
Berlin › Kreisfreie Stadt Berlin › Berlin

Branchenbuch Berlin 10789 Berlin

Kreisfreie Stadt Berlin
Berlin (Gemeinde in Berlin) gilt als Großstadt / Metropole in Berlin. Berlin als Kreisfreie Stadt hat 3.501.920 Einwohner.
1 Asma Fahrschule Berlin Fahrschule

Die Fahrschule Asma in Berlin Wittenau bietet eine qualifizierte FĂŒhrerscheinausbildung in Großraum Reinickendorf und Oberhavel an. Unsere..
2 JF Consulting Real Estate GmbH Immobilien

Wir sind eine Immobilien-Firma, die sich auf die Vermietung und den Verkauf von Immobilien spezialisiert hat. Beim..
3 snot apple pulver Snot Apple

KENIANISCHE SPITZENQUALITÄT - Unser Gorontula-Pulver stammt aus sorgfĂ€ltig ausgewĂ€hlten FrĂŒchten aus Kenia, die fĂŒr ihre dunkle Farbe..
amazon.de/dp/b0cr7vc86t Ha Rr Yx Ea
4 apps entwickeln kosten Apps Entwickeln

Wir helfen Unternehmen dabei, die besten Remote-Technologietalente fĂŒr digitale Projekte zu finden. Projekte in den Bereichen Softwareentwicklung..
5 Halteverbot030 Berlin Halteverbot Berlin

Die eigene Halteverbotszone in Berlin Willkommen bei Halteverbot Berlin, Ihrem zuverlĂ€ssigen Partner fĂŒr Halteverbotsservice und Halteverbotsschilder in Berlin...
6 Halteverbot030 Halteverbot Berlin

Die eigene Halteverbotszone in Berlin Willkommen bei Halteverbot Berlin, Ihrem zuverlĂ€ssigen Partner fĂŒr Halteverbotsservice und Halteverbotsschilder in Berlin...
7 Online-Shop fĂŒr flĂŒssiges GBL (Gamma-Butyrolacton) Online-Shop

GBL (Gamma-Butyrolacton) flĂŒssig online kaufen. Wir verkaufen GBL (Gamma-Butyrolacton) in bester QualitĂ€t online. Bitte kontaktieren Sie fĂŒr..
8 Schindler UmzĂŒge Umzugsunternehmen

Herzlich willkommen bei Schindler UmzĂŒge in Berlin. Unsere Angebote und Leistungen fĂŒr UmzĂŒge aller Art finden Sie..

Kostenlos: 42 Tipps & Tricks für Arbeitswelt & Leben:
Erhalten Sie Ihr Buch "Tipps und Tricks für Arbeitswelt und Leben"
kostenlos per E-Mail als .pdf Datei:

9 Golden Transporte UmzĂŒge

Willkommen bei Golden Transporte, Ihrem starken Umzugspartner Auf der Suche nach einem herausragenden Umzugsdienstleister in Berlin und..
10 Hotel Bar im ChĂąteau Royal Berlin Bar

Unsere lebendige Hotel Bar ist das Herz des ChĂąteau Royal und ein Treffpunkt fĂŒr Berliner und GĂ€ste..
11 Umzugsexperte Berlin Umzugsunternehmen

12 24 7 SchlĂŒsselnotdienst Berlin SchlĂŒsseldienst

Herzlich willkommen bei Jakobs SchlĂŒsseldienst in Berlin! Sie brauchen einen zusĂ€tzlichen SchlĂŒssel, Ihre TĂŒr klemmt oder Sie..
13 Nanoinfinite Kleidung

Entdecken Sie NanoInfinite, Ihren Online-Shop in Deutschland fĂŒr die neuesten Trends in Mode und Technik. Stöbern Sie..
14 biometrisches passbild Passbild

Seit November 2010 ist es in Deutschland gesetzlich vorgeschrieben, fĂŒr sĂ€mtliche Ausweisdokumente ein biometrisches Lichtbild zu verwenden...
15 Mephedron (4-MMC) Online-Shop Online-Shop

Kaufen Sie Mephedron (4-MMC) online. Wenn Sie suchen, wie Sie Mephedron (4-MMC) online kaufen können, dann sind..
16 Frau Krone Heilpraktikerin fĂŒr Psychotherapie Psychotherapie

Das Leben kann herausfordernd sein. Ich Kann Dir dabei helfen Lösungen zu finden, wie Du damit umgehen..
17 RĂŒmpelgenie - EntrĂŒmpelung Auflösung & Entsorgung EntrĂŒmpelung

Mit einem Kostenvoranschlag bietet Ihnen RĂŒmpelgenie einen kompletten EntrĂŒmpelungsservice in Berlin an. Wir fĂŒgen niemals zusĂ€tzliche GebĂŒhren..
18 KEY & CASTLE Immobilien

Als erfahrene Immobilienmakler mit modernen Strategien setzen wir alles daran, Ihr Ziel - den Verkauf Ihrer Immobilie..
19 Umzugsmeister Berlin Umzugsunternehmen Berlin

20 ELV Steuerberatungsgesellschaft mbH Steuerberatung

Mit Sitz in Berlin bietet ELV Steuerberatung maßgeschneiderte Lösungen zur Reduzierung der Steuerlast fĂŒr Unternehmen und Privatpersonen...
21 https: quantumleapfitness.de NahrungsergÀnzungsmittel

Bei Quantum Leap Fitness widmen wir uns der Entwicklung von NahrungsergÀnzungsmitteln, die auf der Grundlage wissenschaftlicher Forschung..
22 Schulranzen im Europacenter Einzelhandel

Das Schulranzen Europacenter, gelegen im Europa-Center Berlin, ist Ihr spezialisierter Ansprechpartner fĂŒr Schulranzen und SchulrucksĂ€cke. Wir prĂ€sentieren..
23 Umzug MĂŒller Umzugsunternehmen Berlin

Bei uns erhalten Sie alles aus einer Hand: vom passenden Möbelwagen bis zum Umzugsmaterial in Berlin –..
24 TAXURA GmbH Steuerberatungsgesellschaft Steuerberater

Expertise fĂŒr Unternehmen deutschlandweit. Spezialisiert auf GmbHs, Freiberufler und Gewerbetreibende, unterstĂŒtzen wir bei Buchhaltung, Jahresabschluss, SteuererklĂ€rungen und Lohnabrechnungen. Unser..
25 Fabian May - Deutsche Vermögensberatung | Finanzberater

Als erfahrener Finanzexperte stehe ich Ihnen bei allen Fragen rund um Ihre Finanzen zur Seite. Ich biete..
26 DATA Bau- und GebÀudemanagement GmbH GebÀudemanagement

Willkommen bei DATA Bau- und GebĂ€udemanagement GmbH, Ihrem zuverlĂ€ssigen Partner fĂŒr umfassende Dienstleistungen im Bereich der GebĂ€udereinigung..
27 Spanndecken in Berlin Spanndecken

Brauchen Sie weitere Info ĂŒber Spanndecken? Mit einem Angebot an Spanndecken Montage Berlin können Sie sich auf..
28 Umzugsprofi Herrlich Umzugsunternehmen Berlin

Bei uns erhalten Sie alles aus einer Hand: vom passenden Möbelwagen bis zum Umzugsmaterial in Berlin –..
29 SteinStar UG Dachreinigung

Die Fachfirma SteinStar aus Berlin ist ein professioneller Anbieter fĂŒr Steinreinigung, Dachreinigung & Fassadenreinigung. Geringe Kosten &..
30 Expressumzug Fritz Umzugsunternehmen

Bei uns erhalten Sie alles aus einer Hand: vom passenden Möbelwagen bis zum Umzugsmaterial in Berlin –..
31 Atlas Marketing GmbH SEO Agentur

FĂŒr den lokalen Erfolg Ihres Business brauchen Sie eine Local SEO Optimierung mit einer professionellen Google My..
32 PikPok.de Werbeartikel

PikPok.de ist ein Spezialist fĂŒr Werbeartikel in Berlin, Spandau. Das Unternehmen bietet individuelle Veredelungstechniken wie Stickerei, Plotten..
33 physioup Filip Lisicki & Marijo Zupanovic Physiotherapie

Herzlich willkommen in unserer freundlichen und kompetenten Physiotherapie-Praxis in Berlin-Zehlendorf! Unsere freundliche Anmeldung empfÀngt Sie in unseren..
34 Balkon Sichtschutz Druckerzeugnisse

35 physioup Filip Lisicki & Marijo Zupanovic Physiotherapie

In unserer Praxis fĂŒr Physiotherapie in Berlin Lichterfelde steht Ihnen ein junges, dynamisches Team gut ausgebildeter und..
36 TS Service Supply GmbH Reinigungsservice

Wir sind die TS Service Supply GmbH, ein in 2023 gegrĂŒndetes Unternehmen mit Hauptsitz in Berlin und..
37 Virtual Office Berlin - GeschÀftsadresse mieten Internet Marketing

Unser Berliner Virtual Office bietet umfassende Dienstleistungen fĂŒr dein Unternehmen: eine renommierte Adresse in Berlin als offiziellen..
38 24 7 SchlĂŒsselnotdienst - Wir öffnen SchlĂŒsseldienst

Der Express NotschlĂŒsseldienst Berlin zeichnet sich durch seine schnelle und zuverlĂ€ssige Reaktion auf NotfĂ€lle rund um SchlĂŒssel..
39 Express NotschlĂŒsseldienst Berlin SchlĂŒsseldienst

Der Express NotschlĂŒsseldienst Berlin zeichnet sich durch seine schnelle und zuverlĂ€ssige Reaktion auf NotfĂ€lle rund um SchlĂŒssel..
40 SFS GebÀudereinigung Berlin GmbH GebÀudereinigung

Willkommen bei SFS GebĂ€ude Reinigung Berlin! Wir sind Ihr zuverlĂ€ssiger Partner fĂŒr eine Vielzahl von Reinigungsdienstleistungen. Unser..
41 Doba Elektrotechnik Elektriker

Doba Elektrotechnik beschÀftigt sich mit der Planung, Realisierung und Betreuung Ihrer Elektroinstallation im Privaten und Gewerblichen Bereich..
42 Researched chemicals for experimental use only Onlineshop

Get the full experience of researched chemicals in number 1 quality..
43 Emailvalidation io Email PrĂŒfung

Emailvalidation.io bietet eine umfassende E-Mail Checker Software fĂŒr die automatisierte Validierung von E-Mail-Adressen. Mit dem Ziel, die..
44 Baumpflege Berlin Baumpflege

Wir bieten Baumpflege Leistungen in Berlin an: - Allgemeine Baumpflege - BaumfÀllungen - Baumschnitt - Baumkontrolle - Baumgutachten - Heckenschnitt..
45 Dr. zara javidnia HautÀrzin

46 Purang Khademi Zahnarzt

47 Enqome GmbH Finanzen

Enqome ist ein umfassendes Finanzportal, das individuelle UnterstĂŒtzung rund um Geldanlagen, Kredite, Girokonten und mehr bietet. Mit..
48 Hausboot-Urlaub24.de Hausboot Urlaub

Hausboot-Urlaub24 bietet die perfekte Möglichkeit, Deutschland vom Wasser aus zu erkunden. Mit einer Vielzahl von Hausbooten, die..
49 Performance Coaching Berlin Coaching

Performance Coaching Berlin ist ein Unternehmen, das von Christopher Mehl, einem zertifizierten Coach, gegrĂŒndet wurde. Das Unternehmen..
50 Purang Khademi Zahnarzt

Sehr geehrte Damen und Herren, Bitte , Bitte, je Schnell, wie möglich, Löschen Sie die Name ..
51 STARBEIT Online-Handel

Lust auf was Kleines - In der Modemetropole Berlin steht STARBEIT fĂŒr Accessoires, die zeitlose UrbanitĂ€t verkörpern...
52 ersatzteilcheck24 Elektrotechnik

Ersatzteilvertrieb fĂŒr HausgerĂ€te weltweit per DHL..
53 All About Phones Handyreparatur

Wir reparieren Dein Samsung, Apple und Huawei Smartphone! Ob Glasbruch, Lautsprecherwechsel oder defekte Ladebuchse. Bei uns bist..
54 Andreas Schubart Immobilien Immobilien

55 Fast Buds Gesundheit

Fast Buds ist ein Anbieter von autoflowering Cannabis-Samen, der sich durch die Nutzung von preisgekrönten amerikanischen Genetiken..
2fast4buds.com/ Auto Indica Strains Sativa Fast Cart Pack Seeds
56 Purang Khademi Zahnarzt

Bitte entfernen Sie meine Adresse von Ihre Seite! meine Praxis ist nicht in der Avecinna Klinik. Vielen Dank fĂŒr..
57 Creative Web Developer Ingo Steinke Web-Entwicklung

Ingo Steinke ist als kreativer Frontend-Webentwickler spezialisiert auf barrierefreie, responsive Web-Entwicklung, ökologische Nachhaltigkeit und schnelle Ladezeit. Angebot:..
58 Kleiderordnung Personal Sustainable Stylist Tina Steinke Modeberatung

Ich bin Tina Steinke, Personal Sustainable Stylist (nachhaltige Stil- und Modeberaterin), begeisterte Second Hand und Vintage Fashionista..
59 Jens Korz Coaching

Durch Jens Korz einzigartige Methodik werden Teilnehmer nicht nur in theoretischen Konzepten geschult, sondern erhalten auch praktische..
60 Kent SchlĂŒsseldienst & TĂŒröffnung Berlin SchlĂŒsseldienst

Willkommen beim Kent SchlĂŒsseldienst Berlin! Wir sind Ihr vertrauenswĂŒrdiger Partner fĂŒr professionelle SchlĂŒsseldienstleistungen. Unser engagiertes Team steht..
61 Pergolaria Dachdecker

Willkommen bei Pergolaria, Ihrem zuverlĂ€ssigen Partner fĂŒr individuelle Pergolen! Wir setzen auf höchste QualitĂ€t und verwenden ausschließlich hochwertige..
pergolaria.de Jakarta Sansfont Segoe Sans Pergolaria Emoji Home Roboto
62 PANDA platforma Jazz Clubs

PANDA platforma ist ein gemĂŒtlicher, intimer Club mit Bar in der Kulturbrauerei (Berlin/Prenzlauer Berg). Hier finden jeden..
63 Couple & Individual Therapy (EN ES Psychologen &

Individual and couple therapy in English. Terapia individual y de pareja en español. Einzel- und Paartherapie auf Deutsch. https://www.pablo-corbalan.com/..
pablo-corbalan.com/en Body Zk Loin Heading Page Booking Bookings My
64 Pergolaria Pergola

Willkommen bei Pergolaria - Ihrem Experten fĂŒr hochwertige Pergolen und erstklassigen Montageservice! Pergolaria bietet ihnen eine Pergola von..
pergolaria.de/ Jakarta Sansfont Segoe Sans Pergolaria Emoji Home Roboto
65 Fahrschule ZweiSieben GmbH Fahrschulen

Die Fahrschule ZweiSieben ist eine in Berlin Wilmersdorf / Charlottenburg ansÀssige Fahrschule, die auf Erfahrungen aufbaut, die..
66 Almansi Kfz Werkstatt Autowerkstatt

Unsere Serviceleistungen: Mechanik Reifen Ölwechsel HU/AU (tĂ€glich) Inspektion Bremsen Klimaanlage Fehlerdiagnose Dieseltechnik oder Automatikgetriebe Abholmöglichkeit (Abschleppservice)..
al-mansi.com/kfz Loin Stylable Blog Booking My Bookings Post Agcgu
67 Klebefisch.de Painter

Klebefisch.de ist dein professioneller Onlineshop fĂŒr Aufkleber, Folien und Beschriftungen aller Art. Ob du dein eigenes Design..
68 Restaurant ChĂąteau Royal Restaurant

69 Blanc - Design Studio Berlin Grafikdesign

Durch ein starkes Grafikdesign wird eine Marke leicht identifizierbar, unterscheidet sich von anderen Unternehmen und schafft Vertrauen..
70 KS SchlĂŒsseldienst Berlin SchlĂŒsseldienst

WILLKOMMEN BEIM KS SCHLÜSSELDIENST Ihr VertrauenswĂŒrdiger Partner Unsere Dienstleistungen: TĂŒröffnungen Schlosswechsel Einbruchschutz Notdienst 24/7 Schließanlagen Beratung und Installation von Sicherheitstechnik..
71 Lab der Musik Musikschule

Lerne von den besten Musikern, im Komfort deines Zuhauses Trete einer lebendigen Gemeinschaft von Mitlernenden bei. Werde der..
72 Berliner KĂŒchenstudio Kitchen Studio

FIND YOUR DREAM KITCHEN IN OUR ONLINE KITCHEN STUDIO BERLIN Contact us https://berlinerkuechenstudio.de/ info@berlinerkuechenstudio.de +4915792604279 Credit Card, Cash, Bank Transfer Mo-Sa. 8.00 -..
73 School of Sculpture Bildhauerschule

In dem idyllischen Garten der alten Monopol Destille in Reinickendorf lÀdt die "School of Sculpture Berlin" dazu..
schoolofsculpture.com/ Helvetica Loin Poppins Heading Body Montserrat My Groups
74 Harfenspieler buchen Harfenspieler

Entdecken Sie Harfenspieler Buchen - Atemberaubende Harfenmusik fĂŒr Ihre Veranstaltung Harfenspieler Buchen ist die perfekte Wahl fĂŒr alle..
75 Garnelen-Guemmer Aquaristik

Berlin - Steglitz
Herzlich Willkommen in unserem Aquaristik LadengeschĂ€ft. Wir beschĂ€ftigen uns seit ĂŒber 10 Jahren mit der modernen Aquaristik..
76 Toplightstore Beleuchtungsarmatur

Toplightstore ist ein erstklassiger Online-Shop fĂŒr hochwertige Kronleuchter und andere Beleuchtungsoptionen zu außergewöhnlichen Preisen...
77 SEO Agentur Berlin Online-Marketing-Unternehmen

Die SEO-Sicht ist eine auf Suchmaschinenoptimierung (SEO OnPage & OffPage) spezialisierte SEO Agentur in Berlin. Der Vorteil..
78 Jolie Begleitservice Begleitservice

Bundesweit, vor allem in Berlin, bietet Jolie Begleitservice fĂŒr Herren und Damen zu Events, Veranstaltungen, ebenso Haus-..
79 Ootel.co Hotel

Entdecken Sie erstklassige UnterkĂŒnfte in Berlin mit Ootel.com. Unser Hotel und Hostel bietet erschwinglichen Komfort fĂŒr jeden..
80 Webspace One Webdesign

WEBSPACE ONE ist eine fĂŒhrende Webdesign-Agentur in Berlin, die sich auf die Erstellung von maßgeschneiderten Websites spezialisiert..
81 Ootel.com Hotel

Berlin - Marzahn
Dieses moderne Hostel bietet eine 24-Stunden-Rezeption und einfach eingerichtete Zimmer. Hier wohnen Sie im Stadtteil Marzahn-Hellersdorf, nur..
ootel.com Berlin Hotel Hostel Ootelcom Buchen Bed Room Budget
82 Alpha Reparaturdienst Elektro- und

Mit unserem Elektro Reparatur Experten sind wir Ihre Ansprechpartner fĂŒr die Reparatur von HaushaltsgerĂ€ten in Berlin. Dank..
alpha-reparaturdienst.de/ Reparatur Garantie Berlin HaushaltsgerÀte Reparaturdienst Alpha Ihr GerÀte
83 Anja Mey fotografie & design Fotograf

Fotografie und Design Fotodesign Hochzeitsfotografie Firmen-, Event- und Portraitfotografie..
anjamey.de Sans Roboto Hochzeit Product Posts List Cart Add
84 NEO Catering Berlin Catering

Professioneller Caterer fĂŒr private und gewerbliche Events jeglicher Art in Berlin und Umgebung. Individuelle Beratung fĂŒr kleine..
neo catering berlin gmbh
85 Anabolik Apotheke Pharmakologie

Das Unternehmen befasst sich mit der Lieferung, der Beratung und dem Verkauf von Arzneimitteln..
anabolikapotheke.com/ Kaufen Steroide Pharmaceuticals Magnus Anabolika Deutschland Tabletten Peptide
86 Ahmed Yousef LL.M. Ägyptischer Anwalt in Attorney At

Wir sind eine Rechtsanwaltskanzlei mit Rundumservice. Wir bieten Rechtshilfe in Rechtsfragen im Zusammenhang mit Àgyptischem und internationalem..
egy-lawyer.com/?lang=de Egyptian Anwalt Recht Berlin Germany Deutschland Law Rechtsanwalt
87 Beiladung-in-Berlin Movers

Wir sind Ihr Beiladungs Experte in Berlin – auf unserer Seite finden Sie alles, was Sie fĂŒr..
beiladung-in-berlin.de/ Berlin Beiladung Umzug Ihren Transport GegenstÀnde Angebot Ihr
88 Ihr FĂŒhrungs Coach Coach

Als Wirtschaftspsychologin begleite ich Sie auf Ihrer Reise zur persönlichen und beruflichen Weiterentwicklung. In meinen individuellen Coachings..
xn--ihr-fhrungs-coach-62b.de/ Cookie Lioba Name Coaching Eich Inhalte DatenschutzerklÀrung Ireland
89 Beiladung-in-Berlin Movers

Wir sind Ihr Beiladungs Experte in Berlin – auf unserer Seite finden Sie alles, was Sie fĂŒr..
beiladung-in-berlin.de/ Berlin Beiladung Umzug Ihren Transport GegenstÀnde Angebot Ihr
90 formlos Plastik Bildhauerei

Skulpturen, Formdesign, Malerei..
petergragert.jimdo.com Home BĂŒhnen Filmplastik Texte Seite Malerei Arbeiten Berlin
91 Transportheld.de Auto

Wir von Transportheld.de machen es Ihnen leichter, das Beste aus Ihren Reisen und Abenteuern zu machen. Wir..
transportheld.de/dachbox-mieten/ Du Cookie Dachbox Name Arial DatenschutzerklÀrung Berlin Helvetica
92 MĂŒller & Woschke UG Umzugsfirma

Bei umzug-berlin.de MĂŒller & Woschke UG erhalten Sie kostenlose und unverbindliche Umzugsangebote aus Berlin, nach Berlin und..
umzug-berlin.de Berlin Umzug Umzugsunternehmen MĂŒller Woschke Ihr Ihren Umzugsfirma
93 Privat- GeschÀfts- und Hypothekenkredite zu 2 FINANZIEREN

wellcometrustplc.com Loan Finance Business We Apply Management Us Bank
94 Umzugsunternehmen-Berlin.de Umzugsunternehmen

Um ein individuelles und maßgeschneidertes Umzugsangebot zu erhalten, wenden Sie sich an ein zuverlĂ€ssiges Umzugsunternehmen. Professionelle und..
umzugsunternehmen-berlin.de/ Berlin Umzug Umzugsunternehmen Kosten Wohnung Cookie UmzĂŒge Umzugsangebote
95 Aktion gegen den Hunger gGmbH Hilfsorganisation

aktiongegendenhunger.de Hunger Mio Aktion Unsere Menschen Spenden Nothilfe Osten
96 StudiBucht Ghostwriter Preise

studibucht.de/preise/ Ghostwriter Seite Eventrocket Preise Kosten Ghostwriting Promiset Rocket
97 Frieden UmzĂŒge UmzĂŒge

Frieden UmzĂŒge in Berlin ist Ihr kompetenter und verlĂ€sslicher Dienstleister fĂŒr UmzĂŒge in Berlin. Als selbststĂ€ndig gemachtes..
frieden-umzuege.de Sans Berlin UmzĂŒge Frieden Umzug Ihren Cuse Leistungen
98 Heid Immobilienbewertung Berlin SachverstÀndiger Immobiliengutachter Berlin Immobilienbewertung

Heid Immobilienbewertung Berlin, Ihr zuverlĂ€ssiger Partner fĂŒr wichtige Schritte wie den Kauf, Verkauf oder die Vererbung von..
heid-immobilienbewertung.de/berlin/ Berlin Immobilienbewertung Immobilie Immobiliengutachter SachverstÀndigen Unsere Gutachten Immobilien
99 kredite24-sofort.de Finanzen

Kredite24 Sofort ist bestrebt, die Finanzplanung fĂŒr jeden zu erleichtern. Unser Angebot an Krediten ist auf einfache..
kredite24-sofort.de/ Kredit Sofort Roboto Kredite Monate Rate Tipp Laufzeit
100 OneCareer GmbH Beratung

OneCareer - Deine Plattform fĂŒr beruflichen Aufstieg. In unserer Rolle als zertifizierter BildungstrĂ€ger fokussieren wir auf hochwertige Ausbildung..
onecareer.de/ Weiterbildung One Gmb Dein Partner Weiterbildungen Projektmanager Lehrgang
101 JOB POINT Berlin Arbeitsvermittlung

Das Berliner Projekt JOB POINT, unterstĂŒtzt durch die Senatsverwaltung fĂŒr Arbeit, Soziales, Gleichstellung, Integration, Vielfalt und Antidiskriminierung..
jobpoint-berlin.de/ Berlin Sans Arbeit Item Unternehmen Minijobs Menschen Job
102 Luftballons bedrucken lassen Luftballons

Luftballons bedrucken lassen - eine kreative Werbemöglichkeit, die fĂŒr jeden Anlass geeignet ist. Egal ob fĂŒr Events..
luftballons-bedrucken-lassen.de Luftballons Nutzen Werbung Events Messen AnlÀsse Drucken Designs
103 Rhetorik Trainer Berlin Rhetorik Trainer

Berlin ist nicht nur eine Stadt, sondern ein Schmelztiegel von Ideen, Kulturen und Visionen. Genau hier setzen..
rhetorik-trainer-berlin.de/ Rhetorik Cookie Berlin Name Trainer DatenschutzerklÀrung Kamera Zweck
104 AdsXpress GmbH - Google & Amazon Online Marketing

Unser Team versteht die besonderen BedĂŒrfnisse von Einsteigern ins Online Business, kleinen und mittleren Unternehmen (KMUs) und..
adsxpress.de/ Ads Google Kampagnen Amazon Ihr Team Preis Partner
105 Loehn Digital Webdevelopement

loehn-digital.com/ Wiedergabeliste Datei Bild Quelle Audio Online Video Ads
106 fĂŒhrerschein kaufen 400 euro Driving Licence

Unsere Erfahrung Mit stolzen 15 Jahren Erfahrung haben wir uns als Anlaufstelle fĂŒr Menschen etabliert, die einen legalen..
xn--fhrerschein72-wob.com/ Top Header Sliding FĂŒhrerschein Action Side Klasse Footer
107 Meet your Writer Bildung

Meet your Writer ist eine Plattform, auf der akademische Ghostwriter und Auftraggeber:innen erstmals direkt aufeinandertreffen. Keine anonyme..
meet-your-writer.com Wissenschaftliche Arbeit Such Ghostwriter Direkter Kontakt Agentur
108 LB Detektive GmbH · Detektei Berlin Detektei

LB Detektive GmbH · Detektei Berlin · Privatermittler: Ihr Ansprechpartner im Bereich Privatermittlungen, Detektivdienste und UnternehmensaufklÀrung. Wir..
lb-detektei.de/detektei/berlin.html Berlin Detektei Cookie Detektive Abhörschutz Lauschabwehr Partner Google
109 Individuelle Berlin Stadtrundfahrten fĂŒr Gruppen Berlin Berlin

Hochwertige, individuelle Panorama Berlin Stadtrundfahrten zum Wunschtermin; perfekt fĂŒr kleine und große Gruppen. Qualifizierte Berliner GĂ€stefĂŒhrer StadtfĂŒhrer..
berlin-stadtrundfahrt-online.de Berlin Berliner Stadtrundfahrt City StadtfĂŒhrungen Tour Stadtrundfahrten StadtfĂŒhrung
110 ErfolgsStories Medienunternehmen

Das Magazin fĂŒr inspirierende Erfolgsgeschichten und wegweisende Projekte. Tauchen Sie ein in die faszinierende Welt erfolgreicher Persönlichkeiten..
erfolgsstories.net Wochen Roboto Ups Medien Serif Start Personen Unternehmen
111 Umzugsfirma Rauch Umzug &

Bernau bei Berlin
Umzugsfirma Rauch ist ein Spezialist fĂŒr Umzugsdienstleistungen in Brandenburg mit ĂŒber zehn Jahren Erfahrung. Sie bieten eine..
umzugsfirmarauch.de/ Condensed Umziehen Nitro Mutation Titel Eventnitro Vfor Ie
112 mama trattoria Berlin Westend Italienisches Restaurant

Entdecken Sie die moderne italienische KĂŒche im Herzen des Berliner Westends bei mama Trattoria am Theodor-Heuss-Platz 2...
mama.eu/mama-berlin-westend/ Cookie Name DatenschutzerklÀrung Anbieter Zweck Inhalte Laufzeit Akzeptieren
113 Top Schmuckgutachter Berlin Schmuckgutachter

Gutachten fĂŒr Schmuck durch zertifizierten SachverstĂ€ndigen in Berlin und Umgebung! Im Bereich Nachlass erstellen wir ĂŒber unser..
berlin-schmuckgutachter.de/ Berlin Schmuckgutachter Schmuck Netzer Gutachten Beratung Nicole Stefan
114 Bite Club Praxis fĂŒr KieferorthopĂ€die KieferorthopĂ€die

Meine Leidenschaft gilt Ihren Zähnen, genauer gesagt: deren Position. Denn je perfekter diese ist, desto gesünder sind..
bite-club.berlin/ Berlin Prenzlauer Berg Behandlung Club KieferorthopÀdie Kieferorthop Speicherung
115 Sebastian Klammer Grafikdesign Berlin Webdesign Grafikdesign

Vom Webdesign bis zum Branding: Gutes Design weckt Neugier – und verbindet. Zum Beispiel Sie und Ihre..
sebastian-klammer.de Grafikdesign Webdesign Sebastian Klammer Berlin Design Web Entwicklung
116 TORBAR Meier Herold Gastro GmbH Französisches Restaurant

Lieben Sie die gehobene französische KĂŒche? Haben Sie Lust auf einen Kurzurlaub in Frankreich? In unserer Brasserie..
torbar.berlin Blue Red If Berlin Get Torbarfunctiono Document French
117 Mehrere IT-affine Mitarbeiter AnfĂ€nger Quereinsteiger fĂŒr IT

Aufgaben - Mit Begeisterung stĂŒrzt Du dich in Dein Selbststudium und lernst folgende Grundlagen: Linux (sicherer Umgang mit..
adora-plus.com/ Grey Red Orange Yellow Green Cyan Blue Purple
118 European Network Services GmbH Solartechnik Reparatur

Hennigsdorf bei Berlin
European Network Services - Ihr ☀️Solar-Wechselrichter 🎯Spezialist Schnelle RĂŒckmeldungen. GĂŒnstige Optionen. PV-Systeme im Fokus. Rasche Instandsetzung. Brands: SMA..
ens-group.eu/de Loin Cormorant Stylable Blog Kvo My Garamond Poppins
119 BFT Verpackungen GmbH Verpackungen

BFT Verpackungen ist ein Unternehmen, das Verpackungen fĂŒr B2B-Unternehmen vertreibt. Wir bieten Doypacks, Druckverschlussbeutel, Kaffeeverpackungen, Flachbeutel, Versandtaschen..
bft-verpackungen.de/ Html Standbodenbeutel Doypack Kraftpapier Ventil Google Flachbodenbeutel Informationen
120 BFT Verpackungen GmbH Verpackungen

BFT Verpackungen ist ein Unternehmen, das Verpackungen fĂŒr B2B-Unternehmen vertreibt. Wir bieten Doypacks, Druckverschlussbeutel, Kaffeeverpackungen, Flachbeutel, Versandtaschen..
bft-verpackungen.de/ Html Standbodenbeutel Doypack Kraftpapier Ventil Google Flachbodenbeutel Informationen
121 YAP you are perfect. Friseur AVEDA

Friseur/ Stylist/ Make Up/ Hairdresser/ Hochsteckfrisuren/ Farbtechniken/ Balayage/ Damen/ Herrn/ Kreativ/ Alternativ/ Klassisch/ Dauerwelle/ Esprit/ Friedrichshain/ Charm/..
y-a-p.de Deiner Dich Du Deinen Dir Ajax Termin Content
122 Legal Anabolika Apotheke

Legal Anabolika ist ein angesehener Online-Shop fĂŒr Steroide in Deutschland. Der Hersteller ist seit ĂŒber einem Jahrzehnt..
legaleanabolika.com/ Testosteron Steroide Trenbolon Peptide Injektionen Kurse Anabolika Steroid
123 Produktfotograf aus Berlin Produktfotografie

Willkommen bei Produktfotografie Berlin. Wie der Name es schon sagt, sind wir Ihre Agentur rund um das Thema..
produktfotografieberlin.de Helvetica Stylable Blog Portfolio Ke Objectassign Ba Page
124 about:dents - Praxis fĂŒr Zahnmedizin Zahnarzt

Schöne ZÀhne sind unser AushÀngeschild. Ein schönes LÀcheln zieht an und bleibt im GedÀchtnis, ob in der..
about-dents.de Praxis Team LĂ€cheln Date Termin Behandlung Uhr Zahnmedizin
125 Hotel ChĂąteau Royal Berlin Hotel

chateauroyalberlin.com/de Royal Ch Hotel Zimmer Berlin Suiten Restaurant Mitte
126 Hercules Transporte UmzĂŒge

Das Möbeltaxi Berlin von Hercules Transporte hat sich auf den professionellen und zuverlÀssigen Kleintransport von Möbeln und..
moebeltaxi-berlin.com Transporte Berlin Möbel Hercules Möbeltaxi Transport Ihr Fsvg
127 SeniorenLebenshilfe Beate Rosner Seniorenbetreuung

Bernau bei Berlin
Die SeniorenLebenshilfe ist bundesweit eins der ersten Unternehmen, die sich auf die vorpflegerische Betreuung spezialisiert haben. Wir..
seniorenlebenshilfe.de/lebenshelfer-brandenburg/lebenshelferin-beate-rosner/ Live Bitte Senioren Pflichtfeld Anfrage Applying Mail Berlin
128 Zahnarztzentrum am Wittenbergplatz Zahnarzt

Das Zahnarztzentrum am Wittenbergplatz in Berlin Schöneberg bietet Ihnen eine umfassende Palette von zahnmedizinischen Leistungen. Ob konventionelle..
zahnarzt-berlin-wittenbergplatz.de Wittenbergplatz Infos Zahnspange Prophylaxe Behandlung Zahnimplantate Narkose Zahnarzt
129 qoq.me Soyiale Medien

santana row. san jose. ca 300
130 Aslan Ambulanter Pflegedienst GmbH Pflegedienst

Aslan-Pflege ist hier, um Ihnen zu helfen. Wir bieten einen glĂŒcklichen und gepflegten Pflegedienst in Berlin. Seit..
aslan-pflege.de/ Berlin Sans Rotate Fade Blur Zoom Pflegedienst Pflege
131 Umzugskracher Berlin-Tiergarten UmzĂŒge

Sie wĂŒnschen sich ein professionelles Umzugsunternehmen in Tiergarten-Berlin, der Ihre Einpack-, Transport, und Montageaufgaben ĂŒbernimmt? Das Team..
umzugskracher.de/berlin-tiergarten/ Montserrat Berlin Tiergarten Angebot Font Awesome Free Umzug
132 Umzugskracher Berlin-Kreuzberg UmzĂŒge

Sie planen einen Umzug und benötigen dafĂŒr ein erfahrenes Umzugsunternehmen in Berlin-Kreuzberg? Dann sind Sie bei Umzugskracher..
umzugskracher.de/berlin-kreuzberg/ Montserrat Berlin Angebot Font Awesome Free Umzug GĂŒnstiges
133 Butler UmzĂŒge UmzĂŒge

Butler UmzĂŒge ist ein renommiertes Umzugsunternehmen, das seit mehr als Jahrzehnten in Berlin, Deutschland, tĂ€tig ist. Unsere..
butler-umzuege.de/ Berlin Umzug UmzĂŒge Butler Umzugsunternehmen Ihr Kosten Ihren
134 RSG Register Solutions gGmbH Medizin Software

RSG Register Solutions gGmbH: Ihr Wegbereiter fĂŒr die Einrichtung von Medizinischen Registern und die Entwicklung von Patientenbefragungen..
register-solutions.de Page Not Found Segoe Emoji Noto Sans Color
135 BAS Business And Science GmbH Ghostwriting

Die BAS Business And Science GmbH ist eine Ghostwriting-Agentur aus Berlin. Sie vermittelt promovierte Ghostwriter, Coaches &..
business-and-science.de/ Science And Helvetica Not Prefetchable Ghostwriter Agentur Business
136 securyx.eu - Ihr Highspeed Computer und Computer Service

Ihr Highspeed Service Ihre alltÀglichen Computerprobleme sind unser Metier. Wir garantieren schnelle und unkomplizierte Hilfe. In unserer..
securyx.eu Start Computer Service Fsys Fcm Fpreset Fsvg Bxml
137 Geabcon Group GmbH & Co. GebÀudereinigung GebÀudereinigung

Die GeAbCon-Gruppe ist der richtige Partner, wenn es um GebĂ€udereinigung geht. Seit ĂŒber einem Jahrzehnt kĂŒmmern wir..
gebaeudereinigung-geabcon-group.de/ Berlin GebÀudereinigung Unterhaltsreinigung Group Ihr Ge Reinigung Font
138 Freelancer in Berlin werden Freiberufler

Die Freiberufler-Plattform Tiejet in Berlin bietet Freiberuflern in der Stadt eine Plattform, auf der sie ihre FĂ€higkeiten..
tiejet.com Services Design Browse Business Writing Marketing Translation Video
139 Cubepools GmbH SchwimmbÀder Erholungs-

Cubepools ist ein fĂŒhrendes Unternehmen, das sich auf die Produktion hochwertiger modularen Pools spezialisiert. Seit 2018 sind..
poolcontainers.de/ Pools Pool Container Schwimmbecken Skin Tone Transport Montage
140 Turbeleuchtung Automotive

Erleben Sie die neueste Technologie mit unserer 3D LED TĂŒrbeleuchtung Auto Logo. Perfekt fĂŒr jedes Auto, um..
turbeleuchtung.de/ Cg TĂŒrbeleuchtung Logo Csvg Audi Cpath Mercedes Product
141 FĂŒhrerschein Kaufen - FĂŒhrerschein BĂŒro FĂŒhrerschein

FĂŒhrerschein online kaufen vom FĂŒhrerschein BĂŒro, der von den Behörden registriert und legal ausgestellt wird, ohne dass..
xn--fhrerscheinbro-gsbl.de/ FĂŒhrerschein Citalic BĂŒro Informationen Behörden PrĂŒfung Kaufen Kunden
142 catering Gastronomie

grannysmithcatering.de Granny Vegan Catering Bowl Smith Spaghetti Service The
143 Coolshiftknobs Automotive

Coolshiftknobs bietet mehr als 1000 qualitativ hochwertige Schaltknauf Tuning Produkte. Sie können aus Hunderten von Optionen fĂŒr..
144 MTS UmzĂŒge Berlin Umzugfirma

Bei uns erhalten Sie alles aus einer Hand: vom passenden Möbelwagen bis zum Umzugsmaterial in Berlin –..
mts-umzug-berlin.de/ Berlin UmzĂŒge Umzug Angebot Umzugsunternehmen Montserrat Umzugsangebot Sachen
145 Berlin-Beiladung Umzug &

Willkommen bei Beiladung-Berlin, Ihrem zuverlĂ€ssigen Partner fĂŒr kostengĂŒnstige und umweltfreundliche Transportlösungen in Berlin und Umgebung. Wir spezialisieren..
146 Belim Rohr 24 ROHRREINIGUNG

Belimrohr24 ist ein professionelles Unternehmen, das sich auf die effiziente Lösung von Kanalisations- und Abflussproblemen spezialisiert hat...
belimrohr24.de/ Eventrocket Rohrreinigung Berlin Notdienst Csvg Belim Rocket Datenow
147 Sanrotech Rohrreinigung Berlin & Abwassertechnik Rohrreinigung &

Kundenvorteile auf einen Blick: - GĂŒnstiges Angebot - Unverbindliches Angebot - Anfahrtfrei - 100% Preistransparenz - Versicherungsfreundlich Das macht uns einmalig in ganz..
sanrotech.de Berlin Dein Experte Rohrverstopfung KĂŒche Keller Bad Serviceprinzip
148 Statistik Beratung & Nachhilfe - Explain Bildung

Mit meiner weitreichenden Expertise in der angewandten Statistik und zahlreichen erfolgreich abgeschlossenen Datenauswertungen & Statistik Beratungen stehe..
statistikberatung.eu Statistik Datenauswertung Beratung Daten Section Unternehmen Zeichen Portfolio
149 Pflegezentrum Rohmich Pflegezentrum

Am Anfang stehen viele Fragen. Gemeinsam mit Ihnen entwickeln wir individuelle und vielfÀltige Betreuungslösungen. Ob Grundpflege, hauswirtschaftliche..
pflegezentrum-rohmich.de/ Rohmich Pflege Pflegedienst Berlin Ihr Versorgung Leistungen Karriere
150 Familientherapie und Beratung nach Jesper Juul Heilpraktikerin FĂŒr

beratungspraxis-simpson.de Jesper Juul Inhalte Berlin Therapie Corinna Simpson Familientherapie
151 ForTomorrow gGmbH Klimaschutz

Wir sind ForTomorrow, ein gemeinnĂŒtziges Klimaschutz-Unternehmen aus Berlin. Du kannst mit uns CO2 ausgleichen. Wir kompensieren CO2-Emissionen..
fortomorrow.eu Emissionsrechte Klima Abo Klimaschutz Deutschland BĂ€ume For Emissionen
152 SĂ€uglingsbehandlung Ergotherapie

Wir bieten Ihnen und Ihrer Familie unseren Schwerpunkt der SÀuglings- und Kleinkinderbehandlung nach IntraActPlus bei Regulationsstörungen, Ess-..
ergotherapie-koepenick.de Fredersdorf Köpenick Timmer Praxis Tel Cookie Ergotherapie Auswahl
153 AD AGENDA Kommunikation und Event GmbH Event- und

Als inhabergefĂŒhrte Event- und Kommunikationsagentur fĂŒr dynamische und schlanke Kommunikation stehen wir seit ĂŒber 25 Jahren unseren..
ad-agenda.com Sans Event Kommunikation Home Shopping Gmb Brooklyn Cardo
154 Relaxmaxx – Individuelle Werbemittel mit Wunschmotiv Werbemittel -

Begeistern Sie Ihre Kunden und GĂ€ste mit individuellen LiegestĂŒhlen fĂŒr Ihr Unternehmen. Entdecken Sie die einzigartigen Holz-LiegestĂŒhle..
relaxmaxx.com Sans Event Kommunikation Home Shopping Gmb Brooklyn Cardo
155 zielgruppe kreativ | Gesellschaft fĂŒr Marketing Werbe- Kommunikations-

Unsere inhabergefĂŒhrte Agentur befindet sich mitten im pulsierenden Berlin. Wir sind spezialisiert auf glĂ€nzende Designs, wasserdichte Brandings..
zielgruppe-kreativ.com Not Prefetchable Zielgruppe Nitro Mutation Werbeagentur Eventnitro Vfor
156 Resilienztraining Alexandra Reimann Coach &

Mein Name ist Alexandra Reimann, seit 10 Jahren bin ich als Trainerin und Coach tÀtig und habe..
resilienztraining.online Reimann Resilienztraining Resilienz FĂŒhrungskrĂ€fte Training Alexandra Roboto Condensed
157 myroom24 GmbH Buchungsplattform FĂŒr

myroom24.com bietet die besten LangzeitunterkĂŒnfte wie Hotels, Serviced Apartments und gewerbliche UnterkĂŒnfte ab 1 Monat an, um..
myroom24.de UnterkĂŒnfte Unterkunft Apartment Kurz Einstellungen Hotels Apartments Hostels
158 Praxis fĂŒr Einzel- und Paartherapie Psychologen &

Einzel- und Paartherapie auf Deutsch, Englisch und Spanisch..
pablo-corbalan.com/ Loin Objectassign Ba Booking Bookings Agcgu Stylable Kcp
159 ErklÀrhelden - Die ErklÀrvideo Agentur in Videoproduktion

Unter ErklÀrhelden GbR agiert eine ErklÀrvideo Agentur aus Berlin, die sich darauf spezialisiert hat, animierte ErklÀrfilme..
erklaerhelden.de/ ErklÀrvideo Erkl Ihr ErklÀrvideos Was Grafiken Cookie Vorteile
160 Online Broker Börse

Im Zeitalter des Internets treffen immer mehr Kapitalanleger ihre Entscheidungen selbststÀndig. Denn der Online-Handel ist bequem, da..
brokerpoint.de Online Broker Brokerpoint Depot Coaching Aktien Börsen Konto
161 SchnittDienst CAD Schnittkonstruktion Bekleidung

CAD Schnittkonstruktion - in den Bereichen DOB / HAKA / KIKO. - Schnittmuster digitalisieren und gradieren - Erarbeitung vom..
schnittdienst.com Schnittdienst Schnitt Jahren Schnittkonstruktion Kostas Murkudis Beate Christoph
162 RWG GebÀudereinigung Berlin GebÀudereinigung

Unsere Reinigungsfirma Berlin ist bereits seit mehreren Jahrzehnten im Bereich der GebÀudereinigung tÀtig und hat sich einen..
rwg-gebaeudereinigung-berlin.com/ Berlin GebÀudereinigung Reinigungsfirma Unsere Geb Sauberkeit Helvetica Arial
163 24h PCR Test Express & Schnelltest Corona Testzentrum

24h PCR Express Test & Schnelltest Corona Testzentrum Berlin Wilmersdorf. FĂŒr alle LĂ€nder/FlĂŒge geeignet. Ergebnis am gleichen..
coronaspot.de Stylable Poppins Barlow Bold Objectassign Ba Italic Booking
164 Tanja Bögner Business-Coaching

Mein Name ist Tanja Bögner, ich bin Personal & Business Coachin. Ich biete Ihnen zielgerichtete Seminare..
tanjaboegner.de Assistenz Store Sans Pro Tanja Is Open Bögner
165 RWG GebÀudereinigung Berlin GebÀudereinigung

Wir sind seit 1994 fĂŒr die Sauberkeit zahlreicher Objekte im Rahmen der GebĂ€udereinigung, Unterhaltsreinigung, Glas- und Fensterreinigung..
rwg-gebaeudereinigung-berlin.com/ Berlin GebÀudereinigung Reinigungsfirma Geb Fensterreinigung Unterhaltsreinigung Sauberkeit Helvetica
166 TSM - Lauschabwehr & Abhörschutz Dienstleistung

Die TSM – Lauschabwehr & Abhörschutz ist ein renommierter Spezialist im Bereich Sicherheitsdienstleistungen, der sich insbesondere auf..
tsm-lauschabwehr.de/ Lauschabwehr PrivatsphÀre Abhörschutz Security Management Daten Anforderungen Lösungen
167 Svea Carstensen Coaching

Als Frau wissen wir, dass das Leben manchmal, wie eine Achterbahn sein kann, mit Höhen und Tiefen..
sveacarstensen.de/ Coaching Grey Red Orange Yellow Green Cyan Blue
168 Scout UmzĂŒge & Transporte Umzugsunternehmen

Bei UmzĂŒgen und Transporten sind wir Ihr zuverlĂ€ssiges Umzugsunternehmen in Berlin und der nĂ€heren Umgebung. Unsere Dienstleistungen..
scout-umzug.de/ UmzĂŒge Berlin Umzug Umzugsunternehmen Scout Citalic Besichtigung Umzugshelfer
169 Scout UmzĂŒge & Transporte Umzugsunternehmen

Bei UmzĂŒgen und Transporten sind wir Ihr zuverlĂ€ssiges Umzugsunternehmen in Berlin und der nĂ€heren Umgebung. Unsere Dienstleistungen..
scout-umzug.de/ UmzĂŒge Berlin Umzug Umzugsunternehmen Scout Citalic Besichtigung Umzugshelfer
170 Praxis fĂŒr PhysioTherapie Pavlos Tsanidis Physiotherapie

KG-Krankengymnastik KG-ZNS Krankengymnastik nach Bobath MLD- Manuelle Lymphdrainage WP/WT-WĂ€rme-, KĂ€ltetherapie ET-Elektrotherapie US-Ultraschall WĂ€rme Kinesiotape KMT-Klassische Massage Therapie BGM-Bindegewebsmassage Segmentmassage Atemtherapie Osteopathischer Konzept Faszienbehandlung GGW Training Gleichgewicht Ihre Gesundheit steht..
physiotherapie-tsanidis.de Physiotherapie Pavlos Tsanidis Praxis Gitschiner Str Berlin Tel
171 Textagentur Schachmatt Textagentur

Eine Bachelorarbeit ist der erste große Schritt in Ihrer akademischen Karriere. Eine qualitativ hochwertige Arbeit ist entscheidend..
grow-consulting.de/lektorat-bachelorarbeit Bachelorarbeit Lektorat Helvetica Arial Lucida Daten Einwilligung Website
172 Karos Wedding Vibes Hochzeitsplaner

Karos Wedding Vibes steht fĂŒr individuelle und charakteristische Hochzeitsplanung. Sie suchen noch einen Hochzeitsplaner Berlin mit Expertise..
karosweddingvibes.de/ Cuse Ahref Berlin Fsvg Hochzeitsplanung Hochzeitsplaner Fwwwworg Cl
173 ÜbersetzungsbĂŒro Front Runner Berlin ÜbersetzungsbĂŒro Dolmetscher

ÜbersetzungsbĂŒro Front Runner Berlin – Wir bringen die Message rĂŒber. Das ÜbersetzungsbĂŒro Front Runner Berlin ĂŒbersetzt, lektoriert und..
front-runner.de/uebersetzungsbuero-berlin-englisch Beglaubigte Berlin Deutsch Englisch Google Französisch Daten Spanisch
174 Fliesenprofi Berlin Fliesenprofi

Als Fliesenleger in Berlin habe ich mich auf die professionelle Installation und Reparatur von verschiedensten Fliesenarten spezialisiert..
fliesenprofi-berlin.de/ Cuse Berlin Lucida Not Prefetchable Helvetica Sans Umgebung
175 TĂŒrbeleuchtung Auto

Erleben Sie die neueste Technologie mit unserer 3D TĂŒrbeleuchtung Auto Logo. Perfekt fĂŒr jedes Auto, um einen..
turbeleuchtung.de/ Cg TĂŒrbeleuchtung Cpath Csvg Logo Audi Sans AusfĂŒhrung
176 ÜbersetzungsbĂŒro Front Runner Berlin ÜbersetzungsbĂŒro Dolmetscher

ÜbersetzungsbĂŒro Front Runner Berlin – Wir bringen die Message rĂŒber. Das ÜbersetzungsbĂŒro Front Runner Berlin ĂŒbersetzt, lektoriert und..
front-runner.de/uebersetzungsbuero-berlin-englisch Beglaubigte Berlin Deutsch Englisch Google Französisch Daten Spanisch
177 WirDÀmmenDeinHaus.com HÀuserdÀmmung EinblasdÀmmung

Dein Partner fĂŒr EinblasdĂ€mmung in Berlin. Egal ob Einfamilienhaus oder Immobilienportfolio, egal ob DachdĂ€mmung oder KerndĂ€mmung im..
wirdaemmendeinhaus.com Website Cookie EinblasdÀmmung Informationen Dich Haus DÀmmung Wir
178 Flora Studio Wei & Klein GbR Kunstpflanzen

Herzlich Willkommen bei Flora Studio, Ihrem Onlineshop fĂŒr Kunstpflanzen. Bei uns finden Sie eine große Auswahl an..
kunstpflanze.de Kunstpflanzen KĂŒnstliche KunstbĂ€ume Dateget Alle Studio Kunstblumen Shop
179 BuBiBag SitzsÀcke Online

FĂŒr Kinder, Jugendliche und Erwachsene stellt BuBiBag eine große Auswahl an SitzsĂ€cken, Palettenkissen, Dekokissen und Kissen her...
bubibag.de/ Sans Sitzsack Schwarz SitzsÀcke Product List Bu Rechteck
180 Abschied und Aufbruch Trauer

FĂŒr den Abschied und fĂŒr den Aufbruch biete ich Ihnen meine Begleitung an: Wenn Sie zu fassen..
abschiedundaufbruch.de Aufbruch Leben Abschied Lebensberatung Trauerbegleitung Trauerrednerin Himmel Zeiten
181 Vitrotrade BV Gesundheit

Wir bei Vitrotrade BV wissen, wie wichtig Schnelligkeit und Genauigkeit sind, wenn es um HIV-Tests geht. Deshalb..
hivtestkaufen.de/ Test Tests Ergebnis Hause Infektion Schnelltest Ergebnisse Antikörper
182 Ruslan Goryukhin Foundation fĂŒr Wissenschaft Forschung Stiftung

Zweck der Gesellschaft ist die Förderung: der Wissenschaft und Forschung (§ 52 Abs. 2 Nr. 1 AO)..
183 Extremer Bikini Extremer Bikini

Sunnybikinis mit Sitz in China ist eine Bademodenmarke, die seit 2015 Bikinis entwirft, herstellt und online verkauft...
sunnybikinis.com/de-de/collections/extreme-bikinis Bikini China Sunnybikinis Organization Offer Produkte Badeanzug Stil
184 Etman UmzĂŒge Umzugsunternehmen

#1 Umzugsunternehmen Berlin! Bei uns erhalten Sie alles aus einer Hand: vom passenden Möbelwagen bis zum Umzugsmaterial in..
etman-umzuege.de/ Berlin Umzug Du Angebot UmzĂŒge Dich Umzugsunternehmen Minuten
185 Umzug Max Moving Service

Bernau bei Berlin
#1 Umzugsunternehmen Bernau bei Berlin! Bei uns erhalten Sie alles aus einer Hand: vom passenden Möbelwagen bis zum..
helmut-schmidt-allee 14b
186 Umzug Max Moving Service

Bernau bei Berlin
#1 Umzugsunternehmen Bernau bei Berlin! Bei uns erhalten Sie alles aus einer Hand: vom passenden Möbelwagen bis zum..
helmut-schmidt-allee 14b
187 Umzug Max Moving Service

Bernau bei Berlin
#1 Umzugsunternehmen Bernau bei Berlin! Bei uns erhalten Sie alles aus einer Hand: vom passenden Möbelwagen bis zum..
helmut-schmidt-allee 14b
188 GOING PUBLIC! Akademie fĂŒr Finanzberatung AG Weiterbildung

Die GOING PUBLIC! Akademie fĂŒr Finanzberatung AG ist ein spezialisierter Partner fĂŒr Weiterbildung in der Finanz-, Versicherungs-..
akademie-fuer-finanzberatung.de Online Weiterbildung Finanzberatung Ich Going Akademie Weiterbildungszeiten Finanzbranche
189 Die Nr. 1 Umzugsfirma aus Berlin Umzug

Maßgeschneiderte Umzugslösungen: Unser professionelles Umzugsunternehmen Wenn es um Ihren Umzug in Berlin geht, sind wir Ihr verlĂ€sslicher Partner..
mueller-umzugsfirma-berlin.de Berlin Umzug Umzugsfirma Familienunternehmen Ihren UmzĂŒge Vertrauen Unser
190 SperrmĂŒllmeister Berlin | SperrmĂŒll & Wohnungsauflösung Haushaltsauflösungen

Die SperrmĂŒllmeister Berlin sind ein professioneller EntrĂŒmpelungs- und SperrmĂŒlldienst, der seinen Service sowohl an private als auch..
sperrmuell-berlin.de SperrmĂŒll Berlin SperrmĂŒllabholung Entsorgung Abholung Fsvg Ihren SperrmĂŒllentsorgung
191 CleanClimb Seilzugangstechnik Glasreinigung

Willkommen auf Clean Climb Berlin, Ihr Spezialist fĂŒr Arbeiten in der Höhe. Mit Hilfe von Seiltechniken erreichen..
192 moebeltransport-in-berlin.de Möbeltransport In

Möbeltransport Berlin: Experte #1 Contact us: https://www.moebeltransport-in-berlin.de/ info@moebeltransport-in-berlin.de +4915792604200 Credit Card, Cash, Bank Transfer Mo-Su. 7.00 - 22.00 Wir sind Ihr Möbeltransport Experte in..
moebeltransport-in-berlin.de/ Berlin Möbeltransport Transport Möbel Möbeltaxi Ihren Ihr Angebot
193 moebeltransport-in-berlin.de Möbeltransport In

Möbeltransport Berlin: Experte #1 Contact us: https://www.moebeltransport-in-berlin.de/ info@moebeltransport-in-berlin.de +4915792604200 Credit Card, Cash, Bank Transfer Mo-Su. 7.00 - 22.00 Wir sind Ihr Möbeltransport Experte in..
moebeltransport-in-berlin.de/ Berlin Möbeltransport Transport Möbel Möbeltaxi Ihren Ihr Angebot
194 moebeltransport-in-berlin.de Möbeltransport In

Möbeltransport Berlin: Experte #1 Contact us: https://www.moebeltransport-in-berlin.de/ info@moebeltransport-in-berlin.de +4915792604200 Credit Card, Cash, Bank Transfer Mo-Su. 7.00 - 22.00 Wir sind Ihr Möbeltransport Experte in..
moebeltransport-in-berlin.de/ Berlin Möbeltransport Transport Möbel Möbeltaxi Ihren Ihr Angebot
195 Motorcycle Screens Auto

Unsere Firma ist spezialisiert auf Motorrad-Windschutzscheiben, Windschilder fĂŒr MotorrĂ€der und Windabweiser, die das VergnĂŒgen beim Rennen sowie..
motorcyclescreens.eu/de/ Windschutzscheiben Motorrad Windschilder Windabweiser Motorcycle Artikel Windschutzscheibe Weiter
196 eGora GmbH Versandhandel

Das Berliner Unternehmen egora betreibt einen Online-Marktplatz, auf dem lokale GeschÀfte aus der Stadt ihre einzigartigen Angebote..
egora.online/ Show Unsere Lieferung Produkte Hause Kategorien HĂ€ndler Lokale
197 Pflegedienst Helppy GmbH Ambulante Pflegedienste

Helppy ist ein moderner hĂ€uslicher Pflegedienst, dem neben der optimalen Betreuung von Senioren auch die BedĂŒrfnisse der..
helppy.de/ Helppy Senioren Helpper Pflegedienst Berlin Angehörigen Hause Hilfe
198 Klassik UmzĂŒge - Umzug Berlin Umzug

Gern stehen wir Ihnen fĂŒr Ihr Umzugsvorhaben zur VerfĂŒgung. Ob Umzug innerhalb Berlins, deutschlandweit oder in die..
klassik-umzuege.berlin Berlin UmzĂŒge Umzug Klassik Umzugsunternehmen Berliner Preis Ihr
199 Umzugskracher Umzug

Beim Umzug stehen meist die Organisation und eine besonders gut strukturierte Vorbereitung im Vordergrund. Ein Umzug im..
umzugskracher.de/ Sans Berlin Not Prefetchable Umzugskracher Umzugsunternehmen Umzugsfirma GĂŒnstige
200 Chroma Online Druckerei Druckerei

CHROMA ist eine Online-Druckerei, die auf ModernitĂ€t, Schnelligkeit und QualitĂ€t setzt. 👉 Online bestellen 👉 Kostenloser Canva Produktdesigner 👉 Wir..
chromadruckerei.de/de Countries Chroma Subscription Du Notifyne Product Produkt Front
201 BFKV UG (haftungsbeschrÀnkt) Versicherungsmakler

Umfangreiche Onlineberatung oder persönlich vor Ort in Berlin von Versicherungsmakler...
berlinfinanz.com Versicherungen Berlin Ver Profil Versicherungsmakler Kredite Euch Kredit
202 Zumera Group GmbH Unternehmensberatung

Zumera ist ein fĂŒhrendes M&A-Beratungsunternehmen mit internationalem Fokus. Zumera bietet mittelstĂ€ndischen Unternehmen eine umfassende Beratung in allen..
zumera.com/de/home/ Unternehmen Kunden Branche Deutschland Investoren Markt Netzwerk Nachfrage
203 Zinkernagel - Balance In Motion Personal Trainer

Mein Name ist Marc Zinkernagel, seit ĂŒber 21 Jahren bin ich selbststĂ€ndiger Personal Trainer & High Performance..
zinkernagel.net Marc Training Ich Personal Trainer Zinkernagel Coach Monaten
204 MDL Unternehmensgruppe Reinigungsfirma

Ihre Immobilie benötigt eine professionelle Hand, welche sie professionell und hochwertig sÀubert? Wir von der MDL Group..
mdl-group.de/ Borlabs Group Eventrocket Berlin Awesome Reinigungsfirma Symbol Unternehmensgruppe
205 Bling Services GmbH Finanzen

Die Bling Card und die zugehörige App von Bling helfen Familien dabei, ihren Kindern den Umgang mit..
bling.de/ Bling App Karte Kinder Trustpilot Geld Taschengeld Google
206 Katro Bau GmbH Bauunternehmen

Bauunternehmen in Berlin, Potsdam und Brandenburg. Von der Altbausanierung bis zum schlĂŒsselfertigen Bauen, Badmodernisierung und Heizungsbau –..
katrobau.de Bau Berlin Gmb Katro Brandenburg Leistungen Badmodernisierung Bauunternehmen
207 Olymp-Bau Fußbodenleger

Trockenbau und Innenausbau mit Rigipsplatten, Dachausbau Sonstige Arbeiten an WÀnden und InnenrÀumen Decken abhÀngen, Zwischendecken einziehen DÀmmarbeiten, WÀrmedÀmmung von Decken Sonstige..
208 MO45LEGAL - Bschorr | Warneke | RechtsanwÀlte und

Willkommen bei MO45LEGAL - unsere Notariats- und Anwaltskanzlei im Immobilien- und Gesellschaftsrecht. Wir beraten ĂŒberregional, im Interesse..
mo45.de Bschorr Warneke Sukowski Michael Ch Ulrike Martin Mandanten
209 Olymp-Bau Fußbodenleger

Trockenbau und Innenausbau mit Rigipsplatten, Dachausbau Sonstige Arbeiten an WÀnden und InnenrÀumen Decken abhÀngen, Zwischendecken einziehen DÀmmarbeiten, WÀrmedÀmmung von Decken Sonstige..
210 Umzugshelfer Berlin ➡ ️ ab 46€ Umzugshilfe Berlin

Umzugshelfer Berlin Umzugshilfe Berlin bietet professionelle Umzugshelfer zu gĂŒnstigen Umzugskosten an. ✅ Professionelle Umzugshelfer mit jahrelanger Erfahrung ✅..
berlin-umzugshilfe.de/ Borlabs Umzugshilfe Berlin Umzugshelfer Umzug Helfer Cookie Unsere
211 Umzugshelfer Berlin ✔ ️ Umzug mit Umzugshelfer Berlin

studenten-umzug.berlin/ Defaults Berlin Umzug Umzugshelfer Studenten Ihren Umzugsfirma Angebot
212 Olymp UmzĂŒge Umzug SperrmĂŒll

Sehr geehrte Damen und Herren, wir sind ein kleines, Familienunternehmen mit langjÀhriger Branchenerfahrung und freuen uns, Ihnen..
213 Search & Train Unternehmensberatung Unternehmensberatung

Die Search & Train Unternehmensberatung fĂŒhrt seit 2007 ganzheitliche Beratungsleistungen in der gesamten D-A-CH Region fĂŒr Mittelstandsunternehmen..
searchandtrain-unternehmensberatungberlin.de/ Seminare Insights Unternehmensberatung Berlin Cookie Unternehmen Informationen Inhalte
214 Rick SchĂŒtze Moderation Event Moderation

Gemeinsam bringen wir ihr Event zum Erfolg. Rick SchĂŒtze ist professioneller Event Moderator, der ihrem Event das..
rick-schuetze.com Cookie Moderator Name Moderation DatenschutzerklÀrung Ihr Ireland Informationen
215 Volker Maria Maier Lichtkuenstler

Panketal bei Berlin
Volker Maria Maier bietet einzigartige Showacts mit LED- und Lichtshows, sowie spektakulÀre Feuershows. Buchen Sie deutschlandweit Ihre..
led-show.eu/ Show Volker Maria Maier Lichtjonglage Feuershows Lichtshow Shows
216 Berlin UmzĂŒge 24 Moving Company

Mo-Su. 7.00 - 22.00 Credit Card, Cash, Bank Transfer Bei uns erhalten Sie alles aus einer Hand: vom passenden..
berlin-umzuege24.de/ Berlin Umzug Angebote Kostenlose Angebot UmzĂŒge Umzugsunternehmen Zeit
217 Expo Stand Services | Exhibition Stand Trade Fair

At Expo Stand Services, we deliver an attractive company stand construction that will appeal to the ideal..
expostandservice.com/exhibition-stand-designs-in-germany/ Exhibition Germany Stand Design Our We Company Services
218 Energetische Beratungen lebendige Konzepte Persönlichkeitsentwicklung

Neue Impulse - annehmen - glĂŒcklicher leben - Blockaden lösen - Kraft und Lebensfreude erhöhen - leichter vorwĂ€rts kommen Ich unterstĂŒtze..
elkeseidel-lebendigekonzepte.de Lebendige Elke Seidel Shui Geomantie Konzepte Willkommen Wahrnehmung
219 Psychotherapie-Praxis Curamentis Psychologische Psychotherapeuten

Curamentis ist eine Praxis fĂŒr Psychotherapie unter der Leitung von Dr. Svenja Zemma, die Ihnen eine kompetente..
psychotherapie-praxis-curamentis.de Therapie Online Psychotherapie Berlin Mitte Praxis Daten Inhalte
220 Technische Hintegrunddienste IT-Dienstleistungen

Technische Hintergrunddienste, professionelle Expertise von Spezialisten Wir verfĂŒgen ĂŒber das umfangreiche Wissen & Know-how, um Ihnen bei der..
221 Schuldnerberatug Berlin - Brandenburg Schuldnerberatug

Die Kanzlei Bornemann ist seit ĂŒber 15 Jahren Ihr Experte fĂŒr Konfliktberatung und Schuldnerberatung in Berlin und..
ralf-bornemann.com Bornemann Kanzlei Schuldnerberatung Einwilligung Services Daten Ralf Herr
222 Karlsruher Immobilienbewertung Immobilienbewertung

Die Immobilienbewertung in Karlsruhe ist ein wichtiger Bestandteil des Immobilienmarktes in dieser Region. Hierbei handelt es sich..
karlsruher-immobilienbewertung.de/ Sans Awesome Helvetica Karlsruhe Lucida Not Prefetchable Arial
223 BERLINER Beerdigungsinstitut Bestattungen

Das Beerdigungs­institut in Berlin Bestattungen fĂŒr einen Abschied in WĂŒrde Besonderen Menschen gebĂŒhrt ein wĂŒrdiger Abschied. Genau das haben..
berliner-beerdigungsinstitut.de/ Berlin Beerdigungsinstitut Bestattung Verstorbenen Abschied Fair Kostenschonend Berliner

Wir von MEIN GÜNSTIG BESTATTER bieten Ihnen kostengĂŒnstige Möglichkeiten zur Bestattung an. Auch fĂŒr eine Sozialbestattung stehen wir..
mein-guenstig-bestatter.de/ Einwilligung Daten Website Services Einstellungen Bestatter Inhalte Service
225 Kfz Gutachten Kfz SachverstÀndiger

24/7 fĂŒr Sie da - Mit uns können Sie rechnen. Oldtimer, Leasing, Wertgutachten, usw...
kfz-gutachterwilmersdorf.de/ Gutachter Setting Segoe Markus Kfz HĂ€usler Emoji Ihr
226 Institut Muth in Berlin Management

institut-muth.de Diese Website Bitte Tagen Letzte Updates Institut Muth
227 Mediationskanzlei & Schuldnerberatung Ralf Bornemann Schuldnerberatung

Sie haben den Überblick ĂŒber Ihre Schulden verloren oder sonstige Probleme aus dem Sozialbereich? Dann kann Ihnen..
ralf-bornemann.com/ Bornemann Kanzlei Schuldnerberatung Einwilligung Services Daten Ralf Herr
228 Umzugsunternehmen Berlin Umzugsunternehmen

Die beste Beratung und Betreuung in Berlin erhalten Sie bei der Umzugsfirma Unsere Angebotspalette bietet eine breite Auswahl..
umzugsunternehmen-berlin-mueller.de/ Berlin Umzug Angebot Umzugsunternehmen UmzĂŒge Ihren Umzugsfirma Kostenloses
229 Mitsegeltörn durch den sĂŒdlichen Dodekanes Segelreisen

10 Tagestörn durch den Dodekanes von Kos bis nach Rhodos. Der Törnverlauf ist ein Traum. Ein toller..
meeressegeln.de Montserrat Roboto Arimo Lato Noto Sans Bord Segeltörn
230 Fenstero Fensterbau und

Der in Berlin ansĂ€ssige und im ganzen Land Brandenburg tĂ€tige Fensterbauer FENSTERO bietet hochwertige Bauelemente zu gĂŒnstigen..
fenstero.de/ Arial Lösung Haus Loft Gewerbe Outer Sansimportantfont Coming
231 GBS-Premium - GBS GrundstĂŒcksbörse & Service Immobilienmakler

Immobilienmakler Berlin und bei uns finden Sie die Symbiose aus Erfahrung, Sachverstand und professioneller Vermarktung sowie Service..
gbs-premium.de/ Immobilie Verkauf Muster Berlin Mut VerÀnderung Whats Immobilienmakler
232 tufeeÂź Services & Grosklos Web Services

tufeeÂź Services & Grosklos bietet Ihnen eine Vielzahl von Online RSS & XML Utilities und Online SEO..
tufee.de Domains Services Utilities Checker Grosklos Web Domain Reader
233 Agentur eager & small Veranstaltungsservice

Als Kreativagentur in Berlin Friedrichshain bieten wir eine breite Palette an professionellen Dienstleistungen fĂŒr Veranstaltungen an. Von..
eagerandsmall.de Agentur Pressekonferenzen Berlin Headset Konzerte Unsere Technikverleih Watt
234 Spanndecken Berlin 24 Spanndecken

GrundsÀtzlich ist eine professionelle Installation von einer satinierten Spanndecke nicht problematisch. Jedoch, wenn Sie keinen Fehler machen..
spanndeckenberlin24.de Spanndecken Archivo Narrow Abhaya Libre Co Berlin Spanndecke
235 Joel von Lerber Musiker

Joel von Lerber zÀhlt national und international zu den bekanntesten Harfenisten. Bereits als 6-jÀhriger erhielt er seinen..
joelvonlerber.com Home Lerber Cookie Joel Harpist But Musik You
236 Growthartig GmbH Marketing

Wir skalieren Unternehmen wirkungsvoll durch cleveres Performance Marketing, einer ganzheitlichen Strategie und datenbasierten Creatives! Namhafte Firmen vertrauen uns..
growthartig.io/ Creatives Marketing Swiper Performance Kunden Growthartig Ads Consulting
237 EntrĂŒmpelung Charlottenburg - Fairwerter Berlin 0177-5180000 Cleaning Service

Ruhlebener Str. 2, 13597 Berlin
Die Fairwerter entrĂŒmpeln fĂŒr Sie auch in Charlottenburg. Kostenlose Besichtigung mit Festpreisangebot. Jetzt anrufen unter 0177-5180000. Kontaktdaten FAIRwerter 24..
entruempelung.berlin/entruempelung-charlottenburg/ Charlottenburg EntrĂŒmpelung Wilmersdorf Feld Berlin New Fairwerter Times
238 Gold An und Verkauf GoldhÀndler

Gold und Silber kaufen und verkaufen in Wien und Berlin Die GOLDINVEST Edelmetalle GmbH ist ein Unternehmen, das..
goldinvest-edelmetalle.de Gold Kaufen Verkaufen Edelmetalle Online Beratung GoldmĂŒnzen Mint
239 Dein Stellplatz GmbH - Parkplatz am Parkservice

Parken am Flughafen Berlin bei Dein Stellplatz! Unser VerstĂ€ndnis von Parken geht weit ĂŒber das bloße Abstellen..
dein-stellplatz.de/parken/berlin-brandenburg-ber/ Flughafen Berlin Parkplatz Parken Stellplatz Brandenburg Auto Dein
240 R.O.M. logicware Soft- und Hardware GmbH Software

R.O.M. logicware GmbH gestaltet und vermarktet digitale Anwendungen fĂŒr Autoren und Personen, die leidenschaftlich gern schreiben. Unser..
papyrus.de/ Cookie Name Autor Du Ireland Google DatenschutzerklÀrung Anbieter
241 Butler UmzĂŒge - Das Umzugsunternehmen aus Umzugsunternehmen

Sie suchen einen schnellen und gĂŒnstigen Umzugsservice in oder um Berlin? Butler UmzĂŒge freut sich, Sie als..
butler-umzuege.de/ Borlabs Berlin Umzug UmzĂŒge Butler Cookie Ihr Awesome
242 Cityfoto Berlin - Fotostudio fĂŒr preiswerte Fotostudio

Cityfoto Berlin – Dein Fotostudio mit Herz und Leidenschaft in Berlin-Schöneberg. Direkt an der U-Bahn Station Eisenacher..
243 Mein Ghostwriter Ghostwriting

TĂ€tig seit 2021 scheut unsere Ghostwriter Agentur keine MĂŒhen, um fĂŒr unsere Kunden herausragende akademische Arbeiten zu..
meinghostwriter.de/ Wörter Seiten Ghostwriter Arbeit Bachelorarbeit Hausarbeit Ghostwriting Masterarbeit
244 Goldstaub Barcatering GmbH & Co KG Catering

Ob geschĂ€ftlich, privat oder öffentlich. Wir haben fĂŒr jedes Format das passende Konzept. Mit kreativem Geschmackssinn fĂŒr..
goldstaub-barcatering.de Ihr Goldstaub Events Barcatering Bar Festivals Ihren Business
245 KEYZO - Film & Animation Videoproduktion

KEYZO ist ein Film- und Videoproduktionsunternehmen mit Sitz in Berlin. Wir sind auf die Produktion anspruchsvoller Imagefilme..
keyzo.de Film Sansfont Videoproduktion Animation Berlin Produktion Unsere Kunden
246 Berliner Hochzeitsfotograf Hochzeitsfotograf

Als Hochzeitsfotograf in Berlin bin ich verantwortlich fĂŒr die Aufnahme und Dokumentation der schönsten Momente an Ihrem..
berliner-hochzeitsfotograf.de/ Berlin Not Prefetchable Momente Awesome Hochzeitsfotograf Nitro Mutation
247 openMIND Travelmanagement Software

Die Reisekostenabrechnungs-App von openMIND – fĂŒr eine effiziente Abrechnung Ihrer GeschĂ€ftsreisen Mit unserer SaaS-Lösung digitalisieren und entlasten Sie Ihre..
openmind-travelmanagement.com/ Reisekostenabrechnung GeschÀftsreisen Kundinnen Vorteile Reisekosten Dienstreisen Einstellungen Digitalisierung
248 seonicalsÂź SEO-Agentur Berlin Werbeagentur

Als Onlinemarketing-Agentur sorgen wir dafĂŒr, dass Ihr Web-Auftritt technisch, strukturell und inhaltlich auf die neuesten Suchmaschinen-Standards optimiert..
seonicals.de/seo-agentur/berlin/ Google Website Online Agentur Berlin Ihr Cookie Ihren
249 BMobility24 GmbH Reisebusunternehmen

Sehr geehrte Damen und Herren, wir möchten uns als Busunternehmen fĂŒr den Raum Berlin/Brandenburg vorstellen. Seit Anfang..
bmobility24.de Cookie Berlin Name Fuhrpark DatenschutzerklÀrung Inhalte Bus Ireland
250 Umzug MĂŒller Umzug

Bei uns steht die Zufriedenheit unserer Kunden an erster Stelle, deshalb arbeiten wir ausschließlich mit qualifizierten Umzugspartnern..
umzugsunternehmen-berlin-mueller.de Berlin Umzug Angebot Umzugsunternehmen UmzĂŒge Ihren Umzugsfirma Kostenloses
251 Tiny Sins Onlineshop

Unser Online-Shop hĂ€lt fĂŒr Dich eine Auswahl an ĂŒber 6.000 Erotikartikeln bereit. In unserem Sortiment findest Du..
tinysins.de Web Map Shop Tiny Sins Dein SĂŒnden Hyphenopoly
252 TYPO3 & Shopware Agentur Berlin - Internetagentur

Als TYPO3 Agentur in Berlin konzipieren wir Ihr TYPO3 CMS entsprechend Ihrer Unternehmensanforderungen. Wir sind TechnologiefĂŒhrer im..
3m5.de Relaunch Dresden Projekten Inhalte Insights Webentwicklung Partner LĂ€nder
253 Synergie Physiotherapie Berlin Schöneberg Physiotherapie

Physiotherapeutische Behandlungen Als Team sind wir zertifiziert fĂŒr Krankengymnastik Die Krankengymnastik ist eine Behandlungsform und dient dazu Krankheiten aus..
synergie-physio.de Physiotherapie Berlin Synergie Schöneberg Physiotherapeut Team Behandlung Patient
254 NRG Projekt Photovoltaik

NRG Projekt ist Ihr Partner fĂŒr Projektleitung, Photovoltaik und Solarthermie in Berlin und Brandenburg! NRG Projekt bietet ein..
nrg-projekt.de Cookie Name DatenschutzerklÀrung Website Informationen Ireland Inhalte Anbieter
255 Kriesmann und Seib GbR Dreamotions Musikproduktion

Dreamotions Tonstudio Berlin: Aufnahmen unter der Wolkendecke fĂŒr Profis und Amateure. Moderne Technik, erfahrene Tontechniker..
dreamotions.de/ Berlin Tonstudio Aufnahmen Technik Services Projekte Studio Equipmentliste
256 Umzugsunternehmen Berlin Umzugsunternehmen

Wir als Umzugsunternehmen der perfekte Partner fĂŒr Ihren Umzug in Berlin Was uns so gut macht? Wir haben..
umzugsunternehmen-berlin-mueller.de/ Berlin Umzug Angebot Umzugsunternehmen UmzĂŒge Ihren Umzugsfirma Kostenloses
257 Ihre Webdesign Agentur aus Berlin Webdesign

Ihre WordPress Webseite erstellen wir nach Ihren WĂŒnschen. Ein Webdesign Berlin wird Ihre Erfolgschancen um 100 %..
hauptstadt-homepage.de Website Webdesign Agentur Pflege Homepage Google Berlin Hosting
258 SeniorenLebenshilfe Daniela Riedel Seniorenbetreuung

Die SeniorenLebenshilfe ist bundesweit eins der ersten Unternehmen, die sich auf die vorpflegerische Betreuung spezialisiert haben. Wir..
seniorenlebenshilfe.de/lebenshelfer-berlin/lebenshelferin-daniela-riedel/ Live Bitte Senioren Pflichtfeld Anfrage Applying Mail UnterstĂŒtzung
259 LED Auto Tuning|LED fĂŒr Auto Auto

CarledLogo Fokus auf LED Auto Tuning und LED fĂŒr Auto, Einschließlich LEDTĂŒrbeleuchtung, LED Untersetzer, AmbienteBeleuchtung, Beleuchtete..
carledlogo.de Cg Csvg Cpath Auto Sans Logo Plex Cuse
260 myitplanet Annahmestelle fĂŒr Datenrettung Berlin Datenrettung

myitplanet: Ihr Experte fĂŒr professionelle Datenrettung. Bei Verlust Ihrer Daten auf MobilgerĂ€ten, Tablets, Computern oder Speichermedien sind..
myitplanet.de/datenrettung/ Cg Csvg Datenrettung Cpath Daten Awesome Cuse Cdefs
261 Abnehmen im Liegen Berlin Beauty

abnehmenimliegenberlin.de Playfair Bold Poppins Italic Display Lato Helvetica Kvo
262 SachverstĂ€ndigenbĂŒro Hoenge SachverstĂ€ndige

Ein SachverstĂ€ndiger fĂŒr Immobilien ist ein Fachexperte, der sich auf die Beurteilung von Immobilienwerte spezialisiert hat. Er..
sachverstaendigenbuero-hoenge.de/ BausachverstÀndiger SchÀden Immobilien Immobiliengutachter Tipps Tricks Infos Behebung
263 Lead-Generator mit automat. Immobilienbewertung Immobilien

Lead-Generator mit automatisierter Immobilienbewertung (PDF) als Komplettlösung fĂŒr Makler. Einfach, individualisiert & automatisiert. Jetzt KOSTENLOS loslegen...
leadmarkt.ch Lead Leads Generator Immobilienbewertung Makler Minuten Immobilienbewertungen Word
264 Hilfe bei Essstörungen - Schwerpunktpraxis bei Psychotherapie

Wenn Hunger nicht das Problem ist, dann ist Essen nicht die Lösung. Als Heilpraktikerin fĂŒr Psychotherapie arbeite..
hilfe-bei-essstoerungen-berlin.de/ Essstörungen Ich Berlin Essen Binge Bulimie Eating Essstörung
265 GO Kfz Gutachter Berlin Kfz Gutachter

Erstellung von SachverstĂ€ndigengutachten fĂŒr Kraftfahrzeuge, Schadenbewertungen bei UnfĂ€llen, Unfallrekonstruktionen, Technische PrĂŒfungen von Fahrzeugen, Bewertung von SchĂ€den an..
266 Berliner Umzugsservice Umzugsservice

Unser Berliner Umzugsunternehmen bietet zuverlÀssigen und sorgfÀltigen Service bei Ihrem Umzug. Mit unserem erfahrenen Team und modernen..
berliner-umzugsservice.de/ Cuse Helvetica Lucida Not Prefetchable Berlin Arial Firma
267 Reinigungs Kommando (Reinigungsfirme Vienna) Reinigungsdienstleistungen

Wir, das Reinigungskommando, sind eine Putzfirma. Wir bieten professionelle Hilfe im Kampf gegen den Schmutz und fĂŒr..
reinigungskommando.at Stylable Play Reinigung Post Ba Blog Containermain Kcp
268 MST Sicherheitsdienst Sicherheitsdienst

MST Sicherheitsdienst bietet Security Service in Berlin und Umgebung Kunden aus allen Branchen Objektschutz Veranstaltungsschutz - Baustellenbewachung..
sicherheitsdienst-berlin.com Berlin Sicherheitsdienst Security Service Kunden Umland Sicherheit Unsere
269 Berlin SEO Freelancer SEO Freelancer

Meine Name ist Noah Lutz und ich bin in Berlin Ihr SEO Freelancer auf Augenhöhe. Ob Anwalt..
berlin-seo-freelancer.de/ Freelancer Cuse Google Berlin Ich Noah Not Prefetchable
270 Regenbogenspuren Haustier Andenken

Sie möchten ein personalisiertes Andenken an Ihr Haustier? Unsere personalisierten Andenken sind ein ganz besonderes Geschenk, um Ihr..
regenbogenspuren.de/ Dateget Regenbogenspuren Boxenschilder Contact Toll Berlin Tiergrabsteine Grablichter
271 Zahnarztzentrum am KurfĂŒrstendamm Zahnarzt

Schreibe mir ein Text ĂŒber das Zahnarztzentrum am KurfĂŒrstendamm und die angebotenen Leistungen. Das Zahnarztzentrum am KurfĂŒrstendamm bietet..
zahnarzt-berlin-kurfuerstendamm.de Zahnarzt Zahnimplantate Berlin KurfĂŒrstendamm Prophylaxe Infos ZĂ€hne Zahnmedizin
272 Berliner Umzugsunternehmen Umzugsunternehmen

Bei uns erhalten Sie alles aus einer Hand: vom passenden Möbelwagen bis zum Umzugsmaterial in Berlin –..
berlinerumzugsunternehmen.de/ Umzugsunternehmen Berlin Sans Symbol Umzug Segoe Emoji Extra
273 Umzugshelfer-Berlin.eu Umzugsunternehmen

Bei uns erhalten Sie alles aus einer Hand: vom passenden Möbelwagen bis zum Umzugsmaterial in Berlin –..
umzugshelfer-berlin.eu/ Berlin Umzug Umzugsunternehmen Montserrat Angebot Berlineu Font Umzugshelfer
274 Olymp UmzĂŒge Umzugsunternehmen

Bei uns erhalten Sie alles aus einer Hand: vom passenden Möbelwagen bis zum Umzugsmaterial in Berlin –..
olymp-umzuege.de/ Berlin Umzugsunternehmen Umzug Montserrat Angebot Ihr Unternehmen Font

TOTENKOPF FRAKTION bietet eine große Auswahl an Totenkopf-Kleidung, Totenkopf-Schmuck und Accessoires an...
totenkopf-fraktion.de Totenkopf Fraktion Ring Shirts Shopify Shopifyroutes Shopifyshop Shopifylocale
276 Supervision und Coaching Supervisorin Coach

Systemische Supervision fĂŒr Teams, Gruppen und Einzelpersonen zur Reflexion von Ressourcen und Herausforderungen im beruflichen Alltag mit..
ruth-kaukewitsch.de Coaching Supervision Teamentwicklung Berlin Stringfrom Arrayflag
277 bestesparer Fashion

Berlin, Germany
Was hÀlt Sie davon ab, Ihre Lieblingssachen zu kaufen? Ihr Budget und die hohen Preise? Dann machen..
bestesparer.de/ Website Beste Bewertungen Blogs Rabatt Geld Marken Gutscheincodes
278 Rohrreinigung Berlin ROHRMED Rohrreinigung

Rohrreinigung in ganz Berlin Verstopfungsbeseitigung aller Art..
279 Privatumzug - BĂŒroumzug Berlin - Umzugsfachspedition Umzugsunternehmen

Wir sind Ihr kompetenter und zuverlĂ€ssiger Umzugspartner in allen Fragen der Planung und des Transports. FĂŒr den Privatumzug..
umzugsfachspedition.berlin Umzug Berlin Umzugsfachspedition If Warning Array Oswald Divi
280 Weddingplaner

Cuse Berlin Helvetica Lucida Not Prefetchable Weddingplaner Awesome
281 Wir verlegen Estrich Flooring Contractor

Bessemerstraße 82 10. OG SĂŒd, 12103 Berlin
Engagierter Estrichleger in Berlin und Umgebung. QualitĂ€t begeistert. FĂŒr Ihre Villa in Zehlendorf, die Altbau-Sanierung in Charlottenburg..
wirverlegenestrich.de Estrich Estrichleger Bayern Alz Opening Str Weißenburg Jahren
282 Umzugsunternehmen Bernau bei Berlin Umzugsunternehmen

Bernau bei Berlin
Ein Wohnortwechsel in Bernau bei Berlin oder nach Dachau oder doch nach Braunschweig bedeutet im ersten Moment..
umzugsunternehmen-bernau-bei-berlin.de Bernau Berlin Umzug Angebot UmzĂŒge Umzugslogistik Unsere Umzugsunternehmen
283 Philipp Nedelmann Heilpraktiker

Sie leiden unter chronischer Erkrankungen, Schmerzen, Verdauungsprobleme oder Erschöpfung und Burnout? Wir sind eine Heilpraktiker-Praxis, die sich..
philippnedelmann.de/ Berlin Therapie Heilpraktiker Nedelmann Praxis Philipp Prenzlauer Berg
284 felmo Mobiler Tierarzt Berlin Tierarzt

felmo ist der mobile Tierarzt in Berlin, der stressfreie Hausbesuche fĂŒr Hunde und Katzen anbietet. Unsere kompetenten..
felmo.de/tierarzt/berlin?utm_source=directories&utm_medium=referral&utm_campaign=stadtbranche Tierarzt Berlin App TierÀrzte Leistungen Termin Hausbesuch TierÀrztin
285 Eberhardt Service Group GmbH Hausmeisterdienstleistung

eberhardt-service.de/ Montserrat Poppins Bold Stylable Italic Post Service Bookings
286 Komfort Polsterei Polsterei

Wir von Komfort Polsterei kĂŒmmern uns um Ihre Möbel. Ganz egal, ob die Polster neu bezogen werden..
komfort-polsterei.de/ Sans Rotate Fade Blur Zoom Berlin Fly Roll
287 Norva24 Deutschland GmbH Rohrreinigung

Norva24 in Deutschland besteht aus mehreren Unternehmen mit verschiedenen Niederlassungen. Wir sind auf UIM (Underground Infrastructure Maintenance)..
norva24.de/ Borlabs Berlin Rohrreinigung Deutschland Norva Gmb Nitro Eventnitro
288 NK Cleaning Service Reinig

Sie suchen eine seriöse Reinigungsfirma in Berlin? Dann sind Sie bei uns genau richtig. Wir sind seit..
nk-cleaningservice.de/ Berlin Modern Browsers Reinigung Service Jost Compat Modes
289 Versicherungen Versicherungsmakler

Wir bieten individuelle Konzeptionen spezialisiert auf KFZ HĂ€ndler und KFZ WerkstĂ€tten. Doch auch fĂŒr alle anderen Gewerbetreibenden..
aurekon.de/ Montserrat Poppins Bold Italic Regular Post Blog Member
290 Matratzen Matratzen

Karibian verkauft bereits seit 1998 in sieben LÀndern erfolgreich Premium Matratzen und produziert jÀhrlich mehr als 65000 Schlafeinheiten. Bei..
karibianhome.de/ Wunschliste Kaltschaum Federkern Naturlatex Matratzen Gel Visco Produkte
291 Stagerockers Kommunikation

Stagerockers.de bringt mehr als die meisten zeitraubenden Seminare. Nutze unsere sofort anwendbaren Tipps & Tricks. FĂŒr Deine..
stagerockers.de/ Hörbuch Video Seminar Training Storytelling Coaching PrÀsentation Coach
292 ReproBerlin GmbH Digitaldruckerei &

ReproBerlin ist Ihre Digitaldruckerei und Copyshop in der Hardenbergstraße 7 in 10623 Berlin Charlottenburg Mo-Fr 9:30-18:30, Sa 11:00-16:00..
reproberlin.de Berlin Charlottenburg Digitaldruckerei Copyshop Mo Fr Sa Repro
293 Personalberatung Personalvermittlung

HSC Personalmanagement ist Ihre Personalberatung wenn es um die Personalsuche von Fach- und FĂŒhrungskrĂ€ften geht. Unsere Headhunter..
hsc-personal.de Personalberatung Headhunter Search Unternehmen Executive Kandidaten FĂŒhrungskrĂ€fte Personalvermittlung
294 No3 Schinkelplatz Apartments

Luxus Serviced Apartments in Berlin-Mitte..
no3-schinkelplatz.com/ Schinkelplatz Residence No Berlin Residences Townhouse Superior Residenzen
295 Fotograf

Berlin Tageslicht Sophie Brand Fotostudio Vorlieben Studio Arrayis
296 Photography

Safari Brand IndividualitÀt Deine Photography Bildern Fotografin StÀrke
297 Naturheilpraxis Shop Gesundheits Online

Sie möchten Ihre Gesundheit aktiv unterstĂŒtzen und NahrungsergĂ€nzungsmittel kaufen – legen aber hohen Wert auf QualitĂ€t und..
naturheilpraxis-shop.de Ly Bewertung Reg Bewertungen Dateget Hook Adresse Mail
298 Berliner Immobiliengutachter Immobiliengutachter

Mit uns haben Sie einen zuverlÀssigen und fachkundigen Immobiliengutachter in Berlin. Alle SachverstÀndigen im Team agieren frei..
berliner-immobiliengutachter.de/ Sans Cuse Helvetica Segoe Arial Lucida Not Prefetchable
299 Dauerhafte Laser-Haarentfernung Berlin Schönheit &

Amara – Aesthetic- & Laserlounge ist ihr kompetenter und professioneller Ansprechpartner fĂŒr dauerhafte Laser-Haarentfernung, apparative Kosmetik sowie..
amara-berlin.de Laser Haarentfernung Behandlung Haut Berlin Haare Amara WellenlÀnge
300 Max Blinker E-roller

Wir bieten Ihnen Elektroroller in höchster QualitĂ€t sowie autorisierten und bequemen Service ĂŒberall. Wir lieben eine nachhaltige..

Kleinanzeigen, Kommentare und Mitfahrgelegenheit Berlin

+ Kommentar oder Kleinanzeige für Berlin eintragen!

301 Home Augenarztpraxis im
Augenarztpraxis im Ärzte Centrum Bülowstraße
302 Albers DAS SPORTRESTAURANT Albers Wettboerse GmbH Albers
Großzügig konzipiert ist das Albers Sportrestaurant der Treffpunkt aller Besucher des Pferdesportparks BerlinKarlshorst. Der aufmerksame
albers-restaurant.de Albers Berlin Restaurant
303 Home
304 Weihnachtsmarkt auf dem Winterfeldtplatz Berlin
Der traditionelle Weihnachtsmarkt auf dem Winterfeldtplatz ist einzigartig und an den Adventssonntagen geöffnet.
weihnachtsmarkt-winterfeldtplatz.de Berlin Weihnachtsmarkt Winterfeldtplatz
305 Formular.de Tipps & Formular.de ist ein Angebot der Formblitz AG
Auf Formular.de finden Sie umfangreiche Informationen zu juristischen Themen wie Mietvertrag Arbeitsvertrag Patientenverfügung
306 Cafe Peri Start
Homepage of Cafe Peri
307 Czollek consult Willkommen! Leah
Diversity Dialoge Mediatorin Trainerin Dozentin Konflikte produktiv und zufriedenstellend lösen Kommunikation Dialog Unternehmen Kommunikationskultur
czollek-consult.de Leah Carola Czollek
308 PROFORMA Corporate Design Gesellschaft fĂŒr Unternehmenskommunikation mbH & Co. KG Design
Corporate Design Agentur Berlin Agentur für Unternehmenskommunikation WebEntwicklungen und Beratung. Für Unternehmen
proforma.de Design Gestaltung Corporate
309 Business Development Germany German
We bring your business on the German market – contact us today!
businessdevelopmentgermany.de German Companies German Marketing
310 DJ Frank DJService DJ
Dj Frank Berlin DJService für Partys Feste Hochzeiten ...
dj-frank-berlin-brandenburg.de DJ Berlin Brandenburg Party Hochzeit
311 Berlin Taekwondo Willkommen Berlinsan Taekwondo Sportverein e.V. Adnan
Olympic Sports Center Berlinsan Taekwondo e.V. Adnan Karabulut
berlintaekwondo.de Adnan Karabulut Taekwondo Berlin
312 Wohnungsauflösung Berlin 030 wohnungsauflö
Wohnungsauflösung Berlin günstig und schnell von Complett Räumung 030 261 01 714
berlin-wohnungsaufloesung.de Wohnungsauflösung Berlin Wohnungsauflösungen Entrümpelung En
313 RAe Böhm & MeyerDulheuer §§
Rechtsanwälte Rechtsanwalt Matthias Böhm Notar Helmuth MeyerDulheuer RA RAe §
boehmmeyerdulheuer.de §§ § Rechtsanwälte
314 Astrid Elisabeth Stebich
Astrid Elisabeth Stebich Make up Artist & Friseurmeisterin aus Berlin. Make up & Haare
315 Home www.berlinevangelisch.de Gesellschaft fĂŒr Unternehmenskommunikation mbH & Co. KG Abgeltungssteuer
www.berlinevangelisch.de – Das ServicePortal der Evangelischen Kirche in Berlin.
berlin-evangelisch.de Abgeltungssteuer Advent Austritt Bach Berlin
316 Berlin Apartments Potsdamer Str Berlin
Apartments in Berlin nähe Potsdamer Platz für Gruppenreisen Gruppenunterkunft
berlin-aparts.de Berlin Apartments Berlin Gruppenreise
317 Bar Voyage barvoyages bar
Bar CafĂ© Kleinkunstbühne
barvoyage.de Bar Berlin Kleinkunst Berlin
318 Home ‱ Kunstsaele Berlin Kunstsaele
Die Kunstsaele Berlin verbinden Galerie Sammlung und Kulturprojekte an einem Ort. Neben den wechselnden
kunstsaele.de Kunstsaele Oehmen Bergmeier
319 WerbeartikelAgentur für Fahrradsattelbezüge
Kultkeks ist Ihr Partner für individuelle Werbemittel und Werbegeschenke. Unser Sortiment reicht von der Handysocke
Seit nunmehr 26 Jahren ist das TRIO PALMERA unterwegs um landesweit und über die Landesgrenzen
josefinol.de Salsa Cumbia Merengue
321 Home Labbow Personalleasing e.K.
Personalberatung und dienstleistungen
322 Marian Kiss Marian
Marian Kiss Film Berlin Filmemacherin Filmmaker Regiesseurin Director
mariankiss.de Marian Kiss Film
323 Marianne Rosenberg | RoseWeb Public Image GmbH Marianne
Die offizielle Website von Marianne Rosenberg mit aktuellen Infos SongDownloads Biografie Diskografie
rosenberg.de Marianne Rosenberg Pop
324 MännerMinne e.V. Erster schwuler choir
MännerMinne e.V. Erster schwuler Männerchor Berlin gegründet 1987 Mitglied im Berliner Sängerbund.
maennerminne.de Choir Chorus Gay
325 | MARTINA DOEHRING | c/o Formblitz AG Martina
Dies ist die offizielle Website der Sopranistin Martina Doehring
martinadoehring.de Martina Doehring Sängerin
326 EVA GmbH EVA GmbH
KFZ Reparatur oder Ausfuhrversicherung:sofort in unserem OnlineShop. Auch Gebrauchtwagengarantie und Finanzierung für Privatpersonen und Händler
327 Diversitygendertraining.de joomla
Joomla! dynamische PortalEngine und ContentManagementSystem
energydeal.de Joomla Joomla
328 :: Keding / ESS Keding / ESS Elektronische Sicherheitssysteme GmbH / Keding GmbH & Co. KG sicherheitssystem
ESS GMBH Planung Lieferung Montage Inbetriebnahme von elektronischen Signal und Anzeigeanlagen
ess-sicherheit.de Sicherheitssysteme Alarmanlagen Brandmeldetechnik Brandmelder Brandmeldeanl
329 Hauptstadtplan | interaktiver stadtplan Adler & Schmidt GmbH Bundeshauptstadt
Interaktiver häusergenauer Stadtplan der Berliner Innenstadt. Suchmöglichkeit nach den Kategorien Sehenswürdigkeiten Kultur Regierungsbauten
hauptstadtplan.de Bundeshauptstadt Berlin Hauptstadt Bundesregierung Reichstag
330 Home GmbH & Co. KG ML4
Personalleasing ML4 Personalmanagement GmbH & Co.
ml4-dienstleistungen.de ML4 ML4Personalmanagement ML4
331 Keding GmbH & Co.KG Integral
IntegralSecurity Integralsecurity Integral Security Integral Security Antennentechnik und Sicherheitstechnik Alarmanlagen Brandmeldeanlagen Einbruchmeldeanlagen Videoüberwachung und mehr)
keding.de Integral Security IntegralSecurity Integralsecutity Integral
332 Start Kauffeld und
Kauffeld und Jahn
333 Willkommen bei Pascha Grill joomla
Joomla! dynamische PortalEngine und ContentManagementSystem
pascha-grill.de Joomla Joomla
334 PartytechnikBerlin Verleih von Berlin
Partytechnik Berlin verleiht Lichttechnik und Tontechnik für Eure Party/Veranstaltung
partytechnik-verleih-berlin.de Berlin Partytechnik Verleih Party Verleih
335 Home
Tierärzte Tierarztpraxis Marianne Gass
336 Willkommen bei perko profundus! Perko
perko profundus
perko-profundus.de Perko Gudrun Profundus Wissenschaftscoach Education
337 Ludger Jungnitz Men's Maenner
Ludger Jungnitz Men's Care Men's Studies
mensstudies.de Maenner Lebensqualitaet Gesundheit
338 Berlin Apartments Potsdamer Str Berlin
Apartments in Berlin nähe Potsdamer Platz für Gruppenreisen Gruppenunterkunft
cityapartsberlin.de Berlin Apartments Berlin Gruppenreise
339 HumanistischSystemische Beratung Frank systemisch
Erkennen und Auflösen von Verstrickungen Familienstellen Psychodrama Gestaltherapie Trauma
frankstamer.de Systemisch Familienstellen Aufstellung
340 Flowers of life Flowers
Flowers of life richtet sich an alle Menschen die Begleitung Gesellschaft oder eine persönliche
flowers-of-life.de Flowers Of Life Brigitte
341 INTEGRAL SECURITY Sicherheitstechnik Keding GmbH & Co. KG IntegralSecurity
Sicherheitstechnik von Integral Security dem deutschlandweiten Firmenverbund für Sicherheitstechnik (Alarmanlagen Brandmeldeanlagen Einbruchmeldeanlagen
integralsecurity.de IntegralSecurity Sicherheitstechnik Integral
342 IJam.de – mediendesign Webdesign
10 Schritte zur eigenen Website | iJam.de Mediendesign
ijam.de Webdesign Mediendesign Homepage
343 Startseite » Gesine Palmer » Herzlich Willkommen auf Gesine
Dr. Gesine Palmer leitet das Berliner Büro für besondere Texte. Die Religionsphilosophin bietet Kommunikationsberatung und
gesine-palmer.de Gesine Palmer Redenschreiben
344 Politikmanagement mit Gitta Stieber Politikmanagement
Gitta Stieber Berlin Politikmanagement Qualifizierung und Weiterbildung die Sie in sozialen
gittastieber.de Politikmanagement Kommunikation SoftSkills
345 Gift Music Gift Music GmbH Weltmusik
Ein kleines Weltmusiklabel aus Berlin
giftmusic.de Weltmusik Label Berlin
346 GEAG Immobilienverwaltung Berlin:Wir verwalten GEAG Immobilienverwaltungs GmbH Wirtschaft
GEAG Immobilienverwaltungs GmbH: kompetente Verwaltung und Betreuung von Immobilien in Berlin Brandenburg Sachsen
geag-berlin.de Wirtschaft Immobilien Immobilienverwaltung
347 Business Development Germany German
We bring your business on the German market – contact us today!
business-development-germany.de German Companies German Marketing
348 Moritz Tilman Achelis | rechtsanwalt
Rechtsanwalt Arbeitsrecht Achelis Baurecht Architektenrecht Grundstücksrecht Wohnungseigentumsrecht Medizinrecht
ra-achelis.de Rechtsanwalt Arbeitsrecht Achelis
349 RDM: Startseite Landesverband Berlin und Brandenburg e.V. rdm
RDM Ring Deutscher Makler Landesverband Berlin und Brandenburg e.V.
rdm-berlin-brandenburg.de Rdm Ring Deutscher
350 Startseite Willkommen
351 Rita Leinenweber · Astrologie Astrologie
Ich freue mich Ihnen meine Kenntnisse in Astrologie Massage & energetischen Heilweisen
ritaleinenweber.de Astrologie Horoskop Geburtshoroskop
352 GEAG Immobilienverwaltung Berlin:Wir verwalten GEAG Immobilienverwaltungs GmbH Wirtschaft
GEAG Immobilienverwaltungs GmbH: kompetente Verwaltung und Betreuung von Immobilien in Berlin Brandenburg Sachsen
sabinespehr.de Wirtschaft Immobilien Immobilienverwaltung
353 Rundum Ich Ihr massage
Massage Ernährungsberatung Fitness und Personal Training Hypnosetherapie in Berlin für Privatkunden
rundum-ich.de Massage Ernährung Hypnose
354 Astrologische Gesundheits und Lebensberatung Astrologie
Astrologische Gesundheits und Lebensberatung Yvonne v. Bechtolsheim: Astrologie Reiki Ernährungsberatung und Radionik in
schwarzer-second-hand-shop.de Astrologie Reiki Ernährungsberatung
355 Roger Thilo EDV Service Roger
Wir bieten ITLösungen im Businessbereich für alle Branchen und Unternehmensgrößen. innovativ zuverlässig
rthilo.de Roger Thilo EDV Service
356 PROBase easy PROFORMA GmbH & Co. KG CMS
Mit PROBase easy erstellen wir individuell hochwertige Webauftritte Sie brauchen nur noch die Texte
pro-base-easy.de CMS ContendManagemnetSystem Contend
357 Sm hope ick Kindermode
Die Teilnahme am Wettbewerb „Meine Heimat“ auf der Kreativplattform Dawanda.de war Anlass Designs zu
smhope.de Kindermode
358 LOOK22 Home LOOK22 LOOK22
LOOK22 MediaService ~ zielgruppenoptimiertes Webdesign ~ aussagekräftige Fotografie ~ perfekte Grafik ~ treffsichere Texte ~
look22.de LOOK22 MediaService Internet Fotografie Grafik
359 Raumdesignerin .Silke Smida. kunst
Art by Silke Smida composed drawings find new places!
raumdesignerin.de Kunst Design Graffiti Wandtattoos Acryl
360 BEGINE Treffpunkt und Frauen
Interkulturelles Frauenkulturzentrum Künstlerinnenförderung Konzerte Ausstellungen Potsdamer Str. 139 BerlinSchöneberg
begine.de Frauen Lesben Frauencafé
361 Complett Räumung | Wohnungsauflösung wohnungsauflö
Wohnungsauflösung Berlin günstig und schnell von Complett Räumung 030 261 01 714
complett-berlin.de Wohnungsauflösung Berlin Wohnungsauflösungen Entrümpelung En
362 Contravision breaking news contra medienwerkstatt e.v. ContraVision
short film festival in berlin germany march 20th to march 28th
contravision.de ContraVision Cinema Contra
363 Doktus.de Dokumente uploaden FORMBLITZ AG doktus
Hier findet man Dokumente zu allen Themen und kann Dokumente suchen verwalten
doktus.de Doktus
364 | MARTINA DOEHRING | c/o Formblitz AG Martina
Dies ist die offizielle Website der Sopranistin Martina Doehring
martina-doehring.de Martina Doehring Sängerin
365 Wolfgang Kommerell | kommerell.de Wolfgang
Website von Wolfgang Kommerell: Segeln Fotografie.
kommerell.de Wolfgang Kommerell Fotografie
366 Marianne Rosenberg | RoseWeb Public Image GmbH Marianne
Die offizielle Website von Marianne Rosenberg mit aktuellen Infos SongDownloads Biografie Diskografie
roseclub.de Marianne Rosenberg Pop
367 Linux auf CD/DVDR linux
LinuxDistributionen auf CDR und DVDR tuxpost.de Shop
tuxpost.de Linux Iso Shop
368 Home Texts and Birgit
Dr. Birgit Hollenbach brings language and science together. Her university studies of translation and biochemistry
textsandtranslations.de Birgit Hollenbach Translation
369 .:|Stadtrundfahrten|Originelle Alternative Stadtrundfahrt|Berliner Dialekt Berlin
| BerlinerSchnauze Stadtrundfahrten | Alternative Stadtrundfahrt im Berliner Dialekt | Mundart sehr Orginelles Geschenk
berliner-schnauze.de Berlin Stadtrundfahrt Stadtrundfahrten Information Private
370 Übersetzer Deutsch Rumänisch Rumänisch
Übersetzungen Deutsch Rumänisch Dolmetscher für Rumänisch in Berlin profesionelle Übersetzung kundenorientiert
turbatu-translations.de Rumänisch Übersetzer Deutsch Rumänisch
371 Home / tausendschwarz.de Angebot
HomepageTitel Berlin
tausendschwarz.de Angebot Kompetenz Beratung
372 Subversionen.de | praeludium
——— Beuys + Agnoli
373 Betreutes Wohnen in Demenz betreutes
Der FAW e.V. begleitet und verwaltet ambulant betreute Wohngemeinschaften für Menschen mit Demenz.
verein-faw.de Betreutes Wohnen Demenz Wg
Seit nunmehr 26 Jahren ist das TRIO PALMERA unterwegs um landesweit und über die Landesgrenzen
trio-palmera.de Salsa Cumbia Merengue
375 Astrologische Gesundheits und Lebensberatung Astrologie
Astrologische Gesundheits und Lebensberatung Yvonne v. Bechtolsheim: Astrologie Reiki Ernährungsberatung und Radionik in
sternen-klar.de Astrologie Reiki Ernährungsberatung
376 Italienische Weine Online Weine
Vinila Weine aus Italien. Wer via eCommerce in Deutschland die besten italienischen Weine online
vinila.de Weine Wein Aus Italien
377 NAS Planung & Baumanagement Nas Planung & Baumanagement GmbH & Co. KG Berlin
NAS Planung & Baumanagement GmbH & Co. KG Telefon +49 (0)30. 216 95 45
xn--nas-planungsbro-cwb.de Berlin Ahmet Nas
378 AllmendeKontor Gemeinschaftsgarten Allmende-Kontor e.V.
Allmende = Gemeingut = Commons: Berliner AllmendeKontor Gemeinschaftsgarten und eine der größten Hochbeetanlagen der
379 Beste Hunde: OnlineMagazin für
Das Online Hundemagazin mit aktuellen Artikeln zu Gesundheit Ernährung Erziehung und Verhalten
380 Berliner Schlagerfest 2012 berliner
Das Berliner Schlagerfest geht in die 2. Runde.
berliner-schlagerfest.de Berliner Schlagerfest 2012 Schlagerfest Berlinmitte
381 Birgit Schlieps Birgit
Urban Sculpture. Die Künstlerin Birgit Schlieps arbeitet mit dem urbanen Raum als Phantom Mythos
birgitschlieps.de Birgit Schlieps Kunst
382 Startseite Willkommen
383 Business Development Germany German
We are the leading German Marketing Company bringing your business on the German market. Our
cockpit-germany.de German Companies German Marketing
384 Coworkingberlinsquarehaus.de coworkingberlinsquarehaus Webseite! Square Haus am Nollendorfplatz GmbH
SquareHaus work meet share collaborate coworking büros konferenzraum
385 Business Development Germany German
We are the leading German Marketing Company bringing your business on the German market. Our
dashboard-germany.de German Companies German Marketing
386 Herzlich Willkommen Willkommen Forner + Forner GbR
Als kreatives und innovatives Unternehmen für Beratung und Kommunikation möchten wir Sie als vertrauensvoller Partner
387 Home Schwarzweiß
Neue Wege Neue Sichten Neue Fotografien Du möchtest besser wahrnehmen und kreativ sein
fotografisch-sehen-lernen.de SchwarzweißFotografie Konzeptfotografie Fotografisch
388 Fotostudio Altman. Hochzeit Wettbewerb Studioalex.de
Suchen Sie einen professionellen Fotografen mit über 25 Jahre Erfahrung in der Fotografie? Dann sind
fotostudioalex.de Studioalex.de Hochzeit Wettbewerb Meine Traumhochzeit!
389 DIF | Dit is mirapodo – operated by myToys.de GmbH
DAS Berliner Modeblog zu Fashiontrends und Modesünden Parties und Veranstaltern Designern und Kollektionen
390 Heilpraxis Susanne Weis Heilpraxis
Heilpraxis Susanne Weis
391 BAKUNAPOLI BakuNapoli
BAKUNAPOLI.Aserbaidschanische und italienische Küche.
baku-napoli.de BakuNapoli Restaurant Berlin Aserbaidschanische Küche
392 Kristina Jacoby Startseite Ghostwriter
Kristina Jacoby unterstützt Autoren bei der Erstellung ihrer Bücher
kristinajacoby.de Ghostwriter Ghostwriting Wissenschaftliches
393 Startseite Klinisches Krebsregister Klinisches Krebsregister fĂŒr Brandenburg und Berlin gGmbH Klinisches
Informationen zur klinischen Krebsregistrierung in Brandenburg
kkrbb.de Klinisches Krebsregister Brandenburg
394 Kniggeinberlin.de Willkommen bei Knigge
Gesellschaftlicher Schliff selbstsicheres und stilvolles Auftreten ist heute wichtiger denn je. Jeder kann Benehmen
knigge-in-berlin.de Knigge Seminare KniggeSeminare Benehmen Benimmkurse
395 PROJECT318 photography
Homepage für die Vernissage / Ausstellung PROJECT318 der SRH Hochschule der populären Künste (hdpk).
project318.de Photography Design Motion
396 Ludger Jungnitz Prozessbegleitung Prozessbegleitung
Prozessbegleitung Berlin Ludger Jungnitz
prozessbegleitung-berlin.de Prozessbegleitung Coaching Projekte
397 SPAM Magazin SPAM
SPAM Magazin Ausgabe 01
spam-music.de SPAM; Magazin Musik
398 Text Julia Richter
Erstklassige Unternehmenskommunikation Texte und Konzepte in Berlin
399 ReBuy der einfache An reBuy reCommerce GmbH gebraucht
An und Verkauf für gebrauchte Handys Tablets Videopiele Filme CDs
rebuy.de Gebraucht Kaufen Gebraucht Verkaufen
400 Pasta e PiĂč Startseite Frische
Frische Pasta in Berlin
pasta-e-piu.de Frische Pasta Berlin Raviolli Ghnochi
401 Aktuelles Bürgerinitia
Stadtplanung von unten Stadtentwicklung TempelhofSchoeneberg Berlin
stadtplanung-von-unten.de Bürgerinitiative Bürgerbegehren Bürgerentscheid Anwohnervers
402 Taxi Bildungscenter Berlin Treffpunkt Bildung GmbH Taxischein
Wir schulen seit 18 Jahren erfolgreich auf die Ortskundeprüfung mit eigenem ständig aktuellem
taxi-bildungscenter.de Taxischein PSchein Taxifahrer Fahrgastbeförderung Ortskundeprüfun
403 Studio NiMa Produktion Mode Kauffeld und Jahn GbR
Vom Entwurf bis zur Produktion. Mode und Textil. Studio NiMa ist in der Bekleidungsindustrie
404 Schuhe Online Shop myToys, mirapodo und ambellis - Shops der myToys.de GmbH
Schöner Schuhe shoppen ♄ riesige Auswahl für Damenschuhe ✓ Herrenschuhe ✓ und Kinderschuhe ✓ Bestellen
405 Yoga in Kreuzberg Yoga
Yoga in Berlin an Ihrem Arbeitsplatz oder besuchen Sie YogaKurse in Berlin Kreuzberg mit
yoga-und-massage.de Yoga Am Arbeitsplatz Yoga
406 MyToys | Alles für myToys, mirapodo und ambellis - Shops der myToys.de GmbH
myToys Ihr OnlineShop für Spielzeug Kindermode Babyausstattung und vieles mehr. Über 100.000
407 Werbung auf dem Sattelschoner|
Sattelschützer als Werbemittel: Bedrucken Sie Sattelbezüge mit Ihrem Logo. Individuelle Gestaltungsmöglichkeiten Lieferung nach drei
408 Finest Whisky Shop Whisky
Unsere Philosophie ist es hochwertige seltene und alte Flaschen der verschiedensten Destillen und Abfüller
finestwhisky.de Whisky Verkauf Berlin
409 Black meadow music production Martin Klein und Christian Kociolek GbR
black meadow music production is a label situated in Berlin.
410 Immocollect.de by Portal Financecollect Immocollect.de by Portal Financecollect GmbH Immocollect.de
Immobilienangebote von Immocollect.de by Portal Financecollect GmbH
immocollect.de Immocollect.de By Portal Financecollect GmbH
411 Simply : pr + simply
simply : die PR und Marketing Agentur für erklärungsbedürftige Produkte! fon +49 (0) 30. 21
agentur-simply.de Simply Public Relation
412 Ashtanga Yoga Schule Berlin Ashtanga
Ashtanga Yoga Schule in Berlin Schöneberg am Winterfeldtplatz Pallasstr. 89 10781 Berlin
ashtangayogaschoeneberg.de Ashtanga Yoga Berlin Schöneberg
413 Rosenscharf und Edelsüß Catering ZOE
Restaurant ZOE Berlin. Asiatische und mediterrane Küche zwischen Hackeschem Markt und Alexanderplatz in Berlin Mitte.
aromamanufaktur.de ZOE Restaurant Lounge
414 Online Marketing: Wissen &
Endlich von Online Marketing profitieren. Portal & Ratgeber für erfolgreiches Internetmarketing mit Grundlagen & Tipps
Fachgeschäft für Naturkosmetik und Naturwaren. Kosmetische Behandlungen nach Dr. Hauschka und M.Gebhardt.
416 Architektur Planung Beratung
Architekten Hannover Berlin Architekturplanung Bauberatung Projektentwicklung Wertermittlung Architektur architectura nova
417 ChristianErdmann.de Christian
Willkommen auf der privaten Site von Christian Erdmann. Erfahren Sie mehr über meine Dozententäigkeit und
christian-erdmann.de Christian Erdmann Dozent Verwaltungsrecht Doppik.kom.bb
418 Christine Ordnung | Home xxxxx
christine-ordnung.de Xxxxx
419 CORINO 4 MEN CorinoArt
Photographer for beauty nude art fashion faces lingerie interieur
corino4men.de CorinoArt Photography Fotografie
420 Claudia Scholl Aktuelle Claudia
Claudia Scholl Buchkonzeption Gestalterische Konzepte Kinderkunstprojekte Illustration und Corporate Design
claudia-scholl.de Claudia Scholl Berlin Kartonzauber Grafikdesign
Herzlich willkommen bei der URBANIS GmbH
bvg-holding.de URBANIS Berlin Unternehmen
422 Home Chatwins Chatwin
CHATWINS: Bücher rund ums Reisen gibt es hier nach Ländern und Kontinenten sortiert. Reisen heißt:
chatwins.de Chatwin Chatwins Bruce Chatwin A
423 52. DeutschFranzösisches Volksfest Schaustellerverband Berlin e.V. Deutsch
Das mit Abstand größte jährliche Volksfest in Berlin Willkommen auf über 40.000mÂČ Erlebnisfläche!
deutsch-franzoesisches-volksfest.de Deutsch Französisches Volksfest Laune
424 Beateberlin AGENTUR FÜR EVENTS beateberlin
beateberlin Agentur für Events und Stadterlebnisse in Berlin und Umgebung
beateberlin.de Beateberlin Agentur Agency
425 Berliner Berufsverband der Gesundheitsaufseher/Hygieneinspektoren BBGH
Der Berliner Berufsverband der Gesundheitsaufseher/Hygieneinspektoren stellt sich vor und bietet Informationsmaterial rund um den öffentlichen
bbghev.de BBGH BVH Hygiene
426 Organisationsberater Berater für Bio
Unternehmensberater für Ökologische Landwirtschaft (Biolandbau) und Biomarkt (Biohandel) – Experte für Bio Lebensmittel und Biolandbau
bio-projektmanagement.de Bio Lebensmittel Bioprodukte
427 BeGreen Netzwerk für nachhaltiges beGreen Netzwerk fĂŒr nachhaltiges Wirtschaften e.V. Verein
Alles Wissenswerte von der Historie über Ergebnisse Veranstaltungen und neueste Trends bis hin zur
begreen-net.de Verein Mitgliedschaft Beitrittserklärung
428 IOB Internationale OmnibusBetreibergesellschaft ZOB
ZOB Zentraler Omnibusbahnhof Berlin an Funkturm und Messegelände:
berlinzob.de ZOB Zentraler Omnibusbahnhof Berlin APC
429 Blauwerke verlag # groschenhefte blauwerke
Verlag aus Berlin fuer konkrete Literatur und konkrete Wissenschaft. Gebrauchstexte für die Westentasche.
blauwerke-berlin.de Blauwerke Blauwerke Berlin
430 Werbe und Vertriebsmangement GSW
Die “ FIGARO news” sind das GSW Club Magazin für die Mieter der GSW Immobilien
effektivwerbung24.de GSW Club Figaro News
431 Elena nehrmann promotion
Kultur Kommunikation
elenanehrmann.de Promotion P.r. Pr
432 MACKE Boutique Berlin
Mode ist Kultur Entsprechend diesem Motto bieten wir Ihnen stil und anspruchsvolle Mode und
433 DigitalphotoBerlin Foto
Phototechnik Fehling Fotografie Bearbeitung Entwicklung Vergrößerung von Diabildern Digitalfotografien
digitalphoto-berlin.de Foto Fotografie Photo
434 Diethard Küster Regisseur
Diethard Kžster Regisseur Produzent Autor Regie Produktion
436 BEOBOOKS Bücher aus Bücher
BEOBOOKS Bücher aus Serbien Katarina Belovukovic
beo-books.de Bücher Serbien
437 Bettina Willumeit | Styling bettina
innovatives kundenorientiertes Fashion Styling für die Bereiche Werbung Editorialproduktionen und Onlinevermarktung
bettina-willumeit.de Bettina Willumeit Stylistin
438 HOME
439 Joomla Toplist Hauptseite joomla
Dies ist die deutsche JoomlaTopseitenliste. Hier finden Sie die wahrscheinlich besten Seiten die mit
joomla-toplist.de Joomla Toplist Best
440 Jugendhilftweiter.de Jugend
Modellprojekt Jugendräte: Eine Homepage von den Jugendräten des Modellprojekts Jugendräte von Berlin SchönebergNord
jugend-hilft-weiter.de Jugend Hilft Weiter
441 LumpenPrinzessin ... Kinderkleidung Kinderkleidung
Die LumpenPrinzessin bietet seit über 15 Jahren Alles für Baby und Kind in gut erhaltener
lumpenprinzessin.de Kinderkleidung Kindermode Kinderschuhe
442 Herzlich Willkommen auf LittleThailand.de thai
Die neuesten und beliebtesten ThaiMassagen ThaiRestaurants Shops und mehr Mit vielen Bewertungen
little-thailand.de Thai Verzeichnis übersetzer Shops Restaurants
443 Evelyn Bornemann Berlin Berlin
Evelyn Bornemann in Berlin Physiotherapie Psychotherapie (HPG) Coach nach der TippingMethode hilft
evelyn-bornemann.de Berlin Physiotherapie Psychotherapie
444 ||| EuroKaukAsia     EuroKaukAsia e.V.
KaukasischEuropäischer Kultur und Wissenschaftsverin e.V.
445 Excelle.consulting | Produktions und excelle.consultin
excelle.consulting bietet kundenindividuelle Lösungen zu Fragen der strategischen Unternehmensentwicklung und der Gestaltung operativer Leistungsstrukturen sowie
excelle-consulting.de Excelle.consulting Excelle Excelle.de
446 F/21 Büro für Nora
f/21 Büro für Zukunftsfragen ist Beratungsinstitut und Denkfabrik. f/21 beobachtet die Gegenwart identifiziert
f-21.de Nora Stampfl Nora S. Stampfl
Natalia Domagala
448 Investieren wie die Superreichen Investieren
Wie auch Sie schnell und einfach die Investments der Superreichen finden die nur ein
superreichtum.de Investieren Geld Anlegen
449 Mediation in Diversity Mediation
Mediation in Konfliktfällen Preisgünstige Mediationsausbildung nach anerkannten Standards von Bundesverbänden oder erfahrene Mediatoren? Kontaktieren
meddiv.de Mediation Berlin Mediationsausbildung Berlin
450 Jura Service Berlin | kaffeevollautomat
Jura Service Berlin| Kaffeemaschine u. Kaffeeautomat ReparturWartung u. Kundendienst in Berlin.Reparaturen von Kaffeemaschinen u.
jura-service-berlin.de Kaffeevollautomaten Reparatur Jura Service Kaffeemaschinen
451 Kanzlei Klaus Koblitzek homepage
homepage dokument webpage page web netz
kanzlei-koblitzek.de Homepage Dokument Webpage Page Web
452 Kanzlei Rechtsanwalt Böcker joomla
Joomla! dynamische PortalEngine und ContentManagementSystem
kanzleiboecker.de Joomla Joomla
453 Rechtsanwaltskanzlei und Notariat Michael Rechtsanwalt
Rechtsanwaltskanzlei und Notariat Michael Müller Rechtsanwalt und Notar Michael Müller in Berlin Schöneberg berät
kanzlei-mmueller.de Rechtsanwalt Notar Berlin
454 Schauspieler Coaching Berlin Karin
Mit dem KarriereTraining für Schauspieler durchstarten und dranbleiben. Die eigene Karriere lustvoll und aktiv gestalten.
karin-kleibel.de Karin Kleibel PR
455 LumpenPrinzessin ... Kinderkleidung Kinderkleidung
Die LumpenPrinzessin bietet seit über 15 Jahren Alles für Baby und Kind in gut erhaltener
kind-in-berlin.de Kinderkleidung Kindermode Kinderschuhe
456 Claudia Scholl Aktuelle Claudia
Claudia Scholl Buchkonzeption Gestalterische Konzepte Kinderkunstprojekte Illustration und Corporate Design
kartonzauber.de Claudia Scholl Berlin Kartonzauber Grafikdesign
457 Krups | Siemens | aeg
Krups | Siemens | AEG | ReparaturServiceWartung und Kundendienst in Berlin.Kaffeemaschinen und Kaffeevollautomaten
kaffeemaschine-reparatur.de Aeg Krups Siemens Kaffeevollautomaten Kaffeemaschinen
458 Home
Elzers Seiten zum Wohnungseigentumsrecht
459 Patwork
460 Peter Bruns Homepage Peter
Homepage von Peter Bruns
peterbruns.de Peter Bruns Cello
461 Rechtsanwälte PfaffHofmann u. Lee Rechtsanwalt
Die Rechtsanwaltskanzlei PfaffHofmann u. Lee legal Rechtsanwaltsgesellschaft bietet eine und zielorientierte Beratung. Schwerpunkt Wirtschaftsrecht z.B.
phl-legal.de Rechtsanwalt Rechtsanwaltskanzlei Arbeitsrecht
462 ..::Phoenix Lounge::.. Phoenix
Phoenix Lounge. Bar Restaurant Cafe in Schöneberg.
phoenix-lounge.de Phoenix Lounge Phoenix
463 Physimetron Elektronische Messtechnik Transimpedanzvers
Rauscharme analoge und digitale elektronische Messtechnik
physimetron.de Transimpedanzverstärker Pikoamperemeter Vorverstärker
464 Mobilienberlin.de living
mobilien: die schönen dinge zum leben wohnen und arbeiten! besuchen sie uns in berlinschöneberg...
mobilien-berlin.de Living Wohnen Wohnaccessoires
465 Otto Events Veranstaltungstechnik veranstaltungstec
Otto Events organisiert Ihre Veranstaltung in Berlin Brandenburg und Potsdam. Wir vermieten Veranstaltungstechnik
ottoevents.de Veranstaltungstechnik Berlin Potsdam
466 Naturheilpraxis im Hofbogen behandlung
Naturheilkunde Praxis Hofbogen Heilung Anwendung Rheuma Therapie Heilpraktiker
heilpraktikerin-schoeneberg.de Behandlung Therapie Körper
467 HALBE STUNDEN // HALF Kurzfilm
halbestunden.de Kurzfilm Leere Familie
468 Flamencomeetsclassic flamenco
flamencomeetsclassic ist ein Tanztheater aus Berlin das klassische Texte Flamencomusik und Tanz zu
flamenco-meets-classic.de Flamenco Tanz Tanztheater
469 Flats & Co. Flats & Co. GmbH Waldmannstr.
Eigentumswohnungen Waldmannstr. 3 BerlinLankwitz
flatsandco.de Waldmannstr. 3
470 Praxis für integrale Medizin Integral
Arztpraxis Dr. Martin Bosch BerlinSchöneberg
integralmedicine.de Integral Medicine Arztpraxis
471 Startseite
Anwälte & Steuerberater PSInkasso
472 Gerd Brendel | Journalist Gerd
Gerd Brendel Journalist
gerdbrendel.de Gerd Brendel Journalist
473 Autorin Martina Gneist CBT
Autorin Martina Gneist Projekte und Philosophie
gn-konzepte.de CBT WBT Lernkonzepte
474 Startseite hanslux Open
Beratung und Dienstleistungen für Computer Netze und ITSicherheit unter Verwendung von OpenSource Produkten
hanslux.de Open Source Freie Software
475 Theater Hans Wurst Nachfahren Grüffelo
Hans Wurst Nachfahren Theater für Kinder und Erwachsene in BerlinSchöneberg zeigt Spielplan
hasn-wurst-nachfahren.de Grüffelo Puppentheater Berlin
476 Organisationsberater Berater für Bio
Unternehmensberater für Ökologische Landwirtschaft (Biolandbau) und Biomarkt (Biohandel) – Experte für Bio Lebensmittel und Biolandbau
handel-und-wandel.de Bio Lebensmittel Bioprodukte
477 Fachanwalt für Arbeitsrecht Berlin Fachanwalt
Fachanwalt für Arbeitsrecht Erbrecht und Versicherungsrecht in Berlin sowie Notar Berlin. Kanzlei Gäbelein &
gaebelein-veith.de Fachanwalt Arbeitsrecht Versicherungsrecht
478 DFRV Regionalgruppe Berlin
| Website der Regionalgruppe Berlin des Deutschen Fundraising Verbands
479 Fußballwörterbuch in 7 Sprachen
FußballWörterbuch in 7 Sprachen: Homepage des Buches von Kaya Yildirim
480 Felicitas Jacobs Theaterpädagogin Theater
Ich biete vielfältige theaterpädagogische Qualifikationen als Ausbildung oder Fortbildung initiiere theatrale Prozesse und entwickle
felicitasjacobs.de Theater Pädagogik Spiel
481 Organisationsberater Berater für Bio
Unternehmensberater für Ökologische Landwirtschaft (Biolandbau) und Biomarkt (Biohandel) – Experte für Bio Lebensmittel und Biolandbau
conradthimm.de Bio Lebensmittel Bioprodukte
482 Startseite constant balance Fußpflege
Heilsame Behandlungen für Körper Geist und Seele Fußpflege Massagen und Heilarbeit
constant-balance.de Fußpflege Wellness Entspannung
483 Organisationsberater Berater für Bio
Unternehmensberater für Ökologische Landwirtschaft (Biolandbau) und Biomarkt (Biohandel) – Experte für Bio Lebensmittel und Biolandbau
consultantfororganictrade.de Bio Lebensmittel Bioprodukte
484 Querschnitt Weine
Querschnitt Weine Weinhandlung in BerlinSchöneberg
485 Startseite
Rechtsanwältin Sylvia PfaffHofmann: Ihr Recht in guten Händen! Spezialgebiete: Europarecht Einbuergerungsrecht und Asylverfahrensrecht
486 Praya ThaiMassage Startseite Massage
Praya ThaiMassage Ihre Praxis in Berlin bietet professionelle Physiotherapie und Massagen als therapeutisches
prayathai.de Massage Praxis
487 Startseite
Anwälte & Steuerberater PSInkasso
488 Kanzlei Rechtsanwalt Böcker joomla
Joomla! dynamische PortalEngine und ContentManagementSystem
rechtsanwaltskanzlei-24.de Joomla Joomla
489 Fachanwalt Strafrecht Rechtsanwalt Fachanwalt
Fachanwalt Strafrecht Rechtsanwalt Feldkamp Berlin
rechtsanwaltskanzlei24.de Fachanwalt Strafrecht Rechtsanwalt
490 Reinigung360.de | Professionelle Gebäudereinigung Reinigung
Gebäudereinigung Büroreinigung Bauendreinigung Glassreinigung Laborreinigung Praxisreinigung Spezialreinigung Teppichreinigung
reinigung360grad.de Reinigung Reinigung Berlin
491 REISEDIENST WITTER: Tolle Reisen. Witter
REISEDIENST WITTER: Tolle Reisen. Viel Vergnügen!
reisedienst-witter.de Witter Reisedienst REISEDIENST
492 Schiek Sports Germany Bodybuilding Schiek
Offizieller Distributor Schiek Sports in Deutschland erhältlich Schiek Sports Schiek Sport Handschuhe
schiek-store.de Schiek Sport Handschuhe
493 Schiek Sports Germany offizieller Schiek
Offizieller Distributor von Schiek Produkten in Deutschland Fitness Bodybuilding Zubehör Fitnesshandschuhe Zughilfen Handgelenkschutz Bandagen
schiek-germany.de Schiek Fitnesshandschuhe Trainingsgürtel
494 HOME
Schulshirt Schulkleidung Schuluniform TShirts PoloShirts Sweatshirts Kapuzenshirts Kleidung Uniform Schule Freizeit Caps
495 Senioren Beratung Berlin Seniorenberatung
Seniorenberatung Berlin
senioren-beratung-berlin.de Seniorenberatung Pflegeheimberatung Neue
496 Datenschutzanalyse externer Datenschutzbeauftragter PrivCom Datenschutz GmbH Datenschutz
Wir organisieren als externe Datenschutzbeauftragte mit DatenschutzAudits Schulungen und Sicherheitstests datenschutzkonforme und sichere Prozesse.
privcom.de Datenschutz Audits Datensicherheit
497 PROMINENTENBAU© Prominentenbau
Erwachsene bauen mit LEGO Elementen für Kinder
prominenten-bau.de Prominentenbau Prominent DAI Lego Hellweg
PME ProBau Management und Entwicklungsgesellschaft mbH
pme-gmbh.de PME ProBau Management Entwicklungsgesellschaft
499 Startseite
Rechtsanwältin Sylvia PfaffHofmann: Ihr Recht in guten Händen! Spezialgebiete: Europarecht Einbuergerungsrecht und Asylverfahrensrecht
500 IOB Internationale OmnibusBetreibergesellschaft ZOB
ZOB Zentraler Omnibusbahnhof Berlin an Funkturm und Messegelände:
iob-berlin.de ZOB Zentraler Omnibusbahnhof Berlin APC
501 Nina Petrick – Autorin Nina
Nina Petrick freie Autorin für Kinder und Jugendbücher Belletristik und Kurzgeschichten. Ihr Jugendbuch
nina-petrick.de Nina Petrick Autorin
502 Digital Innovation Facilitator GuentherLange GmbH digitale
Mit Design Thinking systematisch zu kreativen Problemlösungen für das InternetBusiness: Jens Otto Lange moderiert Ideen
jensottolange.de Digitale Innovation Kreativität
503 Berlinatnight.de :: Stadtmagazin für Musikkalender
NightlifeGuide für Berlin: Clubs Bars Parties Tickets Kinoprogramm Konzerte
berlinatnight.de Musikkalender Movie Genießen
504 Www.djembeberlin.de
Du möchtest die westafrikanische Trommel Djembe spielen lernen. Hier findest du eine Liste von Lehrern
505 Naturheilpraxis im Hofbogen behandlung
Naturheilkunde Praxis Hofbogen Heilung Anwendung Rheuma Therapie Heilpraktiker
hofbogen.de Behandlung Therapie Körper
506 Theater Hans Wurst Nachfahren Grüffelo
Hans Wurst Nachfahren Theater für Kinder und Erwachsene in BerlinSchöneberg zeigt Spielplan
hans-wurst-nachfahren.de Grüffelo Puppentheater Berlin
507 Berliner Berufsverband der Gesundheitsaufseher/Hygieneinspektoren BBGH
Der Berliner Berufsverband der Gesundheitsaufseher/Hygieneinspektoren stellt sich vor und bietet Informationsmaterial rund um den öffentlichen
hygieneinspektoren.de BBGH BVH Hygiene
508 Kanzlei Rechtsanwalt Böcker joomla
Joomla! dynamische PortalEngine und ContentManagementSystem
kanzlei-boecker.de Joomla Joomla
509 ..::Phoenix Lounge::.. Phoenix
Phoenix Lounge. Bar Restaurant Cafe in Schöneberg.
phoenixlounge.de Phoenix Lounge Phoenix
510 Rosenscharf und Edelsüß Catering ZOE
Restaurant ZOE Berlin. Asiatische und mediterrane Küche zwischen Hackeschem Markt und Alexanderplatz in Berlin Mitte.
rosenscharf-edelsuess.de ZOE Restaurant Lounge
511 Tucanu Webseiten leicht Jürgen
tucanu der Weg zur eigenen Homepage leicht zu haben einfach zu bedienen
tucanu.de Jürgen Kubens Beratung
512 Nicolai Thärichen Komponist Arrangeur Thärichens
Nicolai Thärichen Komponist Arrangeur Pianist Aktuelles 2009 Thärichens Tentett Konzerte
thaerichen.de Thärichens Tentett Konzerte Myspace
513 Felicitas Jacobs Theaterpädagogin Theater
Ich biete vielfältige theaterpädagogische Qualifikationen als Ausbildung oder Fortbildung initiiere theatrale Prozesse und entwickle
theaterpaedagogische-kunst.de Theater Pädagogik Spiel
Herzlich willkommen bei der URBANIS GmbH
urbanis-berlin.de URBANIS Berlin Unternehmen
515 Ihre Website erstellen
Alles rund um die Website. Vorkonfiguriert oder maßgeschneidert für lokale Unternehmen aus Dienstleistung Handwerk
516 Studio la voce Sängerin
Stefania Erzmoneit Habsburgerstrasse 5 10781 Berlin fon: 03021 99 68 23 fax:
studiolavoce.de Sängerin Sängerin Klang
517 Home Andrea Schlinkert Queer
Dies ist die Seite von Andrea Schlinkert Tanzlehrerin und Djane in Berlin.
tangoschlampen.de Queer Tango Queer Argentino
518 Willkommen auf der Startseite Tango
Tango Rueda eine Begegnung in vier Takten in Berlin
tangorueda.de Tango Rueda Berlin
519 VIEV | NEW
VIEV – das sind Wagner & Werner ein deutschchilenisches Designerkollektiv aus Berlin.
520 Excelle.consulting | Produktions und excelle.consultin
excelle.consulting bietet kundenindividuelle Lösungen zu Fragen der strategischen Unternehmensentwicklung und der Gestaltung operativer Leistungsstrukturen sowie
excelle.de Excelle.consulting Excelle Excelle.de
521 Wanderreisen Pierolt Wanderreisen
Wanderreisen Pierolt Wandern im Spreewald Hüttenwanderung in den Lienzer Dolomiten Wandern rund
wanderreisen-pierolt.de Wanderreisen Pierolt Wandern Im
522 SammlungsVerkauf coupon
Webdealscout Suche deine Gutscheine Deals und Rabatte
webdealscout.de Coupon Gutschein Geschenk
523 Theo G. Gilbers Sexualpädago
Sexualpädagogische Fortbildung für pädagogische und psychosoziale Fachkräfte
theogilbers.de Sexualpädagoge Und Sexualtherapeut
524 Schmuckmanufaktur Berlin Goldschmiedin Schmuckmanufaktur
Schmuckmanufaktur Berlin Goldschmiedin Schmuck Trendart
schmuckmanufaktur-berlin.de Schmuckmanufaktur Berlin Goldschmiedin
525 LumpenPrinzessin ... Kinderkleidung Kinderkleidung
Die LumpenPrinzessin bietet seit über 15 Jahren Alles für Baby und Kind in gut erhaltener
schuhchen.de Kinderkleidung Kindermode Kinderschuhe
526 Robert Berghoff Berlin robert
Mit einfachem Blick auf die Dinge: Bildgestaltender Kameramann Director Of Photography Cinematographer
robertberghoff.de Robert Berghoff Filme
527 Schuldnerberatung Berlin Schuldenberatung Berlin Schuldnerberatung
â–ș Schuldnerberatung Berlin vom Anwalt Privatinsolvenz Restschuldbefreiung Verbraucherinsolvenz Schuldenberatung Verbraucherinsolvenzverfahren. Rechtsanwalt Pillig Berlin
restschuldbefreiung.de Schuldnerberatung Berlin Privatinsolvenz Restschuldbefreiung Schuldenberatu
528 HOME
Schulshirt Schulkleidung Schuluniform TShirts PoloShirts Sweatshirts Kapuzenshirts Kleidung Uniform Schule Freizeit Caps
529 Home – Goldschmiede Schmuckbotschaften
Goldschmiede Schmuckbotschaften aus Berlin entwirft individuellen Schmuck!
530 Startseite
Anwälte & Steuerberater PSInkasso
531 Gabriele Steiner Praxis für Ärztin
Gabriele Steiner Praxis für Homöopathie am Winterfeldtplatz in BerlinSchöneberg Ärztin für Allgemeinmedizin
steiner-gabriele.de Ärztin Homöopathie Homoeopathie
532 Stephan Szasz Startseite Über
Ich bin Stephan Szasz aus Berlin und erzähle euch auf dieser Webseite ein paar Geschichten
stephan-szasz.de Über Mich Hobby
533 Patwork
534 52. DeutschFranzösisches Volksfest Schaustellerverband Berlin e.V. Deutsch
Das mit Abstand größte jährliche Volksfest in Berlin Willkommen auf über 40.000mÂČ Erlebnisfläche!
volksfest-berlin.de Deutsch Französisches Volksfest Laune
535 Apartment Dr. Claudia Malzfeldt
536 Wirtschaftsmediatoren Berlin Wirtschaftsmediat
Wirtschaftsmediatoren Berlin
wirtschaftsmediatoren-berlin.de Wirtschaftsmediator Mediator Madiation Spannagel Eckolt
537 Home Musik
Kinderlieder Wir Kinder vom Kleistpark gute Musik für Kinder Konzerte für Kinder
wirkindervomkleistpark.de Musik Für Kinder Kinderkonzerte
538 Ölmühle Berlin Olivenöl
Olivenöl aus der ölmühle Berlin Schöneberg. Bei uns finden Sie ein Sortiment von über 60 meist
xn--lmhleberlin-qfb4f.de Olivenöl Olivenholz Balsamico
539 Home
Sachverständiger von der Handwerkskammer Berlin öffentlich bestellter und vereidigter Sachverständiger für das Dachdeckerhandwerk Steildacheindeckungen
540 Brautkleider alles für Kalamov und Kalamova GbR
Bei uns finden Sie moderne und günstige Brautkleider Abendmode Accessoires Dessous. Schneller
541 Anke Sevenich | Schauspielerin
Anke Sevenich gehört zu den besten wenn auch eher unauffälligen Schauspielerinnen des deutschen Fernsehens
542 Restaurant AltÖsterreich Startseite Restaurant
Restaurant AltÖsterreich heißt: Echtes Wiener Schnitzel duftende Frittatensuppe eine ordentliche Portion Kaiserschmarrn oder
alt-oesterreich.de Restaurant AltÖsterreich Alt
543 Startseite Queer
Musikversierte und begeisterte Djane mit breitgefächertem Musikrepertoire für jegliche Anlässe buchbar. Ob Standard und Lateinmusik
andrea-schlinkert.de Queer Tango Queer Argentino
544 Welcome to Berlin Gym aktiv
Auf diesen Seiten findet Ihr alle Informationen rund um den Verein Berlin Gym – Verein
berlin-gym.de Aktiv Fitness Kampfsporttraning
545 Berliner Berufsverband der Gesundheitsaufseher/Hygieneinspektoren BBGH
Der Berliner Berufsverband der Gesundheitsaufseher/Hygieneinspektoren stellt sich vor und bietet Informationsmaterial rund um den öffentlichen
bhbbev.de BBGH BVH Hygiene
546 Bing Ma Communication China
Neue Seite
bingma.de China Business Marketing
547 Schreibcoaching in Berlin Schreibcoaching
Schreibcoaching: Sie schreiben gerade an einer wissenschaftlichen Abschlußarbeit? Bringen Sie sich mit Schreibcoaching wieder in
faden-verloren.de Schreibcoaching Wissenschaftliche Abschlussarbeit
548 Ferienhaus Wittingen
Ferienhaus Wittingen
549 Organisationsberater Berater für Bio
Unternehmensberater für Ökologische Landwirtschaft (Biolandbau) und Biomarkt (Biohandel) – Experte für Bio Lebensmittel und Biolandbau
consultantorganictrade.de Bio Lebensmittel Bioprodukte
550 Home
Brandenburger Tor Variationen mit FotoGalerie TorVariationen Brandenburg Berlin Logo
551 Floorwalker.de Einfach. Schnell. floorwalker
Ein Floorwalker bietet nicht nur bei der Einführung neuer Software effektiven Support sondern auch
floorwalker.de Floorwalker Floorwalking Office
552 FHING Aktuell Werbung
für heute ist nichts geplant
fhing.de Werbung Postkarte Schwul
553 Restaurant AltÖsterreich Startseite Restaurant
Restaurant AltÖsterreich heißt: Echtes Wiener Schnitzel duftende Frittatensuppe eine ordentliche Portion Kaiserschmarrn oder
diodata-restaurant.de Restaurant AltÖsterreich Alt
554 Startseite House of House of Queer Sisters e.V. Queer
Wir sind Sisters und Guards die Gutes tun und dies überall wo wir gebraucht
house-of-queer-sisters.de Queer Sisters Schwulen
555 OnlineShop Bastelkits. Made
Wir haben ein Kit entwickelt mit dem man gleich loslegt in dem gute
556 Linda Sixt Linda
Linda Sixt
linda-sixt.de Linda Sixt
557 Lofts & Co. Lofts & Co. GmbH lofts
Lofts & Co. Best in Lofts!
loftsandco.de Lofts Berlin Dachwohnung Berlin
558 Antiquariat Mertens und Pomplun Antiquariat Mertens & Pomplun GbR Antiquariat
Antiquariat antiquarische Bücher OriginalPhotographien Fotografie Plakate Landkarten Luxuspapier
mp-rarebooks.de Antiquariat Antiquarische Bücher
559 MR Patterns Willkommen Nähen
Mr Patterns das Schnittstudio fuer SelberMacher
mrpatterns.de Nähen Schnittmuster Schnittkurs
560 Psychotherapie und Coaching in
Sie suchen einen Psychotherapeuten oder Coach in Berlin? Sie sind in einer schwierigen privaten oder
561 Gaastra Napapijri Diesel online Markenmode
Fashiontex 24 Online Shop. Ihr Designer Online Shop mit Markenbekleidung wie Gaastra Jacke Poloshirt
fashiontex24.de Markenmode Gaastra Napapijri
562 Heilpraktikerin in Berlin Schöneberg Homöopathie
Isabel Blume Heilpraktikerin Klassische Homöopathie und Shiatsu in Berlin
isabel-blume.de Homöopathie Klassische Homöopathie
563 Http://www.KinderladenKonfetti.de
Mitten im Schöneberger Winterfeldtkiez in Berlin liegt der kleine bunte Kinderladen Konfetti. Zwei Erzieherinnen
Die MUTTER in Berlin Schöneberg bietet vom Frühstück im Außenbereich thailändischer Küche und Cocktails
mutter-berlin.de Thai Bar Berlin Thaifood Frühstück
565 Zuhause Mundgerecht Magazin Save
MUNDGERECHT ist mehr als nur ein Magazin. Eigentlich sind wir ein soziales Startup mit einer
mundgerecht-magazin.de Save Food Nachhaltiges Essen
566 Home Siebergraphic Siebergraphic Berlin
siebergraphic macht die Grafik für Sie in Berlin Nürnberg und Umgebung. Egal was
siebergraphic.de Berlin Grafik Illustration
567 Schlüsseldienst Tempelhof Endpreise direkt Schlüsseldie
Günstiger Schlüsseldienst für Tempelhof. Probleme mit Ihrem Türschloss? Kein Problem. Wir helfen kostengünstig schnell
schluesseldienst-tempelhof-berlin.de Schlüsseldienst Tempelhof Ihr Schlüsseldienst
568 StoppRitalin | Die ScherretMethode Wachstumsstö
Bei immer mehr Kindern und Jugendlichen in Deutschland stellen Ärzte Aufmerksamkeits und Hyperaktivitätsstörungen fest.
stopp-ritalin.de Wachstumsstörungen ADHS Ritalin StoppRitalin ScherretMethode
569 HOME
570 Wellfina Wellness Fitness Naturheilkunde
Angebot: Personal Training Ernährungsberatung Mesotherapie (Anti Aging) Kinesiologie Neuraltherapie Schröpfen
wellfina.de Naturheilkunde Heilpraktiker Personaltraining

Ergebnisse der Bewertung der Themenseite zu Neueröffnungen, verkaufsoffene Sonntage, Gutscheine und Coupons in Berlin
35 Bewertungen ergeben 3 StadtBranche Punkte

Berlin ist die Bundeshauptstadt der Bundesrepublik Deutschland und zugleich eines ihrer LĂ€nder. Die Stadt Berlin ist mit rund 3,5 Millionen Einwohnern die bevölkerungsreichste und mit 892 Quadratkilometern die flĂ€chengrĂ¶ĂŸte Gemeinde Deutschlands sowie nach Einwohnern die zweitgrĂ¶ĂŸte der EuropĂ€ischen Union. Sie bildet das Zentrum der Metropolregion Berlin/Brandenburg und der Agglomeration Berlin . Der Stadtstaat unterteilt sich in zwölf Bezirke. Neben den FlĂŒssen Spree und Havel befinden sich im Stadtgebiet kleinere FließgewĂ€sser sowie zahlreiche Seen und WĂ€lder.

LandkreisKreisfreie Stadt Berlin

Berlin Karte

Berlin Karte Kreisfreie Stadt Berlin Berlin Berlin Stadtplan Kreisfreie Stadt Berlin Berlin