuerberater Berlin Steuerbüro Steuerberatung Buchführung Steuerrecht Veranstaltungen Charlottenburg
187 Tempo Umzüge Berlin Umzugsfirma
Das Umzugsunternehmen Tempo Umzüge aus Berlin, ist ein kleines, noch junges, dennoch professionelles Umzugsunternehmen für Umzüge und...
tempo-umzuege.de Umzug Umzüge Berlin Deutschland Möbeltransporte Umzugsunternehmen Kleintransporte Büroumzug
188 Umzugsfirma Berlin Stark Umzüge
Stark Umzüge Berlin. Wer einen Umzug plant, oder durchführen lassen möchte, kann sich auf Stark Umzüge Berlin...
umzugsfirma-stark.de Umzug Berlin Uns Umzugsunternehmen Selbstverständlich Dass Blog Umzugsdecken
189 Lotjonn Transporte Düsseldorf Umzug &
Lotjonn Transporte in Düsseldorf, ist Ihr zuverlässiges Umzugsunternehmen, wenn Sie einen Umzug nach Düsseldorf, aus Düsseldorf nach...
lotjonn-transporte.de Umzug Unternehmensauflösungen Direkt Antiquitätentransporte Ihr Firmenumzug Gartenentsorgungen Wohnungsauflösungen
190 Igel Umzüge Berlin Umzugsfirma
Igel Umzüge Berlin. Die Umzugsfirma aus Berlin, verfügt über einen professionellen Umzugsservice. Für Umzüge jeder Art, ist...
igel-umzuege.de Umzüge Berlin Umzug Uns Besuchen Umzugsunternehmen Entsorgung Info@igel
191 Umzugsunternehmen Berlin Umzugsfirma
Wichtel Umzüge Berlin, ist ein professionelles Umzugsunternehmen in Berlin. Mit gutem Umzugsservie und freundlichen Umzugshelfern, steht Ihnen...
wichtel-umzuege.de Berlin Umzug Umzüge Umzugsunternehmen Umzugshelfer Umzugsfirma Umzugsanfrage Entrümpelung
192 Restaurierung am Oberbaum GmbH Resaurator
Die Kernbereiche der Tätigkeiten von RAO (Restaurierung am Oberbaum GmbH) liegen in der Denkmalpflege, der musealen und...
rao-berlin.de Restaurierung Restauratoren Englisch | Deutsch English Berlin Rao
193 Detektei AC Online Detektei
Wirtschaftsdetektei und Privatdetektei. Privatdetektive ermitteln Wir bietet Ihnen ein globales Netzwerk an unterschiedlichen Privatdetektei Organisationen. Wobei die Schwerpunkte...
detektei ac online
194 Essen und Trinken Restaurant
Das Restaurant „Spandau Diner“ mit amerikanischer, deutscher und vegetarischer Küche zieht durch sein vielfältiges Angebot viele...
spandau-diner.de Spandau Angebote Karte Burger Feiern Diner Mittagsangebot Events
195 Bowling Zubehör Bowling
Sie finden im Bowling Pro Shop nicht nur alle gängigen Artikel Bowlingkugeln oder vieles rund um...
bowling pro shop
196 Bowling Bowlingbahn
Die Bowlingbahn ist ein lebendiger und beliebter Treffpunkt für Freizeitsportler, Sportbowler, Senioren, Familien- und Freundesrunden, welche überzeugte...
bowlingarena-spandau.de Bowling Spandau Arena Ergebnisse Shop Bowlingbahn Anfahrt Weihnachtsfeier
197 Immobilien3 Immobilienmakler
Immobilien3 - Ihr Immobilienunternehmen für Marzahn - Hellersdorf, Biesdorf, Mahlsdorf, Kaulsdorf, Köpenick & Pankow. Sie möchten sich verändern...
immobilien3.de Berlin Immobilien Mahlsdorf Pankow Immobilie Hellersdorf Biesdorf Eigentümer
198 Smoke & Soul Band - Hochzeitsband Partyband
Wir bieten Ihnen die passende musikalische Umrahmung für Ihre Veranstaltung, ob Hochzeit, Party oder Firmenevent. Die Smoje &...
smokeandsoulband.de/ Band Live Berlin Hochzeitsband Partyband Soul Musik Professionelle
199 Franchiseverband Franchiseberatung
Der Deutsche Franchise-Verband e. V. (DFV) ist der Spitzenverband der deutschen Franchise-Wirtschaft. Der DFV wurde 1978 gegründet...
franchiseverband.com/ Franchise Verband Dfv Selbstständig Systemfinder Systemaufbau Mitglied Erfolgreicher
200 Sperrmüllabholung Berlin Haushaltsauflösung Entrümpelung
Sperrmüll Abholungen in Berlin Recycling Eildienst Sperrmüllabholungen Haushaltsauflösungen Service....
lumk.de/ Lumk Berlin Sperrmüll Sperrmüllabholung Entrümpelungen Pauschal Holz Recycling
201 Ganzjahresreifen Testsieger Auto
Auf dieser Seite stellen wir euch Ganzjahresreifen vor. Weiterhin werden die aktuellen Testsieger von Stiftung Warentest und...
ganzjahresreifen-testsieger.de/ Ganzjahresreifen Test Reifen Kumho Doch Stiftung Tests Goodyear
202 Ergotherapeutische Praxis für Entwicklungsförderung Johanna Kalarus Ergotherapie
In der Praxis werden Kinder und Jugendliche ganzheitlich behandelt und somit in ihrer Entwicklung unterstützt und gefördert....
ergotherapie-kalarus.de Kalarus Praxis Johanna Ergotherapeutische Ergotherapie Pankowkindern Ausgebildet Fachergotherapeutin
203 Physiofit-Praxis für Physiotherapie und myofasziale Schmerztherapie Physiotherapie Gesundheitswesen
Seit über 13 Jahren besteht die Praxis Physiofit in den Räumen einer Stadtvilla im Süden Zehlendorfs. Schwerpunkt dieser...
physiofit-berlin.de Schmerzen Chronische Praxis Physiotherapie Berlin Hilfe Akute Selbsthilfe
204 HELJO INDUSTRIES Wartungsservice
INDUSTRIELLE INSPEKTIONEN MIT DROHNEN Präzise & Hocheffektiv HELJO INDUSTRIES ist eine Inspektionsfirma, die sich auf den Einsatz von moderner...
heljo.industries/ Z Y
205 time2cross AG Online-Agentur
Wir sind einer Internetagentur mit umfangreichem Leistungsangebot rund um das Internet. Dies umfasst insbesondere Webentwicklung, Webdesign, Online...
time2cross.de/ Marketing Content Social Media Onlineshops Module Leistungen Design
206 Spree Gerüstbau GmbH Gerüstbau
Ihr perfekter Partner für den Gerüstbau sind wir von der Spreegerüstbau GmbH. Seit November 2006 sind wir...
spreegeruestbau.de/standorte/berlin/ Berlin Gerüstbau Spree Luckau Mail Gerüste Standorte Denn
207 Kfz- Sachverständiger Kfz- Sachverständiger
Für mich steht an erster Stelle, den gesamten Schadensumfang für den Geschädigten genau festzustellen und Ihn bei der...
kfz-unfall-gutachten-berlin.de Gutachten Kfz Berlin | Regulierung Prüfungen Unfall Direkt
208 Voslamber Praxis für Kieferorthopädie Kieferorthopäde
Die Kieferorthopädin, Dr. Christine Voslamber, bietet in Ihrer Praxis u. a. die Behandlung von Zahn- und Kieferfehlstellungen...
kieferorthopaede-in-berlin.de/ Invisalign Voslamber Berlin Behandlung Teen Kieferorthopädie Christine Kieferorthopäde
209 Lohndata Gehaltsabrechnung
Lohndata ist seit 1981 spezialisierter Dienstleister für das Outsourcing der Lohnabrechnung im Vollservice. Unser Lohnbüro im Herzen...
lohndata.de Navigation Lohndata Lohn Unternehmen Lohnbüro überspringen Gehaltsabrechnung Lösung
210 Schlüsseldienst Marzahn Schlüsseldienst
Sofortige Hilfe bei zugezogener Tür bietet der Schlüsseldienst Marzahn an. 24Std. Service- Rund um die Uhr sind...
schluesseldienst-marzahn-24std.de Schlüsseldienst Marzahn Berlin Schloss Türen Türöffnungen Montagen Schlüsselnotdienst
211 Haushaltsauflösung Berlin Reinickendorf Haus Wohnung
Haushaltsauflösung Berlin Reinickendorf Sperrmüllservice Eildienst Auflösungen von Keller Wohnung sofort Recycling Dienst....
berlin-eildienst.bplaced.net/ Haushaltsauflösung Berlin Reinickendorf Sperrmüll Pauschal Dienst Entrümpelung Entrümpelungsdienst
212 Haushaltsauflösung Berlin Reinickendorf Haus Garten
Haushaltsauflösung Berlin Reinickendorf Sperrmüllabholungen Eildienst Pauschal Service Wohnung Keller Entrümpelungen....
berlin-eildienst.bplaced.net/ Haushaltsauflösung Berlin Reinickendorf Dienst Entrümpelung Pauschal Sperrmüll Hotline
213 Fotostudio Uhlandpassage Heinz-Werner Schawe Fotograf
Wir begrüßen Sie im Fotostudio vom Photograph Hans-Werner Schawe - hier bekommen Sie professionelle Bewerbungsfotos und Businessfotos...
fotograf-charlottenburg-wilmersdorf.de Berlin Charlottenburg Fotostudio Fotograf Bewerbungsfotos Wilmersdorf Businessfotos Uhlandpassage
214 Ganzjahresfeuerwerksladen Pyro Thron GmbH in Berlin Feuerwerk
1. und einziger Ganzjahresfeuerwerksladen Deutschland Pyro Thron GmbH Bahnhofstrasse 05 12555 Berlin Köpenick. Hier erhält man alles was...
pyrothron.com/ Artikel Jorge Feuerwerk Schuss Solas Abreißzünder Handlichtfackel Weiß
215 Silent Disco Kopfhörer Events
Silent Disco Kopfhörer party ALLES, WAS IHR BRAUCHT, UM EINE SILENT DISCO DURCHZUFÜHREN Silent Disco Berlin Vermietet und Verkauft...
silentdiscotheque.com/ Disco Silent Kopfhörer Kaufen Musik Sender Party Mieten
216 Rechtsanwalt Berlin anwalt-artiisik.de Rechtsanwälte
Die Kanzlei Anwalt-Artiisik.de mit Sitz in Berlin-Tiergarten (Moabit) betreut schwerpunktmäßig Mandanten im Bereich Verkehrsrecht, Verkehrsstrafrecht und Allgemeines...
anwalt-artiisik.de Verkehrsrecht Berlin Kanzlei Rechtsanwalt Strafrecht Bußgeld Steuer Ersteinschätzung
217 Film und Serien Produktionsstudio Medienproduktion
Hallo und Herzlich Willkommen bei Jerome Fisher Film und Serien Produktion , Wir sind ein...
jerome-fisher-filmstudio.de Z Y
218 FARAWAYHOME - Wohnen auf Zeit Wohnen Auf
#1 für möblierte Wohnungen & Serviced Apartments in Berlin. Mieten Sie eine von über 1.300 ausgewählten und...
farawayhome.de Apartments Log Berlin Verified Temporary Farawayhomede Living Offer
219 Mixer Tests Shop
In unserem Laden bekommen Sie eine intensive Beratung zum Thema Mixgeräte. Unter anderem gibt es bei uns...
mixertests.com Mixer Shop Leistung _ Verarbeitung Handhabung Preis _amazon_ Tests Verarbeitung _ Zubehör Stromverbrauch Bedienung _amazon_ Funktion Verarbeitung Geräte
220 Dr. med. Henning Frhr. v. Gregory Chirurgie
Praxis für Plastische, Ästhetische und Rekonstruktive Nasen- und Gesichtschirurgie...
drvongregory.de/ Op Berlin Gregory Notice Undefined Chirurgie Henning Plastische
221 Ing. Meinhard Böhm Sachverständiger für Holzschutz Sachverständiger Holzschutz
Rangsdorf bei Berlin
Wir untersuchen als Sachverständige für Holzschutz, Holztechnik und Schimmelpilzbewertung Holzkonstruktionen, Dachstühle und Holzbalkendecken und erstellen Holzschutzgutachten. Dei...
holzingenieur-boehm.de Holzgutachter Berlin Holzschutzgutachten Holzschutz Anhalt Brandenburg Holzschutzsachverständiger Sachsen
222 Hör Autoankauf Berlin24
Seit nun mehr als 25 Jahren ist unser Unternehmen im Bereich Gebrauchtwagen Ankauf tätig. Wir sind bundesweit...
autoankaufberlin24.de/ Berlin Ankauf Autoankauf Autoentsorgung Autoexport Unfallwagen Auto Lkw
223 Stadtführungen in Berlin Stadtführer
Stadtführer für standardisierte oder individuelle Stadtführungen, Stadtrundfahrten und Stadtrundgänge in Berlin Stadtführungen bereits ab zwei Personen! Ideal...
tourguideme-berlin.com Berlin Stadtführung Tour Stadtführer Stunden Ihrem Gruppen Sehenswürdigkeiten
224 Ganzjahresfeuerwerksladen Pyro Thron GmbH in Berlin Feuerwerk Pyrotechnik
Ganzjahresfeuerwerksladen Pyro Thron GmbH in Berlin – Köpenick Bahnhofstrasse 05 12555 Berlin PyroThron GmbH hat sich auf den...
pyrothron.com/ Artikel Feuerwerk Abreißzünder Jorge Solas Handlichtfackel Bengal Berlin
225 Hypnose Berlin Hypnose
Hypnose | Hypnocoaching: Gewichtsreduktion, Raucherentwöhnung, Lampenfieber, Sporthypnose, Liebeskummer, Flugangsthypnose, Entspannung....
coaching-place.de Hypnose Raucherentwöhnung Schlafen Sporthypnose Besser Entspannung Gewichtsreduktion Selbstvertrauen
226 Schlüsseldienst Marzahn Schlüsseldienst
Schlüsseldienst Marzahn - der Ansprechpartner für Notöffnungen zu jeder Tageszeit. Wir sind 24 Stunden an 365 Tagen...
schluesseldienst-marzahn-24std.de Marzahn Schlüsseldienst Berlin Schloss Türöffnungen Türen Wartungen Montagen
227 IMMOFIX Berlin - Immobilienmakler Immobilienmakler
IMMOFIX Berlin ihr Immobilienmakler für Exclusive Immobilien in Berlin & Brandenburg - überzeugen Sie sich von unserem...
immofix.berlin Berlin Einfamilienhaus Eigentumswohnung Verkaufen Immofix Brandenburg Immobilie Immobilienmakler
228 Wedding Planer Veranstaltungsservice
Wir bieten ihnen einen Komplett Service für ihre Veranstaltungen an. Ob vom kleinen Geburtstag bis hin zur Großen...
promore-event.com Webseite Technischen Störung Zurzeit Nichterreichbar   ____               links Nichterreichbar Unser Aufgrundstartseite *
229 Dachdecker Berlin Dachdecker
Ewald Rohde Bedachungs GmbH führender Anbieter in Berlin und Falkensee. Das Unternehmen Dachdecker Berlin Ewald Rohde hat jahrelange...
dachdecker-dachklempner.de Dachdecker Rohde Angebot Sanierung Betrieb Dachklempner Dächer Dachsanierung
230 IMMOFIX Berlin - Immobilienmakler Immobilienmakler
IMMOFIX Berlin ihr Immobilienmakler für Exclusive Immobilien in Berlin & Brandenburg - überzeugen Sie sich von unserem...
immofix.berlin Berlin Einfamilienhaus Immobilien Kaufen Immobilienmakler Brandenburg Immofix Ihr
231 Nolten - Die Studien- und Berufsberater Beratung
Studienberatung und Berufsberatung in Berlin Nolten - Die Studien- und Berufsberater bieten individuelle und professionelle Beratung für Personen...
nolten.de Berufsbild Berufsbilder Master Gallery Permalink Aktivitäten Wahl Ausland
232 WGBG Hausverwaltung Berlin Hausverwaltung
Ihre Hausverwaltung aus Berlin Einer starke Genossenschaft für die Entwicklung Ihrer Immobilien Unter dem Motto: Erfahrung, Wissen und Visionen...
wgbg.de Wgbg Hausverwaltung Sachbearbeitung Berlin Genossenschaft Vorstand Berliner Wirtschafts
233 Interviewer in verschiedenen Sprachen gesucht Marktforschung
Sie sprechen deutsch oder türkisch oder russisch oder polnisch? Dann melden Sie sich bei uns. Für unsere laufenden...
data4u-online.de Deutschland Migranten Türkische Deutsch Türken Türkischen Integriert Gut
234 Hunde & Katzensalon BLACK & WHITE Hundesalon Katzensalon
Hier wird wirklich noch professionell von Hand getrimmt! Das althandwerkliche Know-how macht aus jedem Vierbeiner wieder...
hund-e.de/ Black Hundesalon Dogs Coiffeur White Berlin Professionelle Köpenick
235 Bali Reisen Reisen
Bali Reisen zuverlässig buchen über Albatros. Das Experten - Team berät Sie ausführlich und erstellt die Urlaubsplanung....
balispezi.de Bali Resort Nächte Beach Tage € Ab Urlaub
236 Schütthaar im Test Kosmetik

Streuhaar / Schütthaar - ein Mehrwert schaffendes Produkt - leider noch wenig bekannt in Deutschland. Wenn Sie unter...
237 Haarausfall stoppen Gesundheit
Arten, Ursachen, Mittel und Erfahrungen mit Haarausfall kombiniert mit Experteninterviews mit den besten deutschen Haarmedizinern. Dieser Blog...
haarausfallen.de Haarausfall Erfahren Tun Erfahrungen Haare Deine Gesunde Nährstoffe
238 Gebrauchte Fahrräder in Berlin Fahrradladen
Wir haben ständig mehr als 100 gebrauchte Fahrräder im Angebot in unserem Fahrradladen in Berlin Kreuzberg. Unsere...
gebrauchtfahrradberlin.de Fahrräder Fahrrad Fahrradladen Gebrauchte Mobilcenter Berlin Fahrradfahren Thailand
239 Klempner Berlin Klempner
Klempner Berlin Notdienst - Rohrbruch, Wasserschaden, Verstopfung. Beseitigung jeglicher Verstopfung. Beseitigung und Trocknung von Wasserschäden, Abflussreinigung, Rohrreinigung...
klempner-berlin-24.de Klempner Verstopfung Bezirke Berlin Rohrbruch Notdienst Rohrreinigung
240 Schweisser Berlin Schweisser
Wir schweissen für Industrie, Gastronomie aber auch kleine Sachen im privaten Haushalt. Auch gerne kommen wir in...
schweisser-berlin.de • Berlin Schnell Edelstahlverarbeitung Schweissen Handwerksdienstleistungen Mobiles Geräte
241 AgenturWebfox GmbH Internet Typo3
AgenturWebfox ist Ihr Partner für die Realisierung von neuen Webseiten un Optimierung bestehender Internetpräsenzen. Als Full-Service Agentur...
webfox01.de Marketing Design Agentur Typo Konzeption Strategie Berlin Entwicklung
242 Freiberuflich Ihr Leiterplattenlayout mit Altium Designer Leiterplattendesign
Freiberufliche Unterstützung für Ihre Leiterplattenentwicklung: mit einer aktuellen Altium Designer Lizenz, eigener PC Ausrüstung und Fachwissen. EMV gerechte...
4pcb.de/ Altium Designer Leiterplatten Leiterplattendesign Erstellung Pcb Layout Dienstleistung
243 Kreditangebot kostenlos in 72h Service
Kreditangebot kostenlos in 72h   ein Banker von Beruf und arbeitet derzeit im Bereich der Makro- und Mikrokredite, habe...
244 Marens Ratgeber E-Bookshop
Ratgeber E-Books für die verschiedensten Probleme des täglichen Lebens. Ratgeber rund ums Geld verdienen im Internet, Ratgeber für...
hilf-dir-selbst.berlin Ebooks Geld Ratgeber Ebook Artikel Marens Download Flirt
245 Besuche meinen Shop und kaufe Preiswert OnlieneShop
Besuche meinen Shop und kaufe Preiswert ein Preisvergleiche mit über 3 Millionen Produkten Zehntausende von Marken von Tausenden marktführender...
neumie.buyezee.net/visit-my-shop Fragen Häufig Gestellte Registrierung Packages Marktplatz Marken Uns
246 Black Label Properties Ltd. - Berlin Immobilienmakler
Immobilien in Berlin verkaufen oder vermieten. Wir vermitteln als einer der führenden Immobilienmakler für Berlin Wohnungen, Häuser...
blacklabelimmobilien.com/ Berlin Immobilienmakler Immobilie Immobilien Kauf Label Black Vermittlung
247 Praxis für Ergotherapie Paul Tomaszewski Ergotherapie
in zentraler Lage in Altstadtnähe in Berlin - Spandau, mit günstiger Verkehrsanbindung S – U – Bahn...
ergotherapie-in-spandau.de/ Praxis Therapien Paul Anfahrt Spandau Ergotherapie Tomaszewski Kontakt
248 FairPlay SEO Berlin SEO Agentur
FairPlay SEO Berlin berät Firmen und Freiberufler in allen Fragen des Onlinemarketings. Wir erstellen und optimieren Ihre...
fairplayseo.de Adwords Seo Berlin Local Fairplay Agentur Optimierung Google
249 lohnzettel-berlin.de - Rechtsberater für Ihr Arbeitsleben Rechtsberatung
Lohnzettel-Berlin ist der Berater für ihr Arbeitsleben. Erfahrene und auf das Arbeitsrecht spezialisierte Rechtsanwälte von goadvo.de beraten...
lohnzettel-berlin.de/ Lohnzettel Berlinde Mail Rechtsberater Arbeitsleben Berlin Verantwortlicher Diensteanbieter
250 Diplom- Kaufmann Meir Samuelsdorff stattlich geprüfter

12049 Berlin
Dolmetscher und Übersetzer Hebräisch- Deutsch Berlin...
dolmetscherhebraeisch.berlin/ Hebräisch Ivrit Dolmetscher Berlin Map Sitesgoogle Z
251 Immobilien-jobs.de Immobilien
immobilien-jobs.de ist eine branchenspezifische Stellenbörse für die Immobilienwirtschaft. Unsere aktuellen Job-Anzeigen beinhalten zum einen Fach- und Führungspositionen...
immobilien-jobs.de Warenkorb Tage Mwst Eur Jobs Immobilienmakler Stellenausschreibungen Blog
252 TopAsset Immobilien & Service GmbH Immobilienmakler
TopAsset Immobilien & Service GmbH ist ein seriöser Immobilienmakler mit Sitz in Berlin Spandau. Wir beschäftigen uns...
topasset-immo.berlin/ Immobilie Immobilien Berlin Verkauf Hohen Hausverkauf Neuendorf Parzelle
253 Webentwicklung | Webdesign | Code for Webentwicklung Webdesign
TenMedia ist seit 2011 auf die Webentwicklung in Berlin und das Betreiben von Webportalen spezialisiert. Dabei nutzen...
tenmedia.de Z Y
254 Arbeitsbühne oder Steiger mieten in Berlin Arbeitsbühnenvermietung
Willkommen bei PaDoRent Arbeitsbühnenvermietung! Wenn Sie eine Hebebühne, Arbeitsbühne oder einen Holzhäcksler in und um Berlin mieten wollen...
padorent.de Arbeitsbühnen Lkw Mieten Holzhäcksler Anhänger Arbeitsbühne Arbeitsbühnenvermietung Scheren
255 Werkzeugkoffer Informationen Handwerk
Testberichte und News über werkzeugkoffer für Profis oder Heimwerker. Verschiedene Testberichte und Erfahrungsberichte über einige Werkzeugkoffer. Pflege hinweise und...
werkzeugkofferkaufen.de Werkzeugkoffer Produktbeschreibung Rsaquo Mwst Mannesmann Proxxon Tlg Koffer
256 NICE Network for InterCultural Experiences Auslandspraktikum
NICE (Network for Intercultural Experiences) ist eine deutsch-argentinische Stiftung zur Förderung des internationalen Bildungs- und Kulturaustausches mit...
nice-network.org/de Argentinien Nice Erfahren Südamerika Auslandspraktikum Spanisch Freiwilligenarbeit Erlebe
257 NICE – Network for InterCultural Experiences Auslandspraktikum Spranischkurse
NICE (Network for Intercultural Experiences) ist eine deutsch-argentinische Stiftung zur Förderung des internationalen Bildungs- und Kulturaustausches mit...
nice-network.org/de Argentinien Nice Südamerika Spanisch Auslandspraktikum Praktikum Erfahren Spanischkurse
258 Elvis Stimmen-Imitator Berlin Elvis Stimmen-Imitator Berlin Musik

Events in Berlin und Brandenburg, mit Elvis Presley Interpret Philipp Eberth, buchen können Sie mich...
philipp-eberth.jimdo.com/ Elvis Presley Eberth Zeit Berlin Imitator*** Show Imitator
259 Was sagt mein Sternzeichen eigentlich über Religion
Das Sternzeichen und der Aszendent sagen viel über die Persönlichkeit eines Menschen aus. Erfahren Sie jetzt mehr...
horoskopmekka.de/ Z Y
260 ExoSnacks - exotische Lebensmittel Online-Handel
ExoSnacks bietet Insekten zum menschlichen Verzehr (gefriergetrocknet) mit Rezeptvorschlägen und eine Auswahl an Superfood an. Insekten sind als...
exosnacks.de Insekten Salz Sonstiges Rezepte Grillen Heuschrecken Gewürze Mehlwürmer
261 Berwerbungscoaching Traumberuf finden Coaching
Sie möchten eine erfolgreiche Bewerbung verschicken und wissen nicht wie? Sie haben ein Vorstellungsgespräch vereibart und Sie...
beaterudolph.de Beruf Jobcoaching Lukas Leidenschaft Deinen Berufswahl Coaching Rudolph
262 JENS RICHARD GmbH Lifestyle
Entdecken Sie bei uns auf dem Kurfürstendamm in Berlin oder in unserem Onlineshop schöne und exklusive Dinge...
jensrichard.de/ Berlin Jens Richard Jensen Geschenke Georg Hering Schmuck
263 Auto Ankauf Berlin Autoankauf
Wir sind der Partner wenn es um Ihr Fahrzeug geht. Für einen guten Ankauf Ihres Wagen bzw....
auto-ankauf-reinhold.berlin Berlin Auto Ankauf Verkauf Gebrauchtwagenhändler Angaben Reinhold Std
264 Trinkwasser-Systemerhaltung Trinkwassertechnik
Unser Unternehmen ist spezialisiert im Bereich der: - dauerhafte Systemerhaltung - Beseitigung von Biofilm, Korrosion und Ablagerungen - dauerhafter Schutz...
c-a-c.info Desinfektion Trinkwasser Reinigung Rohrinnenwänden Legionellen Minimierung Verhinderung Systemreinigung
265 Besuche meinen Shop und kaufe Preiswert Baby &
Baby & Kindergarten, Cmputer und Software, Haus und Möbel, Schuhe und Schuwerk, Lokale Angebote, Auto und Motorad...
neumie.buyezee.net/visit-my-shop Packages Fragen Gestellte Häufig Registrierung Marktplatz Shop Opportunity
266 Pumpenhandel und Service Pumpen und
Das Sortiment von Pumpenhandel und Service umfasst Pumpen jeden Formats und Anspruchs, ob die kleine Tauchpumpe oder...
pumpenhandel-service.de Versandkosten Zehnder Hebeanlagen Zubehör Pumpen Mein Drain Gartenpumpen
267 Trendio Fashion
Trendio - die besten Fashion Angebote in einer Übersicht. Ausgewählte Mode aus angesagten Online Shops zu guten...
trendio.eu Shirts Herrenausstatterde Boozt Fashion Sweater Jeans Anzüge Hosen
268 fashion davaa Mode Fashion

Elegant, zeitlos, great! for every one!...
fashion davaa.de
269 Fach- und Rechtsanwältin Gabriele Brandenburg Rechtsanwälte
Die hochspezialisierte Anwaltskanzlei von Rechtsanwältin Gabriele Brandenburg mit Sitz in Berlin Friedenau-Steglitz hift Ihnen bei Problemen im...
rabrandenburg.de Sozialrecht Gesellschaftsrecht Arbeitsrecht Rechtsgebiete Steuerrecht Unfallrecht Rechtsanwalt Steglitz
270 AB-Detective Condor GmbH Detektei
Die AB-Detective Condor GmbH ist Ihr kompetenter Partner bei der Erbringung von Beweisen. Als seriöse, diskrete und...
detectivecondor.de/staedte/detektiv-in-berlin-im-einsatz.htm Detektei Berlin Detektive Condor Detekteien Ermittlungen Einsatz Jahrzehnten
271 Alarmanlagen Video-Türsprechsysteme Sicherheitstechnik
Sicherheitstechnik für privat und Geschäft. Funkalarmanlage Neostar, 2-Wege Technologie, Sicherheit ohne Kabelverlegung, bis zu 10% förderfähig, Video...
security-cctv-systeme.de Mein Video Neostar Shop Funk Full Alarmanlage Ip
272 Rohrreinigung Berlin Absolut Rohrreinigung Kanalreinigung
Firma Absolut Rohrreinigung Berlin ein Unternehmen mit jahrelanger Erfahrung in Branchen: Rohrreinigung, Kanalreinigung, Abflussreinigung so wie TV...
rohrreinigung-absolut.berlin/ Berlin Rohrreinigung Kanalreinigung Abflussreinigung Sanitär Rohruntersuchung Uns Renovierungen
273 A Plus Detective GmbH Detektei
Die A Plus Detective GmbH ist Ihr kompetenter Partner bei der Erbringung von Beweisen. Als seriöse, diskrete...
detektei-aplus.de/dependancen/detektei-berlin.htm Berlin Detektei Detektive Plus Detektiv Firma Einsatzort Wirtschaftsdetektei
274 Trauerrednerin Cornelia Gennrich Trauerrede
trauerrede-berlin.de/ Gennrich Trauerrednerin Trauerrede Trauerfeier Angehörigen Menschen Berlin Dolmetscherin
275 Snorflex® Die innovative Schnarchschiene Schnarchen
Die Produkte von Snorflex über Schnarchspange, Schnarchschiene bis zur Biblock-Orthese wurden von Spezialisten aus der Schlafforschung, HNO...
snorflex.de/ Schnarchen Snorflex® Snorflex Bestellen Hilfe Schnarchschiene übergewicht Dazu
276 Sensamax Natürliches Potenzmittel
Sensamax ist ein natürliches Potenzmittel, das rezeptfrei erhältlich ist. Es bekämpft erektile Dysfunktion, frühzeitigen Samenerguss und sonstige...
sensamax.de/ Sensamax Kaufen Erektionsstörungen Zusatzstoffe Einkaufswagen Produkte Kundenbereich Dysfunktion
277 ASLAN Ambulanter Pflegedienst GmbH Ambulanter Pflegedienst
ASLAN ambulanter Pflegedienst ist ein interkultureller Pflegedienst im Herzen von Berlin Neukölln. Wir bieten Pflege in deutscher und...
aslan-pflege.de Pflegedienst Aslan Leistungen Pflege Stellenangebote Ambulanter Pflegeleistungen Interkulturelle
278 Lida-Shop Gesundheit
Wie man Gewicht verlieren mit Diät mit Müsli Wenn Sie ein bestimmtes Produkt erwerben positive Aura, die Menschen...
lida-shop.org/ Lida Kapseln Konto Kaufen Warenkorb Deutschland Abmagerung Wunschzettel
Diät für die faulen.Teil 1. Die schwachen in letzter Zeit möchten viele von uns, vor allem nach den...
turbo-lida.com/ Lida Extra Stark Formel Kapseln Alt Kaufen St
280 ShowAgenten Entertainment GmbH Eventagentur
Suchen Sie eine Eventagentur in Berlin? Mit jahrelanger Erfahrung in verschiedenen Bereichen? Dann sind sie bei uns richtig!...
showagenten.de/ Berlin Eventagentur Showagenten Bond Party Bands Events Show
281 Trauerrede Berlin Trauerrede
Wenn wir einen nahestehenden Menschen verlieren, wird unser Lebensfundament erschüttert. Als Trauerrednerin in Berlin helfe ich trauernden...
trauerrede-berlin.de/ Trauerrede Gennrich Cornelia Trauerfeier Dolmetscherin Trauerrednerin Angehörigen Menschen
282 Dipl.-Theol. Ferdinand Krieg, Berlin: Eheberatung, Paarberatung. Dipl.-Theol. Ferdinand Krieg, Berlin: Eheberatung, Paarberatung. Eheberatung Paartherapie
Dipl.-Theol. Ferdinand Krieg. Heilpraktiker beschränkt auf das Gebiet der Psychotherapie. Systemische Paartherapie (Paarberatung, Eheberatung). Ich bin Diplom-Theologe und...
einzelundpaartherapie.de Paartherapie Berlin Paarberatung Ferdinand Krieg Systemische Dipl Theol
283 Barthlomeyczik - Heizung & Bäder GmbH Heizung &
Die Firma Barthlomeyczik Heizungen und Bäder mit Haupt-Sitz in Berlin arbeitet seit 1991 erfolgreich bezüglich Montage, Wartung...
online-heizungen.de Heizung Wärmepumpe Brennwertkessel Gasheizung ölheizung Weishaupt Viessmann Buderus
284 Schlüsseldienst Berlin - Schlüsselnotdienst Schlüsseldienst
Ausgesperrt bei Nacht? Der schnelle Dienstleister Schlüsseldienst Berlin König öffnet Ihre Türen und Fenster. Geschultes Personal...
schluesseldienst-koenig.com Schlüsseldienst Berlin Kunden Team König Minuten Schlüssel Schlösser
285 Kuvertiermaschinen Lettershop Postbearbeitung Postbearbeitung
Frankonia aus Berlin Als kundenorientiertes Unternehmen bieten wir Lösungen und Optimierungsansätze für den gesamten Büro- und Poststellen-Bereich. Eine...
frankonia24.de Kuvertiermaschinen Frankiermaschinen | Falzmaschinen Direktadressierer Postaufkommen Elektrostempel Postbearbeitungssystemelettershop
286 Laptop und Apple MacBook Reparatur Service Computer-Service
Wir bieten Computerreparaturen, um genau zu sein, Laptop und Apple MacBook Reparaturen an. Die Diagnose ist kostenlos. In der...
notebookservice030.de Reparatur Laptop Macbook Apple Notebook Display Agb Pc
287 Socialcore Online-Marketing
Socialcore ist eine inhabergeführte Agentur für Content und Suchmaschinenmarketing mit Sitz in Berlin. Das Leistungsspektrum der Agentur...
socialcore.de/ Suchmaschinenoptimierung Marketing Content Google Socialcore Suchmaschinenwerbung Media Management
288 amh Absturzsicherungen Bau
Die Amh Flachdach-Sicherungs GmbH ist Spezialist für Flachdach- Absturzsicherungen. Das Unternehmen ging hervor aus der 1978 gegründeten...
amh-berlin.de/ Absturzsicherungen Berlin Fassaden Zertifizierung Amh Sicherheit Seilsicherungssystem Kollektivschutz
289 1A Versicherungsvergleich Versicherung
Bei uns können Sie sich über sämtliche Versicherungen und Policen informieren. Wir stellen für Sie neue News...
1aversicherungsvergleich.de/ Versicherungsvergleich Vergleichen En Angeboten Uns Besten Jeder Menu
290 Satinanda (Vihara) Buddhismus Berlin
Unsere Veranstaltungen und Angebote: Bitte rufen Sie bei Interesse zur Teilnahme an. • ...
satinanda.de Satinanda Lehrreden Nikaya Veranstaltungen Forum Meditation Dhamma Vortrag
291 Modelagentur Berlin Modelagentur Messehostess
Als Modelagentur Berlin vermitteln wir Models in und aus Berlin für Fotoshootings, Laufstegshows oder Media-Werbung. Zudem sind...
modelagentur-berlin.org Modelagentur Model Berlin Messehostessen Models Promotion Dresden Hostess
292 transparent-beraten.de Maklerservice UG (Versicherungsmakler Berlin) Versicherungsmakler
Wir sind ein junges und aufstrebendes Unternehmen mitten aus dem Herzen von Berlin. Gegründet wurde die transparent-beraten.de...
transparent-beraten.de/ Versicherungen Krankenshyversicherung Versicherung Betriebliche Transparent Rente Riester ✔
293 HilfedurchHypnose.Berlin Katrin Bätz Heilpraktikerin Für
Als Heilpraktikerin für Psychotherapie arbeite ich vorwiegend mit Hypnose. Was ist Hypnose? Hypnose ist ein Trancezustand. Hypnose ermöglicht...
hilfedurchhypnose.berlin Hypnose • Preise Berufliches Lebensentwurfsberatung Leistungssteigerung Hypnoreisen Seiten
294 Kosmetik Berlin Kosmetik
Kosmetik Studio in Berlin gesucht? Dann kommen Sie zu Kosmetik Berlin Luxury Beauty. Unsere erfahrenen Mitarbeiter haben...
luxury-beauty-berlin.de Berlin Permanent Kosmetik Augenbrauen Haut Mikrodermabrasion Kosmetikerin Kosmetikstudio
295 Wissenschaftscoaching Wissenschaftscoaching Wissenschaftsberatung

DD|Coaching bietet kompetente Hilfe bei allen Fragen rund um wissenschaftliches Arbeiten für Studenten/Studentinnen und Schülerinnen/Schüler. Ich betreue...
dd-coaching.de Wissenschaftsberatung Arbeiten Coaching Studierende Schule Verständnis Leistungen Studiums
296 Dr. Martin Müller Steuerberater Steuerberater
Das Konzept was Du erhältst unterscheidet sich im Wesentlichen darin, dass es dir eine Schritt für Schritt...
startupandgrow.de Immobilien Steuen Kosten Aufzubauen Urteil Widerrufsbelehrung Teil Startupandgrowde
297 Acupuncturcentrum Japanische Akupunktur
Elisabeth Vos Tel.: 28 38 43 68 Heilpraktikerin seit 1990. In eigener Praxis tätig mit den Schwerpunkten:...
akupunktur-berlin-vos.de Berlin Akupunktur Medizin Vos Elisabeth Chinesische Akupunkturzentrum Mitte
298 Acupuncturcentrum Akupunktur
Elisabeth Vos Tel.: 28 38 43 68 Heilpraktikerin seit 1990. In eigener Praxis tätig mit den Schwerpunkten:...
akupunktur-berlin-vos.de Berlin Akupunktur Medizin Vos Elisabeth Chinesische Akupunkturzentrum Pflanzenheilkunde
299 ONLINE WOHNBERATUNG Innenarchitektur
ONLINE WOHNBERATUNG Brauchen Sie mehr Stauraum, eine neue Farbe oder einen anderen Stil? Die Online Wohnberatung bietet...
die-raumgestalten.de Berlin Wohnberatung Einrichtungsberatung Projekte Innenarchitektin Onlineberatung Philosophie Kompetenzen
300 Betriebshaftpflichts Vergleiche Versicherung
Wir stellen aktuelle Anbieter und Tarife der Betriebshaftpflichtversicherungen vor. Durch die Vergleiche und Testergebnisse können schnell Vergleichstestsieger...
betriebshaftpflichts-vergleiche.de/ Internetpräsenz Entstehtz

Kleinanzeigen, Kommentare und Mitfahrgelegenheit Berlin

+ Kommentar oder Kleinanzeige für Berlin eintragen!

301 Home Augenarztpraxis im
Augenarztpraxis im Ärzte Centrum Bülowstraße
302 Albers DAS SPORTRESTAURANT Albers Wettboerse GmbH Albers
Großzügig konzipiert ist das Albers Sportrestaurant der Treffpunkt aller Besucher des Pferdesportparks BerlinKarlshorst. Der aufmerksame
albers-restaurant.de Albers Berlin Restaurant
303 Home
304 Weihnachtsmarkt auf dem Winterfeldtplatz Berlin
Der traditionelle Weihnachtsmarkt auf dem Winterfeldtplatz ist einzigartig und an den Adventssonntagen geöffnet.
weihnachtsmarkt-winterfeldtplatz.de Berlin Weihnachtsmarkt Winterfeldtplatz
305 Formular.de Tipps Formular.de ist ein Angebot der Formblitz AG
Auf Formular.de finden Sie umfangreiche Informationen zu juristischen Themen wie Mietvertrag Arbeitsvertrag Patientenverfügung
306 Cafe Peri Start
Homepage of Cafe Peri
307 Czollek consult Willkommen! Leah
Diversity Dialoge Mediatorin Trainerin Dozentin Konflikte produktiv und zufriedenstellend lösen Kommunikation Dialog Unternehmen Kommunikationskultur
czollek-consult.de Leah Carola Czollek
308 PROFORMA Corporate Design Gesellschaft für Unternehmenskommunikation mbH & Co. KG Design
Corporate Design Agentur Berlin Agentur für Unternehmenskommunikation WebEntwicklungen und Beratung. Für Unternehmen
proforma.de Design Gestaltung Corporate
309 Business Development Germany German
We bring your business on the German market ? contact us today!
businessdevelopmentgermany.de German Companies German Marketing
310 DJ Frank DJService DJ
Dj Frank Berlin DJService für Partys Feste Hochzeiten ...
dj-frank-berlin-brandenburg.de DJ Berlin Brandenburg Party Hochzeit
311 Berlin Taekwondo Willkommen Berlinsan Taekwondo Sportverein e.V. Adnan
Olympic Sports Center Berlinsan Taekwondo e.V. Adnan Karabulut
berlintaekwondo.de Adnan Karabulut Taekwondo Berlin
312 Wohnungsauflösung Berlin 030 wohnungsauflösung
Wohnungsauflösung Berlin günstig und schnell von Complett Räumung 030 261 01 714
berlin-wohnungsaufloesung.de Wohnungsauflösung Berlin Wohnungsauflösungen Entrümpelung Entrümpelungen
313 RAe Böhm MeyerDulheuer §§
Rechtsanwälte Rechtsanwalt Matthias Böhm Notar Helmuth MeyerDulheuer RA RAe §
boehmmeyerdulheuer.de §§ § Rechtsanwälte
314 Astrid Elisabeth Stebich
Astrid Elisabeth Stebich Make up Artist Friseurmeisterin aus Berlin. Make up Haare
315 Home www.berlinevangelisch.de Gesellschaft für Unternehmenskommunikation mbH & Co. KG Abgeltungssteuer
www.berlinevangelisch.de ? Das ServicePortal der Evangelischen Kirche in Berlin.
berlin-evangelisch.de Abgeltungssteuer Advent Austritt Bach Berlin
316 Berlin Apartments Potsdamer Str Berlin
Apartments in Berlin nähe Potsdamer Platz für Gruppenreisen Gruppenunterkunft
berlin-aparts.de Berlin Apartments Berlin Gruppenreise
317 Bar Voyage barvoyages bar
Bar Café Kleinkunstbühne
barvoyage.de Bar Berlin Kleinkunst Berlin
318 Home ? Kunstsaele Berlin Kunstsaele
Die Kunstsaele Berlin verbinden Galerie Sammlung und Kulturprojekte an einem Ort. Neben den wechselnden
kunstsaele.de Kunstsaele Oehmen Bergmeier
319 WerbeartikelAgentur für Fahrradsattelbezüge
Kultkeks ist Ihr Partner für individuelle Werbemittel und Werbegeschenke. Unser Sortiment reicht von der Handysocke
Seit nunmehr 26 Jahren ist das TRIO PALMERA unterwegs um landesweit und über die Landesgrenzen
josefinol.de Salsa Cumbia Merengue
321 Home Labbow Personalleasing e.K.
Personalberatung und dienstleistungen
322 Marian Kiss Marian
Marian Kiss Film Berlin Filmemacherin Filmmaker Regiesseurin Director
mariankiss.de Marian Kiss Film
323 Marianne Rosenberg | RoseWeb Public Image GmbH Marianne
Die offizielle Website von Marianne Rosenberg mit aktuellen Infos SongDownloads Biografie Diskografie
rosenberg.de Marianne Rosenberg Pop
324 MännerMinne e.V. Erster schwuler choir
MännerMinne e.V. Erster schwuler Männerchor Berlin gegründet 1987 Mitglied im Berliner Sängerbund.
maennerminne.de Choir Chorus Gay
325 | MARTINA DOEHRING | c/o Formblitz AG Martina
Dies ist die offizielle Website der Sopranistin Martina Doehring
martinadoehring.de Martina Doehring Sängerin
326 EVA GmbH EVA GmbH
KFZ Reparatur oder Ausfuhrversicherung:sofort in unserem OnlineShop. Auch Gebrauchtwagengarantie und Finanzierung für Privatpersonen und Händler
327 Diversitygendertraining.de joomla
Joomla! dynamische PortalEngine und ContentManagementSystem
energydeal.de Joomla Joomla
328 :: Keding / ESS Keding / ESS Elektronische Sicherheitssysteme GmbH / Keding GmbH & Co. KG sicherheitssystem
ESS GMBH Planung Lieferung Montage Inbetriebnahme von elektronischen Signal und Anzeigeanlagen
ess-sicherheit.de Sicherheitssysteme Alarmanlagen Brandmeldetechnik Brandmelder Brandmeldeanl
329 Hauptstadtplan | interaktiver stadtplan Adler & Schmidt GmbH Bundeshauptstadt
Interaktiver häusergenauer Stadtplan der Berliner Innenstadt. Suchmöglichkeit nach den Kategorien Sehenswürdigkeiten Kultur Regierungsbauten
hauptstadtplan.de Bundeshauptstadt Berlin Hauptstadt Bundesregierung Reichstag
330 Home GmbH & Co. KG ML4
Personalleasing ML4 Personalmanagement GmbH Co.
ml4-dienstleistungen.de ML4 ML4Personalmanagement ML4
331 Keding GmbH Co.KG Integral
IntegralSecurity Integralsecurity Integral Security Integral Security Antennentechnik und Sicherheitstechnik Alarmanlagen Brandmeldeanlagen Einbruchmeldeanlagen Videoüberwachung und mehr)
keding.de Integral Security IntegralSecurity Integralsecutity Integral
332 Start Kauffeld und
Kauffeld und Jahn
333 Willkommen bei Pascha Grill joomla
Joomla! dynamische PortalEngine und ContentManagementSystem
pascha-grill.de Joomla Joomla
334 PartytechnikBerlin Verleih von Berlin
Partytechnik Berlin verleiht Lichttechnik und Tontechnik für Eure Party/Veranstaltung
partytechnik-verleih-berlin.de Berlin Partytechnik Verleih Party Verleih
335 Home
Tierärzte Tierarztpraxis Marianne Gass
336 Willkommen bei perko profundus! Perko
perko profundus
perko-profundus.de Perko Gudrun Profundus Wissenschaftscoach Education
337 Ludger Jungnitz Men's Maenner
Ludger Jungnitz Men's Care Men's Studies
mensstudies.de Maenner Lebensqualitaet Gesundheit
338 Berlin Apartments Potsdamer Str Berlin
Apartments in Berlin nähe Potsdamer Platz für Gruppenreisen Gruppenunterkunft
cityapartsberlin.de Berlin Apartments Berlin Gruppenreise
339 HumanistischSystemische Beratung Frank systemisch
Erkennen und Auflösen von Verstrickungen Familienstellen Psychodrama Gestaltherapie Trauma
frankstamer.de Systemisch Familienstellen Aufstellung
340 Flowers of life Flowers
Flowers of life richtet sich an alle Menschen die Begleitung Gesellschaft oder eine persönliche
flowers-of-life.de Flowers Of Life Brigitte
341 INTEGRAL SECURITY Sicherheitstechnik Keding GmbH & Co. KG IntegralSecurity
Sicherheitstechnik von Integral Security dem deutschlandweiten Firmenverbund für Sicherheitstechnik (Alarmanlagen Brandmeldeanlagen Einbruchmeldeanlagen
integralsecurity.de IntegralSecurity Sicherheitstechnik Integral
342 IJam.de ? mediendesign Webdesign
10 Schritte zur eigenen Website | iJam.de Mediendesign
ijam.de Webdesign Mediendesign Homepage
343 Startseite » Gesine Palmer » Herzlich Willkommen auf Gesine
Dr. Gesine Palmer leitet das Berliner Büro für besondere Texte. Die Religionsphilosophin bietet Kommunikationsberatung und
gesine-palmer.de Gesine Palmer Redenschreiben
344 Politikmanagement mit Gitta Stieber Politikmanagement
Gitta Stieber Berlin Politikmanagement Qualifizierung und Weiterbildung die Sie in sozialen
gittastieber.de Politikmanagement Kommunikation SoftSkills
345 Gift Music Gift Music GmbH Weltmusik
Ein kleines Weltmusiklabel aus Berlin
giftmusic.de Weltmusik Label Berlin
346 GEAG Immobilienverwaltung Berlin:Wir verwalten GEAG Immobilienverwaltungs GmbH Wirtschaft
GEAG Immobilienverwaltungs GmbH: kompetente Verwaltung und Betreuung von Immobilien in Berlin Brandenburg Sachsen
geag-berlin.de Wirtschaft Immobilien Immobilienverwaltung
347 Business Development Germany German
We bring your business on the German market ? contact us today!
business-development-germany.de German Companies German Marketing
348 Moritz Tilman Achelis | rechtsanwalt
Rechtsanwalt Arbeitsrecht Achelis Baurecht Architektenrecht Grundstücksrecht Wohnungseigentumsrecht Medizinrecht
ra-achelis.de Rechtsanwalt Arbeitsrecht Achelis
349 RDM: Startseite Landesverband Berlin und Brandenburg e.V. rdm
RDM Ring Deutscher Makler Landesverband Berlin und Brandenburg e.V.
rdm-berlin-brandenburg.de Rdm Ring Deutscher
350 Startseite Willkommen
351 Rita Leinenweber · Astrologie Astrologie
Ich freue mich Ihnen meine Kenntnisse in Astrologie Massage energetischen Heilweisen
ritaleinenweber.de Astrologie Horoskop Geburtshoroskop
352 GEAG Immobilienverwaltung Berlin:Wir verwalten GEAG Immobilienverwaltungs GmbH Wirtschaft
GEAG Immobilienverwaltungs GmbH: kompetente Verwaltung und Betreuung von Immobilien in Berlin Brandenburg Sachsen
sabinespehr.de Wirtschaft Immobilien Immobilienverwaltung
353 Rundum Ich Ihr massage
Massage Ernährungsberatung Fitness und Personal Training Hypnosetherapie in Berlin für Privatkunden
rundum-ich.de Massage Ernährung Hypnose
354 Astrologische Gesundheits und Lebensberatung Astrologie
Astrologische Gesundheits und Lebensberatung Yvonne v. Bechtolsheim: Astrologie Reiki Ernährungsberatung und Radionik in
schwarzer-second-hand-shop.de Astrologie Reiki Ernährungsberatung
355 Roger Thilo EDV Service Roger
Wir bieten ITLösungen im Businessbereich für alle Branchen und Unternehmensgrößen. innovativ zuverlässig
rthilo.de Roger Thilo EDV Service
356 PROBase easy PROFORMA GmbH & Co. KG CMS
Mit PROBase easy erstellen wir individuell hochwertige Webauftritte Sie brauchen nur noch die Texte
pro-base-easy.de CMS ContendManagemnetSystem Contend
357 Sm hope ick Kindermode
Die Teilnahme am Wettbewerb ?Meine Heimat? auf der Kreativplattform Dawanda.de war Anlass Designs zu
smhope.de Kindermode
358 LOOK22 Home LOOK22 LOOK22
LOOK22 MediaService ~ zielgruppenoptimiertes Webdesign ~ aussagekräftige Fotografie ~ perfekte Grafik ~ treffsichere Texte ~
look22.de LOOK22 MediaService Internet Fotografie Grafik
359 Raumdesignerin .Silke Smida. kunst
Art by Silke Smida composed drawings find new places!
raumdesignerin.de Kunst Design Graffiti Wandtattoos Acryl
360 BEGINE Treffpunkt und Frauen
Interkulturelles Frauenkulturzentrum Künstlerinnenförderung Konzerte Ausstellungen Potsdamer Str. 139 BerlinSchöneberg
begine.de Frauen Lesben Frauencafé
361 Complett Räumung | Wohnungsauflösung wohnungsauflösung
Wohnungsauflösung Berlin günstig und schnell von Complett Räumung 030 261 01 714
complett-berlin.de Wohnungsauflösung Berlin Wohnungsauflösungen Entrümpelung Entrümpelungen
362 Contravision breaking news contra medienwerkstatt e.v. ContraVision
short film festival in berlin germany march 20th to march 28th
contravision.de ContraVision Cinema Contra
363 Doktus.de Dokumente uploaden FORMBLITZ AG doktus
Hier findet man Dokumente zu allen Themen und kann Dokumente suchen verwalten
doktus.de Doktus
364 | MARTINA DOEHRING | c/o Formblitz AG Martina
Dies ist die offizielle Website der Sopranistin Martina Doehring
martina-doehring.de Martina Doehring Sängerin
365 Wolfgang Kommerell | kommerell.de Wolfgang
Website von Wolfgang Kommerell: Segeln Fotografie.
kommerell.de Wolfgang Kommerell Fotografie
366 Marianne Rosenberg | RoseWeb Public Image GmbH Marianne
Die offizielle Website von Marianne Rosenberg mit aktuellen Infos SongDownloads Biografie Diskografie
roseclub.de Marianne Rosenberg Pop
367 Linux auf CD/DVDR linux
LinuxDistributionen auf CDR und DVDR tuxpost.de Shop
tuxpost.de Linux Iso Shop
368 Home Texts and Birgit
Dr. Birgit Hollenbach brings language and science together. Her university studies of translation and biochemistry
textsandtranslations.de Birgit Hollenbach Translation
369 .:|Stadtrundfahrten|Originelle Alternative Stadtrundfahrt|Berliner Dialekt Berlin
| BerlinerSchnauze Stadtrundfahrten | Alternative Stadtrundfahrt im Berliner Dialekt | Mundart sehr Orginelles Geschenk
berliner-schnauze.de Berlin Stadtrundfahrt Stadtrundfahrten Information Private
370 Übersetzer Deutsch Rumänisch Rumänisch
Übersetzungen Deutsch Rumänisch Dolmetscher für Rumänisch in Berlin profesionelle Übersetzung kundenorientiert
turbatu-translations.de Rumänisch Übersetzer Deutsch Rumänisch
371 Home / tausendschwarz.de Angebot
HomepageTitel Berlin
tausendschwarz.de Angebot Kompetenz Beratung
372 Subversionen.de | praeludium
??? Beuys + Agnoli
373 Betreutes Wohnen in Demenz betreutes
Der FAW e.V. begleitet und verwaltet ambulant betreute Wohngemeinschaften für Menschen mit Demenz.
verein-faw.de Betreutes Wohnen Demenz Wg
Seit nunmehr 26 Jahren ist das TRIO PALMERA unterwegs um landesweit und über die Landesgrenzen
trio-palmera.de Salsa Cumbia Merengue
375 Astrologische Gesundheits und Lebensberatung Astrologie
Astrologische Gesundheits und Lebensberatung Yvonne v. Bechtolsheim: Astrologie Reiki Ernährungsberatung und Radionik in
sternen-klar.de Astrologie Reiki Ernährungsberatung
376 Italienische Weine Online Weine
Vinila Weine aus Italien. Wer via eCommerce in Deutschland die besten italienischen Weine online
vinila.de Weine Wein Aus Italien
377 NAS Planung Baumanagement Nas Planung & Baumanagement GmbH & Co. KG Berlin
NAS Planung Baumanagement GmbH Co. KG Telefon +49 (0)30. 216 95 45
xn--nas-planungsbro-cwb.de Berlin Ahmet Nas
378 AllmendeKontor Gemeinschaftsgarten Allmende-Kontor e.V.
Allmende = Gemeingut = Commons: Berliner AllmendeKontor Gemeinschaftsgarten und eine der größten Hochbeetanlagen der
379 Beste Hunde: OnlineMagazin für
Das Online Hundemagazin mit aktuellen Artikeln zu Gesundheit Ernährung Erziehung und Verhalten
380 Berliner Schlagerfest 2012 berliner
Das Berliner Schlagerfest geht in die 2. Runde.
berliner-schlagerfest.de Berliner Schlagerfest 2012 Schlagerfest Berlinmitte
381 Birgit Schlieps Birgit
Urban Sculpture. Die Künstlerin Birgit Schlieps arbeitet mit dem urbanen Raum als Phantom Mythos
birgitschlieps.de Birgit Schlieps Kunst
382 Startseite Willkommen
383 Business Development Germany German
We are the leading German Marketing Company bringing your business on the German market. Our
cockpit-germany.de German Companies German Marketing
384 Coworkingberlinsquarehaus.de coworkingberlinsquarehaus Webseite! Square Haus am Nollendorfplatz GmbH
SquareHaus work meet share collaborate coworking büros konferenzraum
385 Business Development Germany German
We are the leading German Marketing Company bringing your business on the German market. Our
dashboard-germany.de German Companies German Marketing
386 Herzlich Willkommen Willkommen Forner + Forner GbR
Als kreatives und innovatives Unternehmen für Beratung und Kommunikation möchten wir Sie als vertrauensvoller Partner
387 Home SchwarzweißFotogr
Neue Wege Neue Sichten Neue Fotografien Du möchtest besser wahrnehmen und kreativ sein
fotografisch-sehen-lernen.de SchwarzweißFotografie Konzeptfotografie Fotografisch
388 Fotostudio Altman. Hochzeit Wettbewerb Studioalex.de
Suchen Sie einen professionellen Fotografen mit über 25 Jahre Erfahrung in der Fotografie? Dann sind
fotostudioalex.de Studioalex.de Hochzeit Wettbewerb Meine Traumhochzeit!
389 DIF | Dit is mirapodo ? operated by myToys.de GmbH
DAS Berliner Modeblog zu Fashiontrends und Modesünden Parties und Veranstaltern Designern und Kollektionen
390 Heilpraxis Susanne Weis Heilpraxis
Heilpraxis Susanne Weis
391 BAKUNAPOLI BakuNapoli
BAKUNAPOLI.Aserbaidschanische und italienische Küche.
baku-napoli.de BakuNapoli Restaurant Berlin Aserbaidschanische Küche
392 Kristina Jacoby Startseite Ghostwriter
Kristina Jacoby unterstützt Autoren bei der Erstellung ihrer Bücher
kristinajacoby.de Ghostwriter Ghostwriting Wissenschaftliches
393 Startseite Klinisches Krebsregister Klinisches Krebsregister für Brandenburg und Berlin gGmbH Klinisches
Informationen zur klinischen Krebsregistrierung in Brandenburg
kkrbb.de Klinisches Krebsregister Brandenburg
394 Kniggeinberlin.de Willkommen bei Knigge
Gesellschaftlicher Schliff selbstsicheres und stilvolles Auftreten ist heute wichtiger denn je. Jeder kann Benehmen
knigge-in-berlin.de Knigge Seminare KniggeSeminare Benehmen Benimmkurse
395 PROJECT318 photography
Homepage für die Vernissage / Ausstellung PROJECT318 der SRH Hochschule der populären Künste (hdpk).
project318.de Photography Design Motion
396 Ludger Jungnitz Prozessbegleitung Prozessbegleitung
Prozessbegleitung Berlin Ludger Jungnitz
prozessbegleitung-berlin.de Prozessbegleitung Coaching Projekte
397 SPAM Magazin SPAM
SPAM Magazin Ausgabe 01
spam-music.de SPAM; Magazin Musik
398 Text Julia Richter
Erstklassige Unternehmenskommunikation Texte und Konzepte in Berlin
399 ReBuy der einfache An reBuy reCommerce GmbH gebraucht
An und Verkauf für gebrauchte Handys Tablets Videopiele Filme CDs
rebuy.de Gebraucht Kaufen Gebraucht Verkaufen
400 Pasta e Più Startseite Frische
Frische Pasta in Berlin
pasta-e-piu.de Frische Pasta Berlin Raviolli Ghnochi
401 Aktuelles Bürgerinitiative
Stadtplanung von unten Stadtentwicklung TempelhofSchoeneberg Berlin
stadtplanung-von-unten.de Bürgerinitiative Bürgerbegehren Bürgerentscheid Anwohnerversammlung Gleisdr
402 Taxi Bildungscenter Berlin Treffpunkt Bildung GmbH Taxischein
Wir schulen seit 18 Jahren erfolgreich auf die Ortskundeprüfung mit eigenem ständig aktuellem
taxi-bildungscenter.de Taxischein PSchein Taxifahrer Fahrgastbeförderung Ortskundeprüfung
403 Studio NiMa Produktion Mode Kauffeld und Jahn GbR
Vom Entwurf bis zur Produktion. Mode und Textil. Studio NiMa ist in der Bekleidungsindustrie
404 Schuhe Online Shop myToys, mirapodo und ambellis - Shops der myToys.de GmbH
Schöner Schuhe shoppen ? riesige Auswahl für Damenschuhe ? Herrenschuhe ? und Kinderschuhe ? Bestellen
405 Yoga in Kreuzberg Yoga
Yoga in Berlin an Ihrem Arbeitsplatz oder besuchen Sie YogaKurse in Berlin Kreuzberg mit
yoga-und-massage.de Yoga Am Arbeitsplatz Yoga
406 MyToys | Alles für myToys, mirapodo und ambellis - Shops der myToys.de GmbH
myToys Ihr OnlineShop für Spielzeug Kindermode Babyausstattung und vieles mehr. Über 100.000
407 Werbung auf dem Sattelschoner|
Sattelschützer als Werbemittel: Bedrucken Sie Sattelbezüge mit Ihrem Logo. Individuelle Gestaltungsmöglichkeiten Lieferung nach drei
408 Finest Whisky Shop Whisky
Unsere Philosophie ist es hochwertige seltene und alte Flaschen der verschiedensten Destillen und Abfüller
finestwhisky.de Whisky Verkauf Berlin
409 Black meadow music production Martin Klein und Christian Kociolek GbR
black meadow music production is a label situated in Berlin.
410 Immocollect.de by Portal Financecollect Immocollect.de by Portal Financecollect GmbH Immocollect.de
Immobilienangebote von Immocollect.de by Portal Financecollect GmbH
immocollect.de Immocollect.de By Portal Financecollect GmbH
411 Simply : pr + simply
simply : die PR und Marketing Agentur für erklärungsbedürftige Produkte! fon +49 (0) 30. 21
agentur-simply.de Simply Public Relation
412 Ashtanga Yoga Schule Berlin Ashtanga
Ashtanga Yoga Schule in Berlin Schöneberg am Winterfeldtplatz Pallasstr. 89 10781 Berlin
ashtangayogaschoeneberg.de Ashtanga Yoga Berlin Schöneberg
413 Rosenscharf und Edelsüß Catering ZOE
Restaurant ZOE Berlin. Asiatische und mediterrane Küche zwischen Hackeschem Markt und Alexanderplatz in Berlin Mitte.
aromamanufaktur.de ZOE Restaurant Lounge
414 Online Marketing: Wissen
Endlich von Online Marketing profitieren. Portal Ratgeber für erfolgreiches Internetmarketing mit Grundlagen Tipps
Fachgeschäft für Naturkosmetik und Naturwaren. Kosmetische Behandlungen nach Dr. Hauschka und M.Gebhardt.
416 Architektur Planung Beratung
Architekten Hannover Berlin Architekturplanung Bauberatung Projektentwicklung Wertermittlung Architektur architectura nova
417 ChristianErdmann.de Christian
Willkommen auf der privaten Site von Christian Erdmann. Erfahren Sie mehr über meine Dozententäigkeit und
christian-erdmann.de Christian Erdmann Dozent Verwaltungsrecht Doppik.kom.bb
418 Christine Ordnung | Home xxxxx
christine-ordnung.de Xxxxx
419 CORINO 4 MEN CorinoArt
Photographer for beauty nude art fashion faces lingerie interieur
corino4men.de CorinoArt Photography Fotografie
420 Claudia Scholl Aktuelle Claudia
Claudia Scholl Buchkonzeption Gestalterische Konzepte Kinderkunstprojekte Illustration und Corporate Design
claudia-scholl.de Claudia Scholl Berlin Kartonzauber Grafikdesign
Herzlich willkommen bei der URBANIS GmbH
bvg-holding.de URBANIS Berlin Unternehmen
422 Home Chatwins Chatwin
CHATWINS: Bücher rund ums Reisen gibt es hier nach Ländern und Kontinenten sortiert. Reisen heißt:
chatwins.de Chatwin Chatwins Bruce Chatwin A
423 52. DeutschFranzösisches Volksfest Schaustellerverband Berlin e.V. Deutsch
Das mit Abstand größte jährliche Volksfest in Berlin Willkommen auf über 40.000m² Erlebnisfläche!
deutsch-franzoesisches-volksfest.de Deutsch Französisches Volksfest Laune
424 Beateberlin AGENTUR FÜR EVENTS beateberlin
beateberlin Agentur für Events und Stadterlebnisse in Berlin und Umgebung
beateberlin.de Beateberlin Agentur Agency
425 Berliner Berufsverband der Gesundheitsaufseher/Hygieneinspektoren BBGH
Der Berliner Berufsverband der Gesundheitsaufseher/Hygieneinspektoren stellt sich vor und bietet Informationsmaterial rund um den öffentlichen
bbghev.de BBGH BVH Hygiene
426 Organisationsberater Berater für Bio
Unternehmensberater für Ökologische Landwirtschaft (Biolandbau) und Biomarkt (Biohandel) ? Experte für Bio Lebensmittel und Biolandbau
bio-projektmanagement.de Bio Lebensmittel Bioprodukte
427 BeGreen Netzwerk für nachhaltiges beGreen Netzwerk für nachhaltiges Wirtschaften e.V. Verein
Alles Wissenswerte von der Historie über Ergebnisse Veranstaltungen und neueste Trends bis hin zur
begreen-net.de Verein Mitgliedschaft Beitrittserklärung
428 IOB Internationale OmnibusBetreibergesellschaft ZOB
ZOB Zentraler Omnibusbahnhof Berlin an Funkturm und Messegelände:
berlinzob.de ZOB Zentraler Omnibusbahnhof Berlin APC
429 Blauwerke verlag # groschenhefte blauwerke
Verlag aus Berlin fuer konkrete Literatur und konkrete Wissenschaft. Gebrauchstexte für die Westentasche.
blauwerke-berlin.de Blauwerke Blauwerke Berlin
430 Werbe und Vertriebsmangement GSW
Die “ FIGARO news” sind das GSW Club Magazin für die Mieter der GSW Immobilien
effektivwerbung24.de GSW Club Figaro News
431 Elena nehrmann promotion
Kultur Kommunikation
elenanehrmann.de Promotion P.r. Pr
432 MACKE Boutique Berlin
Mode ist Kultur Entsprechend diesem Motto bieten wir Ihnen stil und anspruchsvolle Mode und
433 DigitalphotoBerlin Foto
Phototechnik Fehling Fotografie Bearbeitung Entwicklung Vergrößerung von Diabildern Digitalfotografien
digitalphoto-berlin.de Foto Fotografie Photo
434 Diethard Küster Regisseur
Diethard K¸ster Regisseur Produzent Autor Regie Produktion
436 BEOBOOKS Bücher aus Bücher
BEOBOOKS Bücher aus Serbien Katarina Belovukovic
beo-books.de Bücher Serbien
437 Bettina Willumeit | Styling bettina
innovatives kundenorientiertes Fashion Styling für die Bereiche Werbung Editorialproduktionen und Onlinevermarktung
bettina-willumeit.de Bettina Willumeit Stylistin
438 HOME
439 Joomla Toplist Hauptseite joomla
Dies ist die deutsche JoomlaTopseitenliste. Hier finden Sie die wahrscheinlich besten Seiten die mit
joomla-toplist.de Joomla Toplist Best
440 Jugendhilftweiter.de Jugend
Modellprojekt Jugendräte: Eine Homepage von den Jugendräten des Modellprojekts Jugendräte von Berlin SchönebergNord
jugend-hilft-weiter.de Jugend Hilft Weiter
441 LumpenPrinzessin ... Kinderkleidung Kinderkleidung
Die LumpenPrinzessin bietet seit über 15 Jahren Alles für Baby und Kind in gut erhaltener
lumpenprinzessin.de Kinderkleidung Kindermode Kinderschuhe
442 Herzlich Willkommen auf LittleThailand.de thai
Die neuesten und beliebtesten ThaiMassagen ThaiRestaurants Shops und mehr Mit vielen Bewertungen
little-thailand.de Thai Verzeichnis übersetzer Shops Restaurants
443 Evelyn Bornemann Berlin Berlin
Evelyn Bornemann in Berlin Physiotherapie Psychotherapie (HPG) Coach nach der TippingMethode hilft
evelyn-bornemann.de Berlin Physiotherapie Psychotherapie
444 ||| EuroKaukAsia     EuroKaukAsia e.V.
KaukasischEuropäischer Kultur und Wissenschaftsverin e.V.
445 Excelle.consulting | Produktions und excelle.consultin
excelle.consulting bietet kundenindividuelle Lösungen zu Fragen der strategischen Unternehmensentwicklung und der Gestaltung operativer Leistungsstrukturen sowie
excelle-consulting.de Excelle.consulting Excelle Excelle.de
446 F/21 Büro für Nora
f/21 Büro für Zukunftsfragen ist Beratungsinstitut und Denkfabrik. f/21 beobachtet die Gegenwart identifiziert
f-21.de Nora Stampfl Nora S. Stampfl
Natalia Domagala
448 Investieren wie die Superreichen Investieren
Wie auch Sie schnell und einfach die Investments der Superreichen finden die nur ein
superreichtum.de Investieren Geld Anlegen
449 Mediation in Diversity Mediation
Mediation in Konfliktfällen Preisgünstige Mediationsausbildung nach anerkannten Standards von Bundesverbänden oder erfahrene Mediatoren? Kontaktieren
meddiv.de Mediation Berlin Mediationsausbildung Berlin
450 Jura Service Berlin | kaffeevollautomat
Jura Service Berlin| Kaffeemaschine u. Kaffeeautomat ReparturWartung u. Kundendienst in Berlin.Reparaturen von Kaffeemaschinen u.
jura-service-berlin.de Kaffeevollautomaten Reparatur Jura Service Kaffeemaschinen
451 Kanzlei Klaus Koblitzek homepage
homepage dokument webpage page web netz
kanzlei-koblitzek.de Homepage Dokument Webpage Page Web
452 Kanzlei Rechtsanwalt Böcker joomla
Joomla! dynamische PortalEngine und ContentManagementSystem
kanzleiboecker.de Joomla Joomla
453 Rechtsanwaltskanzlei und Notariat Michael Rechtsanwalt
Rechtsanwaltskanzlei und Notariat Michael Müller Rechtsanwalt und Notar Michael Müller in Berlin Schöneberg berät
kanzlei-mmueller.de Rechtsanwalt Notar Berlin
454 Schauspieler Coaching Berlin Karin
Mit dem KarriereTraining für Schauspieler durchstarten und dranbleiben. Die eigene Karriere lustvoll und aktiv gestalten.
karin-kleibel.de Karin Kleibel PR
455 LumpenPrinzessin ... Kinderkleidung Kinderkleidung
Die LumpenPrinzessin bietet seit über 15 Jahren Alles für Baby und Kind in gut erhaltener
kind-in-berlin.de Kinderkleidung Kindermode Kinderschuhe
456 Claudia Scholl Aktuelle Claudia
Claudia Scholl Buchkonzeption Gestalterische Konzepte Kinderkunstprojekte Illustration und Corporate Design
kartonzauber.de Claudia Scholl Berlin Kartonzauber Grafikdesign
457 Krups | Siemens | aeg
Krups | Siemens | AEG | ReparaturServiceWartung und Kundendienst in Berlin.Kaffeemaschinen und Kaffeevollautomaten
kaffeemaschine-reparatur.de Aeg Krups Siemens Kaffeevollautomaten Kaffeemaschinen
458 Home
Elzers Seiten zum Wohnungseigentumsrecht
459 Patwork
460 Peter Bruns Homepage Peter
Homepage von Peter Bruns
peterbruns.de Peter Bruns Cello
461 Rechtsanwälte PfaffHofmann u. Lee Rechtsanwalt
Die Rechtsanwaltskanzlei PfaffHofmann u. Lee legal Rechtsanwaltsgesellschaft bietet eine und zielorientierte Beratung. Schwerpunkt Wirtschaftsrecht z.B.
phl-legal.de Rechtsanwalt Rechtsanwaltskanzlei Arbeitsrecht
462 ..::Phoenix Lounge::.. Phoenix
Phoenix Lounge. Bar Restaurant Cafe in Schöneberg.
phoenix-lounge.de Phoenix Lounge Phoenix
463 Physimetron Elektronische Messtechnik Transimpedanzvers
Rauscharme analoge und digitale elektronische Messtechnik
physimetron.de Transimpedanzverstärker Pikoamperemeter Vorverstärker
464 Mobilienberlin.de living
mobilien: die schönen dinge zum leben wohnen und arbeiten! besuchen sie uns in berlinschöneberg...
mobilien-berlin.de Living Wohnen Wohnaccessoires
465 Otto Events Veranstaltungstechnik veranstaltungstec
Otto Events organisiert Ihre Veranstaltung in Berlin Brandenburg und Potsdam. Wir vermieten Veranstaltungstechnik
ottoevents.de Veranstaltungstechnik Berlin Potsdam
466 Naturheilpraxis im Hofbogen behandlung
Naturheilkunde Praxis Hofbogen Heilung Anwendung Rheuma Therapie Heilpraktiker
heilpraktikerin-schoeneberg.de Behandlung Therapie Körper
467 HALBE STUNDEN // HALF Kurzfilm
halbestunden.de Kurzfilm Leere Familie
468 Flamencomeetsclassic flamenco
flamencomeetsclassic ist ein Tanztheater aus Berlin das klassische Texte Flamencomusik und Tanz zu
flamenco-meets-classic.de Flamenco Tanz Tanztheater
469 Flats Co. Flats & Co. GmbH Waldmannstr.
Eigentumswohnungen Waldmannstr. 3 BerlinLankwitz
flatsandco.de Waldmannstr. 3
470 Praxis für integrale Medizin Integral
Arztpraxis Dr. Martin Bosch BerlinSchöneberg
integralmedicine.de Integral Medicine Arztpraxis
471 Startseite
Anwälte Steuerberater PSInkasso
472 Gerd Brendel | Journalist Gerd
Gerd Brendel Journalist
gerdbrendel.de Gerd Brendel Journalist
473 Autorin Martina Gneist CBT
Autorin Martina Gneist Projekte und Philosophie
gn-konzepte.de CBT WBT Lernkonzepte
474 Startseite hanslux Open
Beratung und Dienstleistungen für Computer Netze und ITSicherheit unter Verwendung von OpenSource Produkten
hanslux.de Open Source Freie Software
475 Theater Hans Wurst Nachfahren Grüffelo
Hans Wurst Nachfahren Theater für Kinder und Erwachsene in BerlinSchöneberg zeigt Spielplan
hasn-wurst-nachfahren.de Grüffelo Puppentheater Berlin
476 Organisationsberater Berater für Bio
Unternehmensberater für Ökologische Landwirtschaft (Biolandbau) und Biomarkt (Biohandel) ? Experte für Bio Lebensmittel und Biolandbau
handel-und-wandel.de Bio Lebensmittel Bioprodukte
477 Fachanwalt für Arbeitsrecht Berlin Fachanwalt
Fachanwalt für Arbeitsrecht Erbrecht und Versicherungsrecht in Berlin sowie Notar Berlin. Kanzlei Gäbelein
gaebelein-veith.de Fachanwalt Arbeitsrecht Versicherungsrecht
478 DFRV Regionalgruppe Berlin
| Website der Regionalgruppe Berlin des Deutschen Fundraising Verbands
479 Fußballwörterbuch in 7 Sprachen
FußballWörterbuch in 7 Sprachen: Homepage des Buches von Kaya Yildirim
480 Felicitas Jacobs Theaterpädagogin Theater
Ich biete vielfältige theaterpädagogische Qualifikationen als Ausbildung oder Fortbildung initiiere theatrale Prozesse und entwickle
felicitasjacobs.de Theater Pädagogik Spiel
481 Organisationsberater Berater für Bio
Unternehmensberater für Ökologische Landwirtschaft (Biolandbau) und Biomarkt (Biohandel) ? Experte für Bio Lebensmittel und Biolandbau
conradthimm.de Bio Lebensmittel Bioprodukte
482 Startseite constant balance Fußpflege
Heilsame Behandlungen für Körper Geist und Seele Fußpflege Massagen und Heilarbeit
constant-balance.de Fußpflege Wellness Entspannung
483 Organisationsberater Berater für Bio
Unternehmensberater für Ökologische Landwirtschaft (Biolandbau) und Biomarkt (Biohandel) ? Experte für Bio Lebensmittel und Biolandbau
consultantfororganictrade.de Bio Lebensmittel Bioprodukte
484 Querschnitt Weine
Querschnitt Weine Weinhandlung in BerlinSchöneberg
485 Startseite
Rechtsanwältin Sylvia PfaffHofmann: Ihr Recht in guten Händen! Spezialgebiete: Europarecht Einbuergerungsrecht und Asylverfahrensrecht
486 Praya ThaiMassage Startseite Massage
Praya ThaiMassage Ihre Praxis in Berlin bietet professionelle Physiotherapie und Massagen als therapeutisches
prayathai.de Massage Praxis
487 Startseite
Anwälte Steuerberater PSInkasso
488 Kanzlei Rechtsanwalt Böcker joomla
Joomla! dynamische PortalEngine und ContentManagementSystem
rechtsanwaltskanzlei-24.de Joomla Joomla
489 Fachanwalt Strafrecht Rechtsanwalt Fachanwalt
Fachanwalt Strafrecht Rechtsanwalt Feldkamp Berlin
rechtsanwaltskanzlei24.de Fachanwalt Strafrecht Rechtsanwalt
490 Reinigung360.de | Professionelle Gebäudereinigung Reinigung
Gebäudereinigung Büroreinigung Bauendreinigung Glassreinigung Laborreinigung Praxisreinigung Spezialreinigung Teppichreinigung
reinigung360grad.de Reinigung Reinigung Berlin
491 REISEDIENST WITTER: Tolle Reisen. Witter
REISEDIENST WITTER: Tolle Reisen. Viel Vergnügen!
reisedienst-witter.de Witter Reisedienst REISEDIENST
492 Schiek Sports Germany Bodybuilding Schiek
Offizieller Distributor Schiek Sports in Deutschland erhältlich Schiek Sports Schiek Sport Handschuhe
schiek-store.de Schiek Sport Handschuhe
493 Schiek Sports Germany offizieller Schiek
Offizieller Distributor von Schiek Produkten in Deutschland Fitness Bodybuilding Zubehör Fitnesshandschuhe Zughilfen Handgelenkschutz Bandagen
schiek-germany.de Schiek Fitnesshandschuhe Trainingsgürtel
494 HOME
Schulshirt Schulkleidung Schuluniform TShirts PoloShirts Sweatshirts Kapuzenshirts Kleidung Uniform Schule Freizeit Caps
495 Senioren Beratung Berlin Seniorenberatung
Seniorenberatung Berlin
senioren-beratung-berlin.de Seniorenberatung Pflegeheimberatung Neue
496 Datenschutzanalyse externer Datenschutzbeauftragter PrivCom Datenschutz GmbH Datenschutz
Wir organisieren als externe Datenschutzbeauftragte mit DatenschutzAudits Schulungen und Sicherheitstests datenschutzkonforme und sichere Prozesse.
privcom.de Datenschutz Audits Datensicherheit
497 PROMINENTENBAU© Prominentenbau
Erwachsene bauen mit LEGO Elementen für Kinder
prominenten-bau.de Prominentenbau Prominent DAI Lego Hellweg
PME ProBau Management und Entwicklungsgesellschaft mbH
pme-gmbh.de PME ProBau Management Entwicklungsgesellschaft
499 Startseite
Rechtsanwältin Sylvia PfaffHofmann: Ihr Recht in guten Händen! Spezialgebiete: Europarecht Einbuergerungsrecht und Asylverfahrensrecht
500 IOB Internationale OmnibusBetreibergesellschaft ZOB
ZOB Zentraler Omnibusbahnhof Berlin an Funkturm und Messegelände:
iob-berlin.de ZOB Zentraler Omnibusbahnhof Berlin APC
501 Nina Petrick ? Autorin Nina
Nina Petrick freie Autorin für Kinder und Jugendbücher Belletristik und Kurzgeschichten. Ihr Jugendbuch
nina-petrick.de Nina Petrick Autorin
502 Digital Innovation Facilitator GuentherLange GmbH digitale
Mit Design Thinking systematisch zu kreativen Problemlösungen für das InternetBusiness: Jens Otto Lange moderiert Ideen
jensottolange.de Digitale Innovation Kreativität
503 Berlinatnight.de :: Stadtmagazin für Musikkalender
NightlifeGuide für Berlin: Clubs Bars Parties Tickets Kinoprogramm Konzerte
berlinatnight.de Musikkalender Movie Genießen
504 Www.djembeberlin.de
Du möchtest die westafrikanische Trommel Djembe spielen lernen. Hier findest du eine Liste von Lehrern
505 Naturheilpraxis im Hofbogen behandlung
Naturheilkunde Praxis Hofbogen Heilung Anwendung Rheuma Therapie Heilpraktiker
hofbogen.de Behandlung Therapie Körper
506 Theater Hans Wurst Nachfahren Grüffelo
Hans Wurst Nachfahren Theater für Kinder und Erwachsene in BerlinSchöneberg zeigt Spielplan
hans-wurst-nachfahren.de Grüffelo Puppentheater Berlin
507 Berliner Berufsverband der Gesundheitsaufseher/Hygieneinspektoren BBGH
Der Berliner Berufsverband der Gesundheitsaufseher/Hygieneinspektoren stellt sich vor und bietet Informationsmaterial rund um den öffentlichen
hygieneinspektoren.de BBGH BVH Hygiene
508 Kanzlei Rechtsanwalt Böcker joomla
Joomla! dynamische PortalEngine und ContentManagementSystem
kanzlei-boecker.de Joomla Joomla
509 ..::Phoenix Lounge::.. Phoenix
Phoenix Lounge. Bar Restaurant Cafe in Schöneberg.
phoenixlounge.de Phoenix Lounge Phoenix
510 Rosenscharf und Edelsüß Catering ZOE
Restaurant ZOE Berlin. Asiatische und mediterrane Küche zwischen Hackeschem Markt und Alexanderplatz in Berlin Mitte.
rosenscharf-edelsuess.de ZOE Restaurant Lounge
511 Tucanu Webseiten leicht Jürgen
tucanu der Weg zur eigenen Homepage leicht zu haben einfach zu bedienen
tucanu.de Jürgen Kubens Beratung
512 Nicolai Thärichen Komponist Arrangeur Thärichens
Nicolai Thärichen Komponist Arrangeur Pianist Aktuelles 2009 Thärichens Tentett Konzerte
thaerichen.de Thärichens Tentett Konzerte Myspace
513 Felicitas Jacobs Theaterpädagogin Theater
Ich biete vielfältige theaterpädagogische Qualifikationen als Ausbildung oder Fortbildung initiiere theatrale Prozesse und entwickle
theaterpaedagogische-kunst.de Theater Pädagogik Spiel
Herzlich willkommen bei der URBANIS GmbH
urbanis-berlin.de URBANIS Berlin Unternehmen
515 Ihre Website erstellen
Alles rund um die Website. Vorkonfiguriert oder maßgeschneidert für lokale Unternehmen aus Dienstleistung Handwerk
516 Studio la voce Sängerin
Stefania Erzmoneit Habsburgerstrasse 5 10781 Berlin fon: 03021 99 68 23 fax:
studiolavoce.de Sängerin Sängerin Klang
517 Home Andrea Schlinkert Queer
Dies ist die Seite von Andrea Schlinkert Tanzlehrerin und Djane in Berlin.
tangoschlampen.de Queer Tango Queer Argentino
518 Willkommen auf der Startseite Tango
Tango Rueda eine Begegnung in vier Takten in Berlin
tangorueda.de Tango Rueda Berlin
519 VIEV | NEW
VIEV ? das sind Wagner Werner ein deutschchilenisches Designerkollektiv aus Berlin.
520 Excelle.consulting | Produktions und excelle.consultin
excelle.consulting bietet kundenindividuelle Lösungen zu Fragen der strategischen Unternehmensentwicklung und der Gestaltung operativer Leistungsstrukturen sowie
excelle.de Excelle.consulting Excelle Excelle.de
521 Wanderreisen Pierolt Wanderreisen
Wanderreisen Pierolt Wandern im Spreewald Hüttenwanderung in den Lienzer Dolomiten Wandern rund
wanderreisen-pierolt.de Wanderreisen Pierolt Wandern Im
522 SammlungsVerkauf coupon
Webdealscout Suche deine Gutscheine Deals und Rabatte
webdealscout.de Coupon Gutschein Geschenk
523 Theo G. Gilbers Sexualpädagoge
Sexualpädagogische Fortbildung für pädagogische und psychosoziale Fachkräfte
theogilbers.de Sexualpädagoge Und Sexualtherapeut
524 Schmuckmanufaktur Berlin Goldschmiedin Schmuckmanufaktur
Schmuckmanufaktur Berlin Goldschmiedin Schmuck Trendart
schmuckmanufaktur-berlin.de Schmuckmanufaktur Berlin Goldschmiedin
525 LumpenPrinzessin ... Kinderkleidung Kinderkleidung
Die LumpenPrinzessin bietet seit über 15 Jahren Alles für Baby und Kind in gut erhaltener
schuhchen.de Kinderkleidung Kindermode Kinderschuhe
526 Robert Berghoff Berlin robert
Mit einfachem Blick auf die Dinge: Bildgestaltender Kameramann Director Of Photography Cinematographer
robertberghoff.de Robert Berghoff Filme
527 Schuldnerberatung Berlin Schuldenberatung Berlin Schuldnerberatung
? Schuldnerberatung Berlin vom Anwalt Privatinsolvenz Restschuldbefreiung Verbraucherinsolvenz Schuldenberatung Verbraucherinsolvenzverfahren. Rechtsanwalt Pillig Berlin
restschuldbefreiung.de Schuldnerberatung Berlin Privatinsolvenz Restschuldbefreiung Schuldenberatu
528 HOME
Schulshirt Schulkleidung Schuluniform TShirts PoloShirts Sweatshirts Kapuzenshirts Kleidung Uniform Schule Freizeit Caps
529 Home ? Goldschmiede Schmuckbotschaften
Goldschmiede Schmuckbotschaften aus Berlin entwirft individuellen Schmuck!
530 Startseite
Anwälte Steuerberater PSInkasso
531 Gabriele Steiner Praxis für Ärztin
Gabriele Steiner Praxis für Homöopathie am Winterfeldtplatz in BerlinSchöneberg Ärztin für Allgemeinmedizin
steiner-gabriele.de Ärztin Homöopathie Homoeopathie
532 Stephan Szasz Startseite Über
Ich bin Stephan Szasz aus Berlin und erzähle euch auf dieser Webseite ein paar Geschichten
stephan-szasz.de Über Mich Hobby
533 Patwork
534 52. DeutschFranzösisches Volksfest Schaustellerverband Berlin e.V. Deutsch
Das mit Abstand größte jährliche Volksfest in Berlin Willkommen auf über 40.000m² Erlebnisfläche!
volksfest-berlin.de Deutsch Französisches Volksfest Laune
535 Apartment Dr. Claudia Malzfeldt
536 Wirtschaftsmediatoren Berlin Wirtschaftsmediat
Wirtschaftsmediatoren Berlin
wirtschaftsmediatoren-berlin.de Wirtschaftsmediator Mediator Madiation Spannagel Eckolt
537 Home Musik
Kinderlieder Wir Kinder vom Kleistpark gute Musik für Kinder Konzerte für Kinder
wirkindervomkleistpark.de Musik Für Kinder Kinderkonzerte
538 Ölmühle Berlin Olivenöl
Olivenöl aus der ölmühle Berlin Schöneberg. Bei uns finden Sie ein Sortiment von über 60 meist
xn--lmhleberlin-qfb4f.de Olivenöl Olivenholz Balsamico
539 Home
Sachverständiger von der Handwerkskammer Berlin öffentlich bestellter und vereidigter Sachverständiger für das Dachdeckerhandwerk Steildacheindeckungen
540 Brautkleider alles für Kalamov und Kalamova GbR
Bei uns finden Sie moderne und günstige Brautkleider Abendmode Accessoires Dessous. Schneller
541 Anke Sevenich | Schauspielerin
Anke Sevenich gehört zu den besten wenn auch eher unauffälligen Schauspielerinnen des deutschen Fernsehens
542 Restaurant AltÖsterreich Startseite Restaurant
Restaurant AltÖsterreich heißt: Echtes Wiener Schnitzel duftende Frittatensuppe eine ordentliche Portion Kaiserschmarrn oder
alt-oesterreich.de Restaurant AltÖsterreich Alt
543 Startseite Queer
Musikversierte und begeisterte Djane mit breitgefächertem Musikrepertoire für jegliche Anlässe buchbar. Ob Standard und Lateinmusik
andrea-schlinkert.de Queer Tango Queer Argentino
544 Welcome to Berlin Gym aktiv
Auf diesen Seiten findet Ihr alle Informationen rund um den Verein Berlin Gym ? Verein
berlin-gym.de Aktiv Fitness Kampfsporttraning
545 Berliner Berufsverband der Gesundheitsaufseher/Hygieneinspektoren BBGH
Der Berliner Berufsverband der Gesundheitsaufseher/Hygieneinspektoren stellt sich vor und bietet Informationsmaterial rund um den öffentlichen
bhbbev.de BBGH BVH Hygiene
546 Bing Ma Communication China
Neue Seite
bingma.de China Business Marketing
547 Schreibcoaching in Berlin Schreibcoaching
Schreibcoaching: Sie schreiben gerade an einer wissenschaftlichen Abschlußarbeit? Bringen Sie sich mit Schreibcoaching wieder in
faden-verloren.de Schreibcoaching Wissenschaftliche Abschlussarbeit
548 Ferienhaus Wittingen
Ferienhaus Wittingen
549 Organisationsberater Berater für Bio
Unternehmensberater für Ökologische Landwirtschaft (Biolandbau) und Biomarkt (Biohandel) ? Experte für Bio Lebensmittel und Biolandbau
consultantorganictrade.de Bio Lebensmittel Bioprodukte
550 Home
Brandenburger Tor Variationen mit FotoGalerie TorVariationen Brandenburg Berlin Logo
551 Floorwalker.de Einfach. Schnell. floorwalker
Ein Floorwalker bietet nicht nur bei der Einführung neuer Software effektiven Support sondern auch
floorwalker.de Floorwalker Floorwalking Office
552 FHING Aktuell Werbung
für heute ist nichts geplant
fhing.de Werbung Postkarte Schwul
553 Restaurant AltÖsterreich Startseite Restaurant
Restaurant AltÖsterreich heißt: Echtes Wiener Schnitzel duftende Frittatensuppe eine ordentliche Portion Kaiserschmarrn oder
diodata-restaurant.de Restaurant AltÖsterreich Alt
554 Startseite House of House of Queer Sisters e.V. Queer
Wir sind Sisters und Guards die Gutes tun und dies überall wo wir gebraucht
house-of-queer-sisters.de Queer Sisters Schwulen
555 OnlineShop Bastelkits. Made
Wir haben ein Kit entwickelt mit dem man gleich loslegt in dem gute
556 Linda Sixt Linda
Linda Sixt
linda-sixt.de Linda Sixt
557 Lofts Co. Lofts & Co. GmbH lofts
Lofts Co. Best in Lofts!
loftsandco.de Lofts Berlin Dachwohnung Berlin
558 Antiquariat Mertens und Pomplun Antiquariat Mertens & Pomplun GbR Antiquariat
Antiquariat antiquarische Bücher OriginalPhotographien Fotografie Plakate Landkarten Luxuspapier
mp-rarebooks.de Antiquariat Antiquarische Bücher
559 MR Patterns Willkommen Nähen
Mr Patterns das Schnittstudio fuer SelberMacher
mrpatterns.de Nähen Schnittmuster Schnittkurs
560 Psychotherapie und Coaching in
Sie suchen einen Psychotherapeuten oder Coach in Berlin? Sie sind in einer schwierigen privaten oder
561 Gaastra Napapijri Diesel online Markenmode
Fashiontex 24 Online Shop. Ihr Designer Online Shop mit Markenbekleidung wie Gaastra Jacke Poloshirt
fashiontex24.de Markenmode Gaastra Napapijri
562 Heilpraktikerin in Berlin Schöneberg Homöopathie
Isabel Blume Heilpraktikerin Klassische Homöopathie und Shiatsu in Berlin
isabel-blume.de Homöopathie Klassische Homöopathie
563 Http://www.KinderladenKonfetti.de
Mitten im Schöneberger Winterfeldtkiez in Berlin liegt der kleine bunte Kinderladen Konfetti. Zwei Erzieherinnen
Die MUTTER in Berlin Schöneberg bietet vom Frühstück im Außenbereich thailändischer Küche und Cocktails
mutter-berlin.de Thai Bar Berlin Thaifood Frühstück
565 Zuhause Mundgerecht Magazin Save
MUNDGERECHT ist mehr als nur ein Magazin. Eigentlich sind wir ein soziales Startup mit einer
mundgerecht-magazin.de Save Food Nachhaltiges Essen
566 Home Siebergraphic Siebergraphic Berlin
siebergraphic macht die Grafik für Sie in Berlin Nürnberg und Umgebung. Egal was
siebergraphic.de Berlin Grafik Illustration
567 Schlüsseldienst Tempelhof Endpreise direkt Schlüsseldienst
Günstiger Schlüsseldienst für Tempelhof. Probleme mit Ihrem Türschloss? Kein Problem. Wir helfen kostengünstig schnell
schluesseldienst-tempelhof-berlin.de Schlüsseldienst Tempelhof Ihr Schlüsseldienst
568 StoppRitalin | Die ScherretMethode Wachstumsstörunge
Bei immer mehr Kindern und Jugendlichen in Deutschland stellen Ärzte Aufmerksamkeits und Hyperaktivitätsstörungen fest.
stopp-ritalin.de Wachstumsstörungen ADHS Ritalin StoppRitalin ScherretMethode
569 HOME
570 Wellfina Wellness Fitness Naturheilkunde
Angebot: Personal Training Ernährungsberatung Mesotherapie (Anti Aging) Kinesiologie Neuraltherapie Schröpfen
wellfina.de Naturheilkunde Heilpraktiker Personaltraining
StadtBranche.de Orts-Portrait von Berlin in Berlin. Die Themenseite zu Neueröffnungen, verkaufsoffene Sonntage, Gutscheine und Coupons in Berlin erhält 3 StadtBranche Punkte - Bewertet wird die Anzahl der Besucher dieser Themenseite. Stand: + Kontakt

Berlin ist die Bundeshauptstadt der Bundesrepublik Deutschland und zugleich eines ihrer Länder. Die Stadt Berlin ist mit rund 3,5 Millionen Einwohnern die bevölkerungsreichste und mit 892 Quadratkilometern die flächengrößte Gemeinde Deutschlands sowie nach Einwohnern die zweitgrößte der Europäischen Union. Sie bildet das Zentrum der Metropolregion Berlin/Brandenburg und der Agglomeration Berlin . Der Stadtstaat unterteilt sich in zwölf Bezirke. Neben den Flüssen Spree und Havel befinden sich im Stadtgebiet kleinere Fließgewässer sowie zahlreiche Seen und Wälder.

LandkreisKreisfreie Stadt Berlin