Ort

Berlin › Kreisfreie Stadt Berlin › Berlin

Branchenbuch Berlin 10789 Berlin

Kreisfreie Stadt Berlin
Berlin (Gemeinde in Berlin) gilt als Großstadt / Metropole in Berlin. Berlin als Kreisfreie Stadt hat 3.501.920 Einwohner.
1 Matratzen Matratzen

10787
Berlin
Karibian verkauft bereits seit 1998 in sieben Ländern erfolgreich Premium Matratzen und produziert jährlich mehr als 65000 Schlafeinheiten. Bei..
karibianhome.de/ Wunschliste Kaltschaum Federkern Naturlatex Matratzen Gel Visco Produkte
2 Stagerockers Kommunikation

10963
Berlin
Stagerockers.de bringt mehr als die meisten zeitraubenden Seminare. Nutze unsere sofort anwendbaren Tipps & Tricks. Für Deine..
stagerockers.de/ Hörbuch Video Seminar Training Storytelling Coaching Präsentation Coach
3 ReproBerlin GmbH Digitaldruckerei &

10623
Berlin
ReproBerlin ist Ihre Digitaldruckerei und Copyshop in der Hardenbergstraße 7 in 10623 Berlin Charlottenburg Mo-Fr 9:30-18:30, Sa 11:00-16:00..
reproberlin.de Berlin Charlottenburg Digitaldruckerei Copyshop Mo Fr Sa Repro
4 Personalberatung Personalvermittlung

10715
Berlin
HSC Personalmanagement ist Ihre Personalberatung wenn es um die Personalsuche von Fach- und Führungskräften geht. Unsere Headhunter..
hsc-personal.de Personalberatung Headhunter Search Unternehmen Executive Kandidaten Führungskräfte Personalvermittlung
5 No3 Schinkelplatz Apartments

10117
Berlin
Luxus Serviced Apartments in Berlin-Mitte..
no3-schinkelplatz.com/ Schinkelplatz Residence No Berlin Residences Townhouse Superior Residenzen
6 Sophie Brand Studio Fotograf

13055
Berlin
Sophie Brand Studio: Mietstudio in Berlin der Fotografin Sophie Brand mit zwei wunderschönen und individuellen Locations mit..
sophiebrand-studio.de/ Berlin Tageslicht Sophie Brand Fotostudio Vorlieben Studio Arrayis
7 Sophie Brand Photography Photography

14057
Berlin
Emotionale, ausdrucksstarke & kreative Mode- & Portraitfotografie für Schauspieler*innen, Musiker*innen, Persönlichkeiten sowie für Firmen, Unternehmer*innen und Powerfrauen...
sophiebrand.de/ Safari Brand Individualität Deine Photography Bildern Fotografin Stärke
8 Naturheilpraxis Shop Gesundheits Online

10435
Berlin
Sie möchten Ihre Gesundheit aktiv unterstützen und Nahrungsergänzungsmittel kaufen – legen aber hohen Wert auf Qualität und..
naturheilpraxis-shop.de Ly Bewertung Reg Bewertungen Dateget Hook Adresse Mail
9 Berliner Immobiliengutachter Immobiliengutachter

12107
Berlin
Mit uns haben Sie einen zuverlässigen und fachkundigen Immobiliengutachter in Berlin. Alle Sachverständigen im Team agieren frei..
berliner-immobiliengutachter.de/ Sans Cuse Helvetica Segoe Arial Lucida Not Prefetchable
10 Dauerhafte Laser-Haarentfernung Berlin Schönheit &

10709
Berlin
Amara – Aesthetic- & Laserlounge ist ihr kompetenter und professioneller Ansprechpartner für dauerhafte Laser-Haarentfernung, apparative Kosmetik sowie..
amara-berlin.de Laser Haarentfernung Behandlung Haut Berlin Haare Amara Wellenlänge
11 Max Blinker E-roller

10827
BERLIN
Wir bieten Ihnen Elektroroller in höchster Qualität sowie autorisierten und bequemen Service überall. Wir lieben eine nachhaltige..
maxblinker.de/de/
12 meltus Studio Grafik

12681
Berlin
Sie suchen ein individuelles Bild mit dem Sie Ihr Produkt in den Vordergrund bringen können? meltus Studio..
meltus.de Studio Gallery Contact All Services Illustrations Product Visuals
13 Kaspar-Umzüge GmbH Umzugsunternehmen

10829
Berlin
Ein Umzug ist Vertrauenssache. Für einen sicheren und reibungslosen Umzug gibt es keine zweite Chance. Höchste Sorgfalt..
kaspar-umzuege.de Berlin Umzug Kaspar Umzüge Angebot Umzugsunternehmen Kontakt Mail
14 Quaabo Weiterbildung Berufskraftfahrer Weiterbildungen

10365
Berlin
Quaabo bildet seit 13 Jahren Berufskraftfahrer aus. (Weiterbildungen für Lkw-Fahrer & Busfahrer - Modul 95) Wir sind dazu..
quaabo.de Ausbildung Berufskraftfahrer Cookie Weiterbildung Quaabo Website Modul Informationen
15 Detektei Fahtz Berlin Detektei

14089
Berlin
Privatdetektei & Wirtschaftsdetektei Wir bieten unseren Mandanten seit mehr als über 20 Jahren seriöse und erfolgreiche Informationsbeschaffungen..
detektei-fahtz.de Berlin Detektei Privatdetektiv Mulifont Fahtz Anliegen Privatdetektive Unsere
16 Miteinander wachsen - Familienbegleitung Krabbelgruppe

12045
Berlin
Familienbegleitung Miteinander wachsen Berlin ich begleite engagierte und undogmatische Eltern, die sich für eine bedürfnisorientiere Erziehung interessieren und gleichzeitig..
miteinanderwachsen.org Eltern Kind Meine Shop Kontakt Leistungen Menü Gruppen
17 Sabayking Thai Massage Tempelhof Massage

12347
Berlin
Sabayking befindet sich direkt bei McFit in Berlin-Tempelhof und bieten Ihnen in unserer Wellnessoase ein in Deutschland..
thaimassage-tempelhof.de Massage Thai Sonnenstudio Berlin Tempelhof Sabayking Exklusive Sportmassage
18 Miteinander wachsen - Familienbegleitung Krabbelgruppe

12045
Berlin
Familienbegleitung Miteinander wachsen Berlin ich begleite engagierte und undogmatische Eltern, die sich für eine bedürfnisorientiere Erziehung interessieren und gleichzeitig..
miteinanderwachsen.org Eltern Kind Meine Shop Kontakt Leistungen Menü Gruppen
19 Sibolab UG Atemgastest Zur

10435
Berlin
Manche Krankheiten kann man riechen. Ein leicht süßlich-fruchtiger Acetongeruch etwa deutet beispielsweiße auf Diabetes, ein Ammoniakgeruch auf..
sibolab.de Arrayfrom Type Start Mathmin Untersuchung Sibo Reizdarm Sibolab
20 Dipl. Psych. Justyna Menke - Beratung Supervision Beratung

10715
Berlin
Supervision, Beratung, Elterncoaching, Hochbegabung, psychologische Beratung, Life Coaching, Outdoor Coaching, Business Coaching, Begabtenberatung, walk-and-talk-Coaching in Berlin..
justyna-menke.de Libre Post Bookings Blog Booking Objectassign Baskerville Stylable
21 Sparrks Business Coaching

10435
Berlin
Sparrks wurde 2021 als Berliner Start-Up ins Leben gerufen. Sparrks bietet eine selbstentwickelte B2B Coaching Plattform, die..
sparrks.io/ Coaching Sparrks Business Coaches Manrope Themen Unternehmen Mitarbeitenden
22 Berliner Fotoladen Fotoladen

13581
Berlin
Bei uns von IDEAL TREND finden Sie alles aus den Bereichen Bilderrahmen, Fotoalben und Kamerazubehör. Besuchen Sie..
berlinerfotoladen.de/ Important Bilderrahmen Fotouhren Kamerazubehör Kategorie Ihrem Versand Fotoalben
23 Matze Umzüge Services

13403
Berlin
Fühlen Sie sich festgefahren und fragen sich, wie Sie da rauskommen? Kein Grund zur Sorge; Rufen Sie..
matze-umzuege.de/ Sans Prefetchable Not Umz Awesome Matze Berlin Umzüge
24 Tante Emma Shop Online Lebensmittel

16321
Bernau bei Berlin
Kennst Du mich noch? Ich bin es, Tante Emma. So wie du erwachsen geworden bist habe auch ich..
tanteemma.io/ Tante App Emma Du Dir Dich Kontakt Store
25 Handwerker-Berlin365 Allround-Handwerker

12359
Berlin
Meine Dienstleistungen werden im Raum Berlin und Umland angeboten. Die Arbeitszeit liegt im Zeitfenster zwischen 7.30 Uhr..
handwerker-berlin365.de Berlin Handwerker Speicherung Böden Art Zugriff Zustimmung Zweck
26 DIE WELTBERÜHMTE REIBE AUS FINNLAND Handwerkliche Küchen

12159
Berlin
Anckeramic® Küchen Utensilien 100% handgefertigte Ceramico keramikreiben aus Finnland. Darunter Muskatnussreibe, Knoblauchreibe, Ingwerreibe, Parmesanreibe, Zitruspresse, Kaffeefilter-Halter..
anckeramic.de/ Fbw Text My Cormorant Helvetica Blog Ri Ligh
27 Strategieberatung Juliane Heinroth Unternehmensberatung

12435
Berlin
Positionierung, Strategie-Entwicklung & Kommunikation für kleine & mittelständische Unternehmen | Beratung, Workshops, Trainings & Umsetzungsbegleitung..
juliane-heinroth.de Mitarbeiter Menü Angebot Kommunikation Erstgespräch Kostenfreies Strategieberatung Kontakt
28 Zahnarztpraxis Spreekrone Zahnarzt

13509
Berlin
Willkommen in der Zahnarztpraxis Spreekrone Berlins Zahnspezialisten für die ganze Familie Moderne Zahnmedizin in entspannter Atmosphäre – kein Gegensatz..
spreekrone.de/ Zahnarzt Berlin Reinickendorf Praxis Termin Spreekrone Zahnarztpraxis Kontakt
29 DachProfi Berlin Services

10243
Berlin
Dachdecker ist ein Unternehmen in Berlin, das erstklassigen Service und Reparaturen für Dächer von Häusern und Gebäuden..
dachprofi.berlin/ Berlin Dach Dachdecker Ihr Wärmedämmung Dachbeschichtung Angebot Kontakt
30 LeadMarkt.ch Kostenloser Lead-Generator mit automatisierter Werteinschätzung Immobilien

12043
Berlin
Benutzerfreundlicher Leadgenerator für Makler & Werbeagenturen - prozessoptimiert durch mehrfache A/B-Tests. Geräteübergreifend, einfach & schnelle Integration in..
leadmarkt.ch/ Lead Leads Generator Immobilienbewertung Makler Minuten Immobilien Immobilienbewertungen
31 Tageslichtlampe Medizin

10715
Berlin
Tageslichtlampe Test – Die besten Tageslichtleuchten zur Lichttherapie Tageslichtlampen haben mittlerweile gut Fuß auf dem deutschen Markt gefasst..
tageslichtlampetest.com/ Tageslichtlampe Lux Lampe Beurer Test Tageslichtleuchten Philips Tageslichtleuchte
32 Praxis für systemische Therapie und Beratung Psychotherapie

14169
Berlin
Systemische Einzel-, Paar-, Familientherapie und Beratung, Traumafachberatung und Craniosacrale Körpertherapie...
praxis-benter.de Heilpraktikerin Berlin Sonja Benter Beratung Therapie Cranio Biodynamik
33 Hotel Dorint Kurfürstendamm Berlin Hotel

10789
Berlin
Die preisgekrönte Architektur von Jan Kleihues, spektakuläre Kunst von Lüpertz, Toscanelli & Kampmann sowie die einzigartig aufstrebende..
hotel-berlin.dorint.com/de
34 Hotel Essential by Dorint Berlin-Adlershof Hotel

12489
Berlin-Adlershof
hotel-berlin-adlershof.dorint.com/de
35 Leadership Coaching München Coaching

10437
Berlin
Jeder Mensch ist anders. Individualität macht uns aus, das Leben spannend und lebenswert und stellt uns gleichzeitig oft..
leadership-coaching-muenchen.com/ Coaching München Leadership Eich Unternehmen Lioba Mitarbeiter Work
36 Sabayking Thai Massage & Wellness Charlottenburg Thai Massage

14059
Berlin
Sabayking ist Ihr exklusives Thai Massage und Wellness Studio in Berlin-Charlottenburg. Wir bieten Ihnen eine vielfalt an..
sabayking-thaimassage.de Massage Schmerzen Massagen Thai Unsere Stress Sabayking Muskeln
37 Maticz Technologies Software Development

26944
Berlin
Maticz is a Top Blockchain Development company in India that aims to help Fintech and other businesses..
maticz.com/ Development We Get Maticz Software Our Demo Web
38 Kunsttherapie | Ernährungsberatung | Innere Stärke Kunsttherapie und

10243
Berlin
Meine Grundhaltung: Meine Arbeit ist geprägt von der Wertschätzung für die jeweilige Familie, hochgradigem Einfühlungsvermögen in die aktuelle..
kunsttherapie-berlin.art/ Wnfo Text Wnf My Book Bookings Post Profile
39 Fahrschule Performance Tegel Fahrschule

13507
Berlin
Herzlich willkommen in der Performance-Fahrschule Filiale Berlin Tegel. Wir bilden in folgenden Klassen aus: Führerscheinklasse für PKW:..
performance-fahrschule.de Redirect Webkit Moz Khtml Homepage
40 LOVE DESTINATION Events - Pia Etzold Hochzeitsservice

10409
Berlin
Ich bin Hochzeitsplanerin & Event Designerin und plane Hochzeiten in Berlin und ganz Europa. Von den ersten..
lovedestination.events/ Luxes La Script Belleza Destination Berlin Tag Planung
41 Hire a Doctor Group Ärztevermittlung

10405
Berlin
Als Personaldienstleister im Gesundheitswesen vermittelt die Hire a Doctor Group medizinisches/pflegerisches Fachpersonal für Vertretungen in Gesundheitseinrichtungen und..
hireadoctor.de/ Cookie Website Doctor Hire Group Teams Informationen Unsere
42 Familiesportrait Portrait Zeichnen

10179
Berlin
Lass dein Foto professionell von uns zeichnen oder dein Bild malen lassen. Wir erstellen eine atemberaubende Zeichnung..
familiesportrait.de/products/portrait-zeichnen-lassen Farbe Foto Bleistift Fotovorlage Bleifstiftzeichnung Bild Portrait Offer
43 Majori Systems GmbH Informationstechnik

10557
Berlin
Majori Systems ist Ihr reliabler Kooperationspartner, bei allen Fragen rund um das Thema Microsoft 365. Mit unseren..
bertha-benz straße 5
44 COMPANIFY Franchiseberatung Unternehmensberatung Strategieberatung

10117
Berlin
Mit Franchisesystemen erfolgreich wachsen. COMPANIFY Franchiseberatung Berlin hilft Unternehmen und Gründern, die ein eigenes Franchisesystem aufbauen wollen. Ein..
companify.de/ Franchise Cookie Google Informationen Website Berlin Firmensitz Standort
45 Dreipeo - Die Hundeschule und Hundephysiotherapie Hundetraining Hundephysiotherapie

14050
Berlin
Hallo liebe/r Hundehalter/in! Mein Name ist Andrea Popp und ich bin zertifizierte Hundeerzieherin und Verhaltensberaterin (IHK Potsdam) mit..
dreipeo.de/ Hund Minuten Training Listenelement Link Element Befunderhebung Therapie
46 Hochdruckreiniger Testsieger Einkaufen

12685
Berlin
Dieser neue Ratgeber informiert seine Leser über die neusten Anbieter und Testberichte von Hochdruckreinigern...
hochdruckreinigers-testsieger.de/ Testsieger Hochdruckreiniger Alle Blick This Stringfrom Arrayflag
47 Hochdruckreiniger Testsieger Einkaufen

12685
Berlin
Dieser neue Ratgeber informiert seine Leser über die neusten Anbieter und Testberichte von Hochdruckreinigern...
hochdruckreinigers-testsieger.de/ Testsieger Hochdruckreiniger Alle Blick This Stringfrom Arrayflag
48 Rümpelgenie Cleaning

13156
Berlin
Wenn Sie in Berlin oder Umgebung wohnen und persönliche Hilfe bis hin zu Entrümpelungen oder Umzügen benötigen..
ruempelgenie.de/ Sans Montserrat Entrümpelung Berlin Rümpelgenie Service Cuse Entsorgung
49 Unicoaching-Berlin Wissenschaftscoaching

12157
Berlin
Bei jedem Arbeitsschritt auf dem Weg zur fertigen Masterarbeit werden Sie von kompetenten Wissenschaftlern begleitet. Wir leiten..
unicoaching-berlin.de/wissenschaftliches-coaching/masterarbeit/ Coaching Hilfe Seite Dissertation Forschung Wissenschaftliches Lektorat Qualitative
50 Agas Immobilien GmbH Immobilien

10115
Berlin
Herzlich Willkommen bei Ihrem Maklerbüro Agas Immobilien! Wir helfen Ihnen bei allen Belangen rund um Ihr jetziges..
agas-immobilien.de Berlin Immobilien Vermarktung Ort Ihr Agas Mwin Unsere
51 Wüstentouren wüstenreisen kameltrekking marokko Marokkoreisen

10369
Berlin
UNSERE ANGEBOT DES JAHRES 2022 – 6 für 5 Wenn Sie als Gruppe bei uns für sechs Personen..
wuestenperle.com Wuestenperle Marokkoreisen This Stringfrom Arrayflag Fwuestenperlecom Fgebirgstour Type
52 Abschleppdienst Krause Abschleppdienst

10961
Berlin
Einer der besten und zuverlässigsten Abschleppdienste in ganz Deutschland ist Krause Abschleppdienst. Wir bieten Abschleppdienste in allen..
abschleppdienst-krause.de/ Sans Abschleppdienst Berlin Krause Cuse Ihr Website Service
53 hellseher-magier.com Lebensberatung

88662
Überlingen
Alles begann in Transsilvanien, im Herzen Rumäniens. Dort, wo Bram Stoker seine Inspiration holte und mit Vlad..
hellseher-magier.com/grandmaster-der-magie-ueber-mich Containerhtkcinline Ich Post Blog Objectassign Video Rumänien Captcha
54 Praxis für Homöopathie in Berlin Treptow Gesundheit

12437
Berlin
Diese Praxis für klassische Homöopathie liegt im ruhigen Baumschulenweg in Berlin. Die Heilpraktikerin behandelt hier in Treptow-Köpenick..
naturheilpraxis-homoeopathie-berlin.de Homöopathie Berlin Behandlung Details Heilpraktiker Praxis Treptow Köpenick
55 Praxis für Integrative Lerntherapie Margret Bradfield Lerntherapie

12103
Berlin
Hilfe beim Lesen, Schreiben und Rechnen bei einer LRS und Dyskalkuli...
lerntherapie-bradfield.de Cookie Lerntherapie Consent Praxis Lese Integrative These The
56 Euer Trauredner: Markus Lemke | Freie Hochzeitsredner

10245
Berlin
freietrauungberlin-markuslemke.de/ Trauung Markus Trauredner Berlin Hochzeit Trauzeremonie Lemke Freie
57 Mobile Hundeschule Fellkumpelz Berlin Brandenburg Hundeschule

12437
Berlin
Mein Name ist Tobias von den Fellkumpelz. Ich bin Hundeerzieher und Verhaltensberater mit IHK/ BHV Ausbildung und Abschlusszertifikat. Ich..
fellkumpelz.de Sans Open Hund Tobias Oswald Uv Training Fellkumpelz
58 Rechtsanwalt Uwe Heichel Rechtsanwalt

10587
Berlin
Rechtsanwalt Uwe Heichel in Berlin Charlottenburg-Wilmersdorf Das Immobilienrecht in Deutschland ist sehr komplex. Es wird beeinflusst von diversen..
rechtsanwalt-heichel.de Heichel Berlin Uwe Rechtsanwalt Feld Dieses Charlottenburg Wilmersdorf
59 Dave Brice Handy Jammer

10115
Berlin
jammer-store.de ist ein Störsender-Großhändler mit mehr als 15 Jahren Berufserfahrung, den Kunden die professionellsten Lösungen. https://www.jammer-store.de/WLAN-bluetooth-storsender.html..
jammer-store.de/ Störsender Antennen Signal Handy Handheld Bänder Wi Jammer
60 030 Immobilienbewertung Immobilienbewertung

10179
Berlin
Wir sind Ihr Ansprechpartner für eine unabhängige Immobilienbewertung in Berlin und Umgebung. Unsere Experten bieten dabei Gutachten..
030-immobilienbewertung.de/ Sans Cuse Awesome Helvetica Prefetchable Lucida Not Csvg
61 Dachdeckerei Briegmann Dachdecker

13409
Berlin
Wir von der Dachdeckerei Briegmann sind sowohl für Privatkunden als auch für Unternehmen, Architekten und öffentliche Auftraggeber..
dachdeckerei-briegmann.de/ Briegmann Dachdeckerei Berlin Dach Meisterbetrieb Kontakt Dachdeckermeister Team
62 June Six Hotel Berlin City West Hotel

10623
Berlin
Bohèmeflair, Künstlertreff, Institution im Nachtleben – der Berliner Savignyplatz ist der Hotspot in City West. In diesem..
june-six-hotels.com/hotels/berlin-city-west/ June Six Hotel Zimmer City Berlin West Uhr
63 IKARUS Steuerberatung in Berlin und Dessau Steuerberaterin

10963
Berlin
Wir sind Ihr zuverlässiger Steuerberater und decken sämtliche steuerrechtlichen Aspekte Ihres Unternehmens ab. Dazu gehören alle steuerrechtlichen..
ikarus-steuerberatung.de/ Steuerberatung Berlin Dessau Bettina Höll Steuerberaterin Lohnbuchhaltung Arial
64 Psychologische Praxis Zehlendorf | Psychotherapie & Psychotherapie

14167
Berlin
Die Psychologische Praxis Zehlendorf besteht aus einem Team hochqualifizierter Psychologen, Psychotherapeuten (HeilprG), Paartherapeuten und Hypnosetherapeuten. Unsere Praxis..
psychologische-praxis-zehlendorf.de Psychologische Praxis Zehlendorf This Stringfrom Arrayflag
65 EastSeven Hostel Berlin Hostel

10119
Berlin
EastSeven Hostel in Berlin - Du suchst nach einem gemütlichen Hostel in Berlin? Freue dich auf..
eastseven.de Sans Gothic One Berlin Prenzlauer Berg Hostel Segoe
66 Berliner Bausachverständiger Bausachverständiger

10179
Berlin
Wir sind Ihr zuverlässiger Bausachverständiger und Baugutachter in Berlin. Unser Team bestehend aus Spezialisten begleitet Sie bei..
berlin-bausachverstaendiger.de/ Sans Cuse Awesome Lucida Not Prefetchable Helvetica Berlin
67 Davinci Medic Ästhetische Medizin

10409
Berlin
Bei Davinci Medic Berlin stehen Sie als Patient im Mittelpunkt. Wir bieten Ihnen modernste wissenschaftlich fundierte Therapieverfahren..
davincimedic.de/ Tattooentfernung Berlin Eingewachsener Medic Zehnagel Entfernung Davinci Speicherung
68 Interior Studio Isabella Hamann Innenarchitektur

14057
Berlin
ELEGANTE HIGHLIGHTS FÜR JEDES INTERIOR Interior Studio Isabella Hamann bietet individuelle Planungen die auf die Bedürfnisse der..
ih-interiorstudio.com/ Giobagnara Leder Farbe Farben Designs Wildleder Materialien Italien
69 Zauber-Engel Zauberei mit Herz und Humor Künstler

13503
Berlin
Professionelle Zauberkunst Charmant, sympathisch, individuell Für alle Anlässe im Raum Berlin Brandenburg..
zauber-engel.de Berlin Zauberer Brandenburg Magie Ich Gäste Hochzeit Art
70 Wikinger Umzüge Umzüge

12053
Berlin
Es stehr ein Umzug wn und Sie benötigen professionelle Unterstützung von einer UMzugsfirma bei ihrem Umzug? Dann..
wikinger-umzuege.de/ Berlin Umzug Wohnungsauflösung Möbel Leistungen Umzugsunternehmen Umzüge Kontakt
71 BB Fliesen - Fliesenleger Berlin Handwerk

10115
Berlin
bb-fliesen.de Apx Fliesen Amin Berlin Mosaik Details Planung Prefetchable
72 Work-Life-Balance Coaching

14165
14165 Berlin
Alle meines Coachings (Coaching für Führungskräfte, NLP-Kompaktkurs, Onlinekurse uvm.) zielen darauf, dich dabei zu unterstützen, deine Probleme..
work-life-balance-berlin.de Work Life Balance Coaching Berlin Online Coach Condensed
73 Dehler Coaching Coaching

10117
Berlin
Ich setze alles darauf an, das Potenzial meiner Klientinnen und Klienten voll auszuschöpfen und dabei Ideen zu..
dehlercoaching.de/ Coaching Berlin Dehler Business Ursula Coach Konfliktmoderation Führungskräfte
74 Rohr-Frei Berlin Rohrreinigung

10117
Berlin
Als Firma für Rohrreinigung in Berlin sind wir Ihr seriöser und erfahrener Ansprechpartner. Mit unserem Notdienst sind..
rohr-frei-berlin.de/ Sans Rotate Franklin Fade Blur Frei Zoom Roll
75 Odontik Odontik

12099
Berlin
Ihr Zahnarzt in Tempelhof VON PROPHYLAXE BIS ZAHNERSATZ Unser professionelles Team freut sich auf Ihren Besuch in unserer Zahnarztpraxis..
odontik.de/ Tempelhof Zahnarzt Stefanos Baraliakos Uhr Damm Unser Tempelhofer
76 Odontik Odontik

12099
Berlin
Ihr Zahnarzt in Tempelhof VON PROPHYLAXE BIS ZAHNERSATZ Unser professionelles Team freut sich auf Ihren Besuch in unserer Zahnarztpraxis..
odontik.de/ Tempelhof Zahnarzt Stefanos Baraliakos Uhr Damm Unser Tempelhofer
77 Resilienztraining Online Coaching

10711
Berlin
Viele neue Führungskräfte jonglieren am Anfang damit, plötzlich nicht mehr Team-Mitglied zu sein, sondern in der Rolle..
resilienztraining.online Reimann Resilienztraining Resilienz Führungskräfte Training Alexandra Mitarbeiterinnen Herausforderungen
78 Valera Medizinisches Kleintierzentrum Berlin Tierarzt

14163
Berlin
Valera – Medizinisches Kleintierzentrum ist ein tierärztliches Behandlungszentrum für Kleintiere. In unserem Standort in Berlin Zehlendorf beschäftigen..
valera.vet Product Tock Berlin Kleintierzentrum Team Medizinisches Tierarzt Menü
79 Ku´Damm 101 Design-Hotel Berlin Hotel

10711
Berlin
kudamm101.com/
80 apprime GmbH | App Agentur Berlin App Entwicklung

10405
Berlin
Die App Agentur apprime GmbH aus Berlin bietet native iOS App und Android App Entwicklung, sowie hybride..
apprime.de App Sans Cookie Google Entwicklung Name Mobile Informationen
81 Berliner KFZ Gutachter KFZ Gutachter

10115
Berlin
Wir sind Ihr unabhängiger KFZ Gutachter in Berlin für fundierte Gutachten. Bei einem Unfall oder Schaden an..
berliner-kfzgutachter.de/ Cuse Lucida Prefetchable Not Helvetica Gutachter Auto Sans
82 Beschriftungen Druckerei Werbetechnik

12621
Berlin
Siebdruck, Museumsbeschriftung, Digitalisierung, Digitaldruck, Plattendruck, Kunstdruck, Folierung, Objektbeschriftung, Beschilderung, Schilder, Leitsysteme, datenbearbeitung, Fotodruck, Scans, Repros, Holzdruck..
heerlein-werbetechnik.de
83 Gon joy Africa - Ihr Afrika-Reisespezialist Reiseveranstalter

10318
Berlin
Gon joy Afrika - Ihr Afrika-Reiseveranstalter garantiert Ihnen authentische Begegnungen und erfahrene Guides. Wir sind mit Expertenwissen..
gonjoy-africa.de Reisen Afrika Safaris Africa Safari Go Tansania Kenia
84 PRIMEROS Erste Hilfe Kurs Berlin Friedrichshain Erste-Hilfe-Ausbildung

10243
Berlin Friedrichshain
Erste Hilfe Kurs Berlin Friedrichshain - am besten bei PRIMEROS: Einfach einen Kurstermin wählen und mit ein..
primeros.de/erste-hilfe-kurse/erste-hilfe-berlin-friedrichshain/ Hilfe Erste Du Kurs Ersthelfer Kurse Berlin Friedrichshain
85 PRIMEROS Erste Hilfe Kurs Berlin Charlottenburg Erste-Hilfe-Ausbildung

10627
Berlin Charlottenburg
Erste Hilfe Kurs Berlin Charlottenburg - am besten bei PRIMEROS: Einfach einen Kurstermin wählen und mit ein..
primeros.de/erste-hilfe-kurse/erste-hilfe-berlin-charlottenburg Hilfe Erste Du Kurs Ersthelfer Kurse Berlin Charlottenburg
86 PRIMEROS Erste Hilfe Kurs Berlin Mitte Erste-Hilfe-Ausbildung

10178
Berlin
Erste Hilfe Kurs Berlin - am besten bei PRIMEROS: Einfach einen Kurstermin wählen und mit ein paar..
primeros.de/erste-hilfe-kurse/erste-hilfe-berlin-mitte Hilfe Erste Du Kurs Ersthelfer Kurse Berlin Mitte
87 PRIMEROS Erste Hilfe Kurs Berlin Neukölln Erste-Hilfe-Ausbildung

12057
Berlin-Neukölln
Erste Hilfe Kurs Berlin Neukölln - am besten bei PRIMEROS: Einfach einen Kurstermin wählen und mit ein..
primeros.de/erste-hilfe-kurse/erste-hilfe-berlin-neukoelln Hilfe Erste Du Kurs Ersthelfer Kurse Berlin Neukölln
88 PRIMEROS Erste Hilfe Kurs Berlin Marzahn Erste-Hilfe-Ausbildung

12679
Berlin-Marzahn
Erste Hilfe Kurs Dachau - am besten bei PRIMEROS: Einfach einen Kurstermin wählen und mit ein paar..
primeros.de/erste-hilfe-kurse/erste-hilfe-berlin-marzahn Hilfe Erste Du Kurs Ersthelfer Kurse Berlin Marzahn
89 PRIMEROS Erste Hilfe Kurs Bernau bei Erste-Hilfe-Ausbildung

16321
Bernau bei Berlin
Erste Hilfe Kurs Bernau bei Berlin - am besten bei PRIMEROS: Einfach einen Kurstermin wählen und mit..
primeros.de/erste-hilfe-kurse/erste-hilfe-bernau-berlin Hilfe Erste Du Kurs Ersthelfer Kurse Berlin Bernau
90 Metallzaun.de - Zäune und Tore aus Zaunbau

13403
Berlin
Der Zaunshop Metallzaun.de liefert robuste Zaunsysteme und Tore aus Aluminium nach Maß. Unsere Zäune sind pulverbeschichet nach..
metallzaun.de Stylable My Post Profile Blog Containerzvtnsinline Prompt Grid
91 Obsthof Berlin Obsthof

12047
Berlin
Wir sind ein junges Berliner Start-Up Unternehmen, dass es sich zum Ziel genommen hat Büros, Kanzleien etc...
obsthof-berlin.de/ Sans Cookie Slab Name Berlin Datenschutzerklärung Inhalte Obstkörbe
92 Zahnarztpraxis Neukölln Zahnarzt

12047
Berlin
Die Zahnarztpraxis Neukölln von Frau Dr. Petra Hartmann bietet Ihnen alle zahnmedizinischen Leistungen von A bis Z..
zahnarztneukoelln.com Behandlung Berlin Hartmann Neukölln Zahnarztpraxis Zahnarzt Uhr Zahnmedizin
93 THE OCEAN BETWEEN - Kunstausstellung Lifestyle

10245
Berlin
Internationale Kunstausstellung im Taxi Kundencenter „THE OCEAN BETWEEN“ Der Austausch zwischen Künstlerinnen aus Nordamerika und Deutschland steht in..
oceanbetweenartandculture.blogspot.com/ Neue Light Helvetica Blog Arial Link Facebook Twitter
94 Traumdisco-Berlin Veranstaltungen

14050
Berlin
Die Traumdisco-Berlin, eine ehrenamtliche Elterninitiative die einmal monatlich, freitags in „dieEICHE“, in der evangelischen Kirchengemeinde Neu-Westend..
traumdisco-berlin.de Berlin Traumdisco Neu Westend Disco Menschen Zipp Himmel
95 Aluzaun Zaun Zaunbau Gartentor Zaunbau

13407
Berlin
METALLZAUN.DE ist Hersteller für hochwertige Aluzäune und Gartentore und Briefkastensäulen. Wir produzieren für Sie Zaun- und Torsysteme..
metallzaun.de Stylable My Post Profile Blog Containerzvtnsinline Prompt Grid
96 Kebap with Attitude Gastronomie

10119
Berlin
Wir sind Berlins erstes new wave Kebap Restaurant. Was bedeutet das genau? Wir sind Berliner, wir lieben..
kebapyourlife.de My Subscriptions Grid Containercdmpinline Page Objectassign Bg Stylable
97 Peers Solutions GmbH Lernplattform

10119
Berlin
Peers ist die Softwarelösung für Personalentwicklung in der Industrie. Wir erstellen Lernpfade für Zukunftsthemen, indem wir die..
peers-solutions.com/ Peers Cookie Mitarbeitenden Website Solutions Google Name Informationen
98 Entsorgung Entrümpelung Wohnungsauflösung Berlin Kellerentrümpelung Müllentsorgung Entsorgung Entrümpelung

10783
Berlin
Entsorgung, Entrümpelung, Wohnungsauflösung, Berlin, Kellerentrümpelung, Müllentsorgung..
turbo-entsorgung.de Berlin Entsorgung Abfall Sperrmüll Service Abfälle Was Müll
99 Sperrmüll Entsorgung Entrümpelung Abholung Sperrmüll Entsorgung

10965
Berlin
Sie sind auf der Suche nach einer Entsorgungsfirma? Was genau haben zu entsorgen? Oder möchten Sie doch..
sperrmuell-berlin.com/ Berlin Sperrmüll Entsorgung Abholung Sondermüll Sperrmüllabholung Sperrmüllentsorgung Dienstleistungen
100 MBSR.berlin - MBSR & Achtsamkeitskurse beim Gesundheit

10437
Berlin
MBSR, Achtsamkeit & Meditation für Stressbewältigung und zur Verbesserung der Lebensqualität. Diplom-Psychologe Kirill Falkow ist vom MBSR..
mbsr.berlin Top Header Footer Sliding Action Side Recent Subheader
101 Online Marketing Agentur - NexTao GmbH Online Marketing

10557
Berlin
Ob SEO oder Webdesign, Printkampagnen, Grafikkonzepte oder Marketingstrategien: Die NexTao-Werbeagentur ist in jedem Fall Ihr kompetenter Ansprechpartner!..
nextao.de/berlin/
102 Antiquitäten Schmuck und Altgold Ankauf Berlin Antiquitäten

12207
Berlin
Zum Standort Berlin des renommierten Unternehmens Haeger gehört auch die Antiquegalerie – wo Kunden gern ihre antiken..
antiquegalerie.de/standorte/antiquitaeten-berlin Ankauf Antiquitäten Kunst Gemälde Skulpturen Back Uhren Düsseldorf
103 Bellas Hochzeitsshop Hochzeitsshop

12623
Berlin
bellas-hochzeitsshop.de: Der Hochzeitsblog und Shop. Alles für den großen Tag! In regelmäßigen Artikeln informieren wir euch Neuigkeiten..
bellas-hochzeitsshop.de/ Alles Tag Hochzeitsshop Du Thema Hochzeit Dann Blog
104 Goldankauf Haeger GmbH Berlin Goldankauf

12207
Berlin
Kontaktieren Sie unsere Mitarbeiter bei der Haeger GmbH, wenn Sie zum Thema Ankauf per Post Fragen haben..
goldankauf-haeger.de/berlin/ Berlin Cookie Goldankauf Gold Gmb Haeger Schmuckankauf Informationen
105 Ku´Damm 101 Design-Hotel Berlin Hotel

10711
Berlin
kudamm101.com
106 Peilicke Telefonmarketing Telefontraining Telefoninkasso Weiterbildung

10115
Berlin
Durch meine Seminare, Trainings und Beratungen werden die Menschen ein Meister in der Kommunikation am Telefon...
peilicke-telefontraining.de Telefon Content Telefontraining Telefonakquise Header Peilicke Video Sans
107 Rheinische Scheidestätte GmbH Goldankauf Berlin Gold- und

10711
Berlin
Die Mitarbeiter der Rheinischen Scheidestätte GmbH sind für Sie da, wenn Sie zu fairen Konditionen Gold verkaufen..
rheinische-scheidestaette.de/goldankauf-berlin/ Goldbarren Krügerrand Goldpreis Goldmünzen Silber Silberbarren Gold Standort
108 Gabienoo- Systemische Therapie- Mediation- Supervision Paartherapie

10823
Berlin
Systemische Mediation, Therapie und Supervision aus Leidenschaft. Diplom-Pädagogin Februniye Gabienoo aus Berlin Schöneberg ist Ihre Expertin für..
therapie-mediation-supervision-berlin.de Berlin Therapie Supervision Coaching Systemische Mediation Beratung Ich
109 Sanus-Fahrdienst Behindertentransport Schülerbeförderung

12247
Berlin
Wir helfen Menschen mit unterschiedlichen körperlichen oder sonstigen Einschränkungen mobil zu bleiben. Wir bieten Ihnen pünktlichen, schnellen und..
sanus-fahrdienst.de/ Fahrdienst Sanus Kontakt Ziel Anfrage Informationen Personen Unsere
110 Anwalt Arbeitsrecht & Vertragsrecht Berlin | Rechtsanwalt Arbeitsrecht

14195
Berlin (Dahlem)
Als ehemalige Unternehmensanwältin, Führungskraft und Personalleiterin (HR Business Partner) verfügt Frau Silke Hendrix nicht nur über das..
silkehendrix.de/ Cookie Name Borlabs Informationen Inhalte Website Line Datenschutzerklärung
111 Mietshausverkaufen Immobilien

10785
Berlin
Mietshausverkaufen bietet Ihnen einen schnellen und diskreten Weg Ihre Immobilie zu verkaufen. Wir suchen die für Sie..
mietshausverkaufen.de/mehrfamilienhaus-verkaufen Verkauf Immobilie Mehrfamilienhauses Mehrfamilienhaus Käufer Unterlagen Wohnungen Ihres
112 Waschmaschinen Reparatur Berlin Reparatur

10247
Berlin
Ob kaputte Waschmaschine, Wäschetrockner, Geschirrspüler, Herd/Ofen oder Fernsehr, Phoenix24 ist Ihr Reparaturdienst für Haushaltsgeräte in Berlin und..
phoenix-reparaturdienst.de/ Berlin Reparatur Waschmaschine Waschmaschinen Brandenburg Phoenix Hilfe Uhr
113 Fensterbauer24 Fenster

12207
Berlin
Wir sind als renommiertes Fensterbau Unternehmen in Berlin und Umland tätig. Fenstermontagen und -umbauten gehören zu unseren..
fensterbauer24.com/ Berlin Fensterbauer Fensterbau Nä Türen Kunden Fenster Reparaturen
114 MTS Umzüge Umzüge

13359
Berlin
Umzüge in Berlin..
mts-umzug-berlin.de/ Berlin Umzüge Umzug Angebot Umzugsunternehmen Umzugsangebot Sachen Umzugsgüter
115 Sanus-Fahrdienst Behindertentransport Schülerbeförderung

12247
Berlin
Wir helfen Menschen mit unterschiedlichen körperlichen oder sonstigen Einschränkungen mobil zu bleiben. Wir bieten Ihnen pünktlichen, schnellen und..
sanus-fahrdienst.de/ Fahrdienst Sanus Kontakt Ziel Anfrage Informationen Personen Unsere
116 Kiek rin Deutsche Küche & Catering Deutsche Küche

13187
Berlin
Muttern wie bei Muttern ... Täglich frische & leckere Gerichte..
kiek-rin.berlin Imbiss Partyservice Kiek Berlin Pankow Mittagsgerichte
117 SIGNAL IDUNA Versicherung Maria Radusch Versicherung

12627
Berlin
Die Haftpflichtversicherung ob privat oder betrieblich ist der Grundstein für ein sorgenfreies Leben, denn im Schadensfall bezahlt..
signal-iduna-agentur.de/maria.radusch Helvetica Calibri Arial Generalagentur Maria Radusch Ort Service
118 Blechdachhandel Berlin Baustoffe Handwerker

13125
Berlin
Blechdachhandel Berlin ist Ihr Spezialist für Trapezbleche und Blechdächer aller Art. Die Trapezbleche werden in eigener Produktion..
berlin-blechdachhandel.de/ Sans Blechdach Narrow Dach Lebensdauer Grad Blechdachs Cuse
119 Leadarchitekten Dienstleistungen

10707
Berlin
Wir kommen selber aus dem klassischen Mittelstand und wissen, wie viele Bälle unsere Kunden täglich jonglieren müssen...
leadarchitekten.de/ Vertriebsprozesse Vertrieb Wachstum Schritt Kunden Zeit Leadarchitekten Unternehmen
120 Berliner Brautmoden Brautmoden

10178
Berlin
Brautmoden, Brautkleider und Hochzeitskleider genau so individuell wie Sie, finden Sie in unserem Geschäft. Wir führen Kleider..
berliner-brautmoden.de/ Awesome Freefont Brautkleider Hochzeitskleider Brautmoden Performance Mutation Nitro
121 Shopyoga Versandhandel

10623
Berlin
shopyoga.de Yoga Zubehör Du Deine Kette Shop Mala Dir
122 CMD Zahnarzt Berlin Zahnarzt

10171
Berlin
Au weia, wir wissen schon, zum Zahnarzt geht keiner so richtig gern. Aber mit mehr als 20..
cmd-zahnarzt-berlin.de/ Berlin Zahnarzt Spezialisten Behandlung Therapie Dysfunktion Schmerzen Position
123 Zahnarztpraxis Sterndamm 9 Zahnarztpraxis

12487
Berlin
Wir arbeiten mit unterschiedlichen Meisterlaboren in Berlin zusammen. Durch die langjährige Zusammenarbeit sind wir, als Zahnarztpraxis Dr...
zahnarztberlin-drkhasin.de/ Berlin Sterndamm Zahnarztpraxis Zahnarzt Niederschöneweide Praxis Uhr Vereinbarung
124 Wichtel Umzüge GmbH Umzugsunternehmen

13158
Berlin
Als Berliner Umzugsunternehmen bietet die Firma Wichtel Umzüge GmbH professionelle Dienstleistungen aus dem Bereich Umzug und Transport..
wichtel-umzuege.de Umzug Umzugsunternehmen Umzüge Berlin Umzugshelfer Ihren Unsere Ihrem
125 FUNKE Reparaturservice Berlin-Brandenburg Waschmaschinen Reparatur

10589
Berlin
Sie möchten Ihre Haushaltsgeräte in ganz Berlin nach Belieben reparieren? Wenn das der Grund ist, dann entspannen..
funke-reparatur.de/
126 Gebäudereinigung Klaus Gotzhein Gebäudereinigung

12159
Berlin
Herzlich willkommen bei der Gebäudereinigung von Klaus Gotzhein, Ihrem Fachwirt für Reinigungs- und Hygienemanagement in Berlin-Friedenau. Unsere..
gebaeudereinigung-gotzhein.de Gebäudereinigung Friedenau Gotzhein Berlin Klaus Website Geb Diese
127 Betriebsarztservice Arbeitsschutz &

13187
Berlin
Betriebsarztservice bietet Dienstleistungen im Bereich Arbeitsmedizin, Arbeitssicherheit und Arbeitspsychologie an acht Standorten in Deutschland an...
betriebsarztservice.de Kontakt Betriebsarztservice Mitarbeiter Ihr Standortseite Taxiarzt Praxis Fr
128 Zentherapie® Triggerpunkttherapie und Tiefe Bindegewebsarbeit - Heilpraktiker

10967
Berlin
Schmerzen und eingeschränkte Beweglichkeit hindern uns daran, frei und unbeschwert den Ereignissen des Alltags zu begegnen. Durch die..
heilpraxis-sommer.de Zentherapie Sommer Triggerpunkttherapie Tiefe Bindegewebsarbeit Zentherapy Heilpraktiker Heilpraxis
129 Hundeausführservice Dogs in Nature Dogwalking und

12203
Berlin
Dogs in Nature ist ein professioneller Hundeausführservice mit Abhol- und Bringservice. Lutz Rechenberg ist ausgebildeter Hundetrainer und..
dogs-in-nature.berlin Nature Dogs Hundeausführservice Hunde Berlin Dogwalking Hunden Hund
130 SevenDays Transports Berlin Umzugsunternehmen

10367
Berlin
Ein starker Partner für Umzüge, Transporte und Haushaltsauflösungen in Berlin - Preiswert & transparent. Vereinbaren Sie noch heute..
sevendays-transports.de Berlin Umzug Transports Umzugsunternehmen Seven Ihr Ihren Angebot
131 BU-Hilfe.de - Experten bei Berufsunfähigkeit Fachanwalt Versicherungsrecht

14059
Berlin
Die BU-Hilfe.de besteht aus einem Team hochspezialisierter Fachanwältinnen für Versicherungsrecht, die berufsunfähige Versicherte bei der Anmeldung und..
bu-hilfe.de Versicherer Cookie Informationen Versicherte Versicherten Leistungen Daten Arial
132 Tischlerei Gelbstein Tischlerei

12051
Berlin
Wir sind ein anerkannter Handwerks-, Ausbildungs- und Meisterbetrieb für Innenausbau / Fachgerechte Türen Einbau / Fenster Einbau..
tischlerei-gelbstein.de/ Tischlerei Unsere Meisterbetrieb Wartung Gelbstein Fachbetrieb Rauchmelder Brandschutztüren
133 AK-Bau Innenausbau

12161
Berlin
Baufirma in Berlin ---- Wir sind ein zuverlässiges Unternehmen für Wohnungsbaugenossenschaften, Hausverwaltungen sowie Privat- und Gewerbekunden. Unser Leistungsschwerpunkt bezieht..
ak-bauberlin.de Berlin Komplettsanierungen Bau Badmodernisierung Leistungen Beleuchtung Logo Deckensegel
134 Flugs Bauunternehmen Pflasterarbeiten

12347
Berlin
Flugs Bau - ein Bauunternehmen für alle Dinge draußen. Wir sind ein Unternehmen mit den Schwerpunkten Garten-..
flugsbau.de/ Berlin Bauunternehmen Winterdienst Tiefbau Straßenbau Mediumttf Flugs Brandenburg
135 Fitnessgeräte-Test.de Testberichte

13599
Berlin
Das Portal Fitnessgeräte-Test.de informiert über Fitnessgeräte. Im Vergleich werden die Testsieger in den Kategorien Laufbänder, Crosstrainer, Ergometer..
fitnessgeräte-test.de
136 Deutsche Lebensversicherungs-AG Versicherung Lebensversicherung

12489
Berlin
Die Deutsche Lebensversicherungs-AG (DLVAG) aus Berlin* bietet ihren Geschäfts- und Privatkunden, als Spezialversicherer der Allianz, ausschließlich Lösungen..
dlvag.allianz.de
137 Fashion Almanac Fashion Blog

10115
Berlin, Germany
Fashion Almanac is a blog that features articles on topics including fashion trends for men and women..
fashionalmanac.net The You This Rebecca There If It But
138 DiVa Eventservice GbR Event Agentur

12247
Berlin
Wir unterstützen Sie bundesweit. Auf Veranstaltungen präsentieren wir Sie kompetent. Ihren Event begleiten wir stilvoll und mit..
diva-eventservice.com Gmb Berlin Personal Entertainment Event Mitarbeiter Kontakt Di
139 prima klima - no limits! travel Reisebüro

10827
Berlin
prima klima – no limits! bietet hochwertige Ski-, Motorrad- und Familienreisen an. Unsere Bus- und Gruppenreisen führen..
nolimits.de Angebot Ski Merkzettel Dieses Tour Hotel Skisafari Powder
140 Corona Schnelltest Reinickendorf Berlin Gesundheitswesen

13403
Berlin
Wir sind Ihr Corona Schnelltest Partner im Berliner Stadtteil Reinickendorf und Umgebung für schnelle und sichere Antigen-Schnelltests...
corona-test-reinickendorf.de/ Berlin Reinickendorf Teststelle Schnelltest Corona Covid Antigen Uhr
141 feinreparatur Smartphone

10119
Berlin
Smartphone, Laptop, Macbbok pro, Imac, Computer Reparatur in Berlin. Wir führen für Hard und Software Reparaturen ..
feinreparatur
142 Doolado Agentur Digital Marketing

10119
Berlin
Doolado Agentur für Online Digital Marketing ✓ sowie Mobil Apps Ios Android App ✓App Entwicklung ✓Flutter..
doolado.de/ Marketing App Ihr Online Cookie Agentur Apps Mobile
143 Belvedere Zahnärzte Dr. Ohling & Ohling Zahnarztpraxis

14055
Berlin
Ihre Bestellpraxis mit Wohlfühlatmosphäre bei geringsten Wartezeiten in Berlin-Westend. Ihre Wünsche sind die Basis für unsere kompetente..
ohling.de/ Ohling Erfahren Dr Asset Zahn Belvedere Uhr Behandlung
144 SiBa Wirtschaftskanzlei GmbH Gründungsberatung Gründungsagentur

10117
Berlin
Unser Schwerpunkt liegt darin, Sie als Unternehmer zu unterstützen, schnell und unkompliziert Ihre Geschäftstätigkeit aufnehmen zu können...
siba-wirtschaftskanzlei.de/ Gmb Treuhand Vorrats Cookie Gründung Informationen Website Google
145 ABEX Stahlbau – Rohrbiegen – Stadtmöbel Metallbau Gartenbau

12059
Berlin
Hochwertige Pflanzkübel für grüne Innenstädte. Edelstahl – Cortenstahl für angesagte Rostoptik – Aluminium – Zink oder feuerverzinkte Metalle:..
pflanzkuebel-abex-berlin.de Seite Pflanzkübel Comic Sans Hier Neues Kürze Tage
146 TransLina Dolmetscher & Übersetzungsbüro Übersetzungen &

12049
Berlin
Wir übersetzen Urkunden jeder Art • Zivilstandwesen (Geburtsurkunden, Geburtsregister, Heiratsurkunden, Eheschließungsverträge, Eheregister, Personalausweise, Reisepässe, Zivilmelderegister, Familienbücher, Sterbeurkunden, Sterberegister..
translina.de Cavalry Facebook Ij Aa Unternehmen Einstellungen Intl Informationen
147 Sushi For You Lieferservice

10625
Berlin
Sushi for You ist ein Zusammenschluss selbständiger Unternehmer, die unter der gemeinsamen Marke einen einheitlich hohen Standard..
sushi-for-you.de/ Sushi Lieferservice For You Dein Berlin Köln Dortmund
148 Online Marketing Consulting | Kapuze statt Onlinemarketing

10319
Berlin
Kapuze statt Mütze bietet innovatives und kreatives Online Marketing Consulting aus Berlin. Die Leistungen umfassen digitale Strategie-Entwicklung..
kapuzestattmuetze.de Marketing Mütze Ich Poppins Consulting Kapuze Online Produkt
149 Teeshop Berlin Tee

12489
Berlin
Der Teeshop Berlin entführt Sie in die Welt des Tees Betreten Sie die Welt des Tees im Teeshop..
teeshop-berlin.de/ Tee Ronnefeldt Password Lager Lieferzeit Werktage Aromatisierter Tea
150 Dekorationsverleih Partyausstatter Dekorationsverleih Eventdienstleistung

12349
Berlin
Dekorationsverleih, Partyausstattung, Catering & Service..
hochzeitsverleih-berlin.de Store Is Id Home Button Untertitel Bildtitel Webseite
151 Eventservice & Hochzeitsplanung Dekorationsverleih Eventdienstleistung

12349
Berlin
Bei uns erhalten Sie Hochzeitsdekoration, Floristik, Eventdekoration oder den kompletten Service rund um Ihre Veranstaltung...
a-mare.de Sans Open Store Events Uv Is Home Event
152 Umzugsunternehmen Klassik Umzüge Umzug

12629
Berlin
Gern stehen wir Ihnen bei Ihrem Umzugsvorhaben zur Seite! Jahrelange Erfahrung und Spaß an der Arbeit geben..
klassik-umzuege.berlin Berlin Umzüge Klassik Umzugsunternehmen Umzug Preis Berliner Umzugsgutliste
153 Rzeczoznawca Samochodowy Berlin STOWARZYSZENIA MOTOEXPERT Kfz Gutachter

13055
Berlin
Kfz Sachverständiger Berlin Rzeczoznawca Samochodowy Berlin UNFALLGUTACHTEN NACH EINEM UNVERSCHULDETEM VERKEHRSUNFALL IN DEUTSCHLAND ENTSCHÄDIGUNG UND SCHADENREGULIERUNG NACH EINEM VERKEHRSUNFALL IN..
rzeczoznawca-samochodowy-berlin.pl Roboto Poppins Open Sans Berlinie Condensed Rajdhani Uv
154 EAST END COMMUNICATIONS GmbH Eventagentur

10115
Berlin
Mit mehr als 20 Jahren Erfahrung bieten wir Ihnen als in Berlin agierende Event Management Agentur ganzheitliche..
east-end.de/eventagentur/berlin/ Cookie Event Name Events Berlin Ireland Datenschutzerklärung Google
155 Apartmentservice Vermittlung

13088
Berlin
Apartmentservice ist eine Vermittlungsagentur mit Online-Buchungsportal für das Wohnen auf Zeit in Serviced Apartments in Deutschland und..
apartmentservice.de Apartments Serviced Apartmentservice Haus Berlin Service Deutschland Zeit
156 Ersthelfer.tv - Erste Hilfe Kurs Berlin-Reinickendorf Ersthelfer

13059
Berlin
Ersthelfer.tv ist Ihr professioneller Anbieter für den Erste Hilfe Kurs in Reinickendorf. Unsere Erste Hilfe Kurse finden..
ersthelfer.tv/standorte/berlin-erste-hilfe-kurse/berlin-reinickendorf/ Hilfe Berlin Erste Kurs Reinickendorf Betrieb Sans Animation
157 Zabi Rollen

10829
Berlin
zabi-rollen.de/ Räder Symbol Kunststoff Rollen Zubehör Polyurethan Produkte Alle
158 Zahnärzte am Potsdamer Platz Zahnarzt

10785
Berlin
Die Zahnarztpraxis am Potsdamer Platz empfängt Sie in entspannter Atmosphäre mit einem zuvorkommenden und freundlichen Team. Wir..
zahnaerzte-am-potsdamer-platz.de Berlin Uhr Zahnarzt Zahnarztpraxis Bleaching Schubert Christine Dr
159 DPO STAR GmbH Software

10829
Berlin
dpostar ist eine neue DSGVO-Software, die alle notwendigen Datenschutz-Vorgaben und -Dokumentationen auf innovativ einfache, spielerische Art und..
dpostar.com Software Unternehmen Daten Aufgaben Freiberufler Mittelstand Konformität Unser
160 About Weed UG (haftungsbeschränkt) Gesundheit Kosmetik

10245
Berlin
About Weed wurde in Berlin-Friedrichshain gegründet und ist ein digitaler Marktplatz für Hanfprodukte, E-Zigaretten und Zubehöre. Das..
aboutweed.de/ Produkte Blüten Deine Nä Du Lebensmittel Kosmetik Tiere
161 TC Fahrzeugaufbereitung Fahrzeugaufbereitung

13507
Berlin
Autopflege - Autoreinigung vom Profi in Berlin Tegel - Reinickendorf Profitieren Sie von unserem hochqualifizierten Fachpersonal, das sich..
tegelcenter-autopflege.de Internal Server Error
162 Übersetzungen für Ukrainisch und Deutsch Übersetzer Sprachdienstleistungen

10627
Berlin
Übersetzungen verschiedener Dokumente: Pass und Peronalausweis Geburtsurkunde Heiratsurkunde ..
ukrainisch.berlin Ukrainisch Ufer Deutsch Goethe Sprache Tatiana Garcia Literatur
163 Immobiliendarlehen und Investitionsfinanzierung Immobilienbau

10115
Berlin
Persönliche Darlehensdienste Hallo Sie suchen einen Notkredit für ..
6 walter-bloch-straße 6
164 Polygraph Click Fraud

10117
Berlin
Founded in 2021, Polygraph is a cybersecurity system that helps in preventing, detecting, and eliminating click frauds...
polygraph.net/ Polygraph Fraud We Contact Detection Click Avoid Ad
165 DPO STAR GmbH Software

10829
Berlin
dpostar ist eine neue DSGVO-Software, die alle notwendigen Datenschutz-Vorgaben und -Dokumentationen auf innovativ einfache, spielerische Art und..
dpostar.de Unauthorized This Either
166 Regionales Onlinemarketing Onlinemarketing

10707
Berlin
regionales-onlinemarketing.de - Der Blog mit Informationen rund um SEA, SEA und Online-Marketing für regionale Unternehmen. Besuchen Sie..
regionales-onlinemarketing.de/ Marketing Online Unternehmen Google Local Trends Content Jahr
167 Müller & Woschke Umzüge

14167
Berlin
Sorfältige Umzugsplanung für einen stressfreien Umzug Undurchsichtige Preise, unerwartet hohe Rechnungen… Viele Menschen sind bereits auf unseriöse..
umzug-berlin.de Berlin Umzug Umzugsunternehmen Müller Ihr Ihren Woschke Umzugsfirma
168 DRESP SPORT COUTURE Sports

10405
Berlin
Bei DRESP Sport Couture verbindet sich elegantes Modedesign mit Funktionalität. Seit 2016 bietet das Modelabel aus Berlin..
dresp.com Regulärer Preis Angebotspreis Stückpreis Shop Yoga Avenir Now
169 Kali Kali Ernährungstherapie Ernährungsberatung

10243
Berlin - Friedrichshain
Erhalten Sie, bequem von Zuhause aus, eine persönliche Beratung für ein gesünderes Essverhalten. Als leidenschaftliche Diätassistentin stehe..
kalikali.de/ Customer Ernährungstherapie Berlin Ernährungsberatung Nä Kali Json Event
170 Clever Vital Health&Beauty

13585
Berlin, Germany
Die eigene Gesundheit wird vielen immer wichtiger. Ausreichend Bewegung und Schlaf, Entspannung und die richtige Ernährung sind..
clevervital.com/ Sans Awesome Freefont Vital Deine Produkte Gesundheit Nitro
171 SGBVM Sport

14055
Berlin
sgbvm - Der Blog für den Hobby- und Breitensport in Deutschland. Wir stellen beliebte Sportarten und Veranstaltungen..
sgbvm.de/ Section Color Breitensport Sportverletzung Behandlungsmethoden Rückkehr Vereins Sportvereins
172 Brautschmuck Blenk Brautschmuck

10707
Berlin
Brautschmuck Blenk betreibt einen Blog rund um die Themen Brautmode, Brautschmuck, Schuhe, Styling, Accessoires und Co. Mit..
brautschmuck-blenk.de/ Brautkleid Hochzeit Schmuck Tag Kleider Outfit Styling Brautmode
173 Aca Berlin Blog

10785
Berlin
aca Berlin ist ein Online Forschungsinstitut. Hier werden Informationen aus Forschung und Wissenschaft geteilt. Besuchen Sie unseren..
aca-berlin.de/ Forschung Arbeit Ghostwriter Interdisziplinäre Forschungsinstitut Forschungsarbeit Forschungsbereiche Online
174 Existenzgründercoaching Unternehmensberatung

12101
Berlin
Die Existenzgründerhilfe UG ist ein deutschlandweit agierendes Beratungsunternehmen für Existenzgründer und Existenzgründerinnen, mit aktuell 22 Standorten. Wir..
existenzgruenderhilfe.de/ Alle Infos Existenzgründerhilfe Gründungszuschuss Beratung Gründerseminar Existenzgründerseminar Existenzgründer
175 Fa. Bootshaeuser.de Bootshäuser Vermietung

10119
Berlin
Ein Urlaub in einem unserer Bootshäuser ist die perfekte Verbindung aus purer Erholung, Naturerlebnis pur und stillvollem..
bootshaeuser.de Personen Bootshaus Wasser Landkreis Hausboot Urlaub See Zimmer
176 MW Expat Solution Services GmBH Insurance

10585
Berlin
At MW Expat, we not only realise the importance of having a sound financial plan for the..
mw-expat.com/ Expat Germany Solution Services Gmb Insurance More Information
177 Umzug Berlin Umzüge Privat Umzug Firma Umzug Berlin

12057
Berlin
Herzlich Willkommen bei Prinz Umzüge! Seit 1996 sind wir als Umzugsfirma für Sie da! Sie suchen für Umzüge in..
prinz-umzuege
178 Umzugsunternehmen Berlin Umzugsunternehmen

13409
Berlin
Umzugsunternehmen Berlin Wir sind ein berliner Umzugsunternehmen. Unser Familienunternehmen besteht seit 2005. Wir führen Umzüge europaweit durch. Neben..
igel-umzuege.de Berlin Sans English German Awesome Umzug Umzüge Website
179 PiercingLine Fashion

10623
Berlin, Germany
Piercings sind schon längst ein etablierter Modeschmuck geworden. Vor allem Piercings für das Ohr wie das Helix-..
piercingline.com Cookie Piercing Verwendung Anbieter Name Lebensdauer Piercings Google
180 Auto Service Asad Auto Service

13409
Berlin
Mercedes Fachwerkstatt seit 1975. Oldtimer & Youngtimer enthusiasten. Riesige Teileauswahl in unseren heiligen Hallen...
auto-service-asad.de/ Autoservice Asad Mercedes Partner Berlin
181 Edelmetall – An- und Verkauf Aurofix Goldankauf Goldverkauf

10825
Berlin
Die Firma Aurofix GmbH ist seit ihrer Gründung im Jahr 2013 im Bereich von Edelmetallen tätig. Nach langjähriger..
altgoldankauf24.de Börsenkursaktualisierung Automatische Vorschau Versandkosten Mw Heraeus Raleway Argor
182 Waldkraft. Online-Shop

13125
Berlin
Tiergesundheit unterstützen das ist unser Auftrag. Wir wollen, dass Tiere lebensfroh und unbeschwert umherspringen können und Tierbeitzen..
waldkraft.bio Kategorie Einstellungen Cookie Versand Kontakt Labortests Magen Zahlungsbedingungen
183 Proktologie Dr. Loch Proktologie

10789
Berlin
Mein Name ist Dr. med. Horst Loch. Ich bin renommierter Proktologe mit jahrzehntelanger Erfahrung in der Diagnostik..
proktologie-dr-loch.de/ Cookie Dr Loch Informationen Website Proktologie Google Berlin
184 PR-Agentur Große GmbH Strategie |

13156
Berlin
Bessere Medienpräsenz und qualifizierte Leads für Kunden aus den Bereichen Bauen, Wohnen, Energie durch maßgeschneiderte Kommunikation. Sie möchten..
pr-grosse.de Gmb Agentur Große Kommunikation Berlin Kunden Jahren Partner
185 Sebastian Helming Immobilien Immobilienmakler

10117
Berlin
PERSÖNLICHER SERVICE. VERLÄSSLICHE RESULTATE. Wer die besten Ergebnisse erzielen möchte, braucht die besten Makler. Profitieren auch Sie..
sebastianhelming-immobilien.de/ Immobilien Immobilienmakler Store Berlin Sebastian Is Helming Home
186 Garamantis GmbH Interaktive Ausstellungen

10829
Berlin
Garamantis wurde 2014 in Berlin gegründet und entwickelt interaktive Ausstellungen und Showrooms. Individuelle Software-Entwicklung steht im Fokus..
garamantis.com Multitouch Garamantis Tisch Ihr Reality Showroom Software Ausstellungen
187 SM MIR UG Tabakwaren

14167
Berlin
glimp.de Sans Price Bar Switch Salt Elf Islands Lady
188 Stylefy - die Möbelplattform für Hersteller Möbel Branche

10437
Berlin
stylefy.de/ Möbel Stylefy Lieferung Wohnung Kauf Regale Sets Widerrufsrecht
189 Bonsaihandel Bonsaihandel

14052
Berlin
Ikigai Bonsai ist ein reiner Bonsai-Onlineshop. Die Bestellungen können aber gerne mit Terminvereinabrung in Berlin Charlottenburg abgeholt..
ikigai-bonsai.com/ Bonsai Shohin Bonsais Ikigai Onlineshop Bonsaischalen Baum Juniperus
190 Coaching Coaching

14165
Berlin
Mein Name ist Ingrid Huttary. Seit mehr als 15 Jahren begleite ich als Coach und Trainerin Menschen..
offene-horizonte.de/ Coaching Balance Home Kongress Lebensbalance Coach Online Hier
191 Klassik Umzüge Dienstleistung Umzug

12681
Berlin
Wir sind ein kleines, aber feines Berliner Umzugsunternehmen mit langer Erfahrung. Diese Erfahrung können wir als fairen..
klassik-umzuege.berlin Berlin Umzüge Klassik Umzugsunternehmen Umzug Preis Berliner Einlagerung
192 SeniorenLebenshilfe Claudia Kruk Seniorenbetreuung

13581
Berlin
Die SeniorenLebenshilfe ist bundesweit das einzige Unternehmen, dass sich auf die vorpflegerische Betreuung spezialisiert hat. Wir unterstützen..
seniorenlebenshilfe.de/lebenshelfer-berlin/lebenshelferin-claudia-kruk/ Senioren Live Bitte Pflichtfeld Arial Anfrage Applying Berlin
193 Viveka Jaeger - Amerikanische Chiropraktik Chiropraktiker

14057
Berlin
Die Amerikanische Chiropraktik vereint verschiedene Disziplinen wie die Osteopathie, Kinesiologie und die Kunst der Justierung zu einer..
chiropraktik-jaeger.de/ Sans Jaeger Chiropraktiker Amerikanischer Berlin Weilheim Opening Viveka
194 BHI Hesse Immobilien Immobilienmakler

13597
Berlin
In Spandau, aus Spandau, für Spandau… Als Spandauer Immobilienmakler sind wir seit über 25 Jahren für Sie in..
immobilienmakler-spandau.de/ Hesse Spandau Immobilien Cookie Immobilie Name Immobilienmakler Verkauf
195 Akademily Ghostwriting

12103
Berlin
Wissenschaftscoaching: Coaching, Beratung Wo die Betreuung an Universitäten endet, beginnt Akademily mit seinen Mentoring-Dienstleistungen. Seit April 2018 begleiten..
akademily.de/ Wissenschaftscoaching Akademily Anbieter Garantierte Arbeit Schreibservices Coaching Korrektur
196 Tee online kaufen Tee Online

10245
Berlin
Tee online kaufen im Bio Tee Online Shop Unser Teesortiment umfasst zahllose Teesorten aus fast allen Teeregionen der..
hitoca.com Tee Bio Online Shop Teesorten Feine Hitoca Gew
197 Treza Hersteller Von

12107
Berlin
doppelstabzaun-treza.de New Roman Zäune Herstellung Doppelstabmatten Firma Pforten Polen
198 Balkon Sichtschutz Ideen Balkon Sichtschutz

10827
Berlin
Balkon Sichtschutz Ideen ist ein Onlineshop für großformatige Druckerzeugnisse, mit der Spezialisierung auf die Fertigung von Balkon..
balkon-sichtschutz-ideen.de/ Sansfont Uv Sans Sichtschutz Ideen Freefont Displayfont Display
199 vorbereitende Buchhaltung Dienstleistungen

12439
Berlin
Wir bieten Ihnen unsere Dienstleistungen im Bereich Buchhaltung für den Raum Berlin und Brandenburg an. BUCHHALTUNG / CONTROLLING: Buchen..
mmu-berlin.de/ Container Site Vertical Drop Raleway Five Wbu Header
200 Corona Schnelltest Berlin Schöneberg Telekommunikation

10783
Berlin
Corona Schnelltest, Antigentest, Bürgertest, Kostenloser Schnelltest..
201 M&W Bürobedarf Bürobedarf und

13509
Berlin
Alles rund ums Büro - Nachhaltig, schnell und gut. In Berlin begeistert Sie unser Bürobedarfservice M & W..
mw-buerobedarf.de/nachhaltigkeit Store Is Initial Home Webseite Parameters Id Key
202 heysports Vergleichsportal

10999
Berlin
heysports.io ist eine Website, auf der du ganz einfach die Fitness- und Yogastudios deiner Stadt miteinander vergleichen..
heysports.io/ Mui Segoe Emoji Yoga Apple Arial Symbol Color
203 Alexandra Reimann Unlimited Coaching

10711
Berlin
Seit Jahren helfe ich jungen internationalen Führungskräften beim Einstieg in ihre neuen Funktionen. Wie das geht und was..
alexandra-reimann.com/ Montserrat Roboto Merriweather Slab Sans Awesome Cuse Reimann
204 Corona-Testzentrum Laboratorien

10717
Berlin
In unserem CoVID19-Testzentrum können Sie sich, Ihre Familienangehörigen und Mitarbeiter schnell und unkompliziert ohne Termin testen lassen...
7com-corona-test.de/agb/ Berlin Verbraucher Corona Vertrag Schnelltest Bestellung Widerrufsrecht Bundesallee
205 Corona Express Test BLN Gesundheit &

1334
Berlin
Wir haben sehr vielfältige Öffnungszeiten, ein gutes Personal unter anderem auch freundliche Kunden was uns die Arbeit..
corona-express-test-bln.de Berlin Schnelltest Corona Wedding Antigen Test Ergebnis Uhr
206 PEN Personalgewinnung GmbH Unternehmensberatung

10719
Berlin
Die PEN Personalgewinnung ist eine Unternehmensberatung spezialisiert auf Mitarbeitergewinnung mit Sitz in Berlin. Der Schwerpunkt liegt dabei..
pen-personalgewinnung.de/ Sansfont Uv Sans Personalgewinnung Gmb Hauptsitz Nitro Eventnitro
207 TEENDOO Fashion

10629
Sybelstraße 46, 10629, Berlin
Unser Online Shop bietet die heißesten Streetwear Outfits und Marken Turnschuhe von heute zu Schnäppchenpreisen...
teendoo.com Schuhe Wishlist Quick Ausführung Lite Awesome Stiefel Weizen
208 Foxx Umzüge Berlin Umzug

13089
Berlin
Das Umzugsunternehmen Foxx Umzüge in Berlin, bietet ihnen einen sicheren Umzug in Berlin, Deutschland und ganz Europa...
umzuege-berlin.com Umzug Umzüge Umzugsunternehmen Ihrem Transport Berlin Ihren Angebot
209 CoVID19 Testzentrum Laboratorien

10717
Berlin
In unserem CoVID19-Testzentrum können Sie sich, Ihre Familienangehörigen und Mitarbeiter schnell und unkompliziert ohne Termin testen lassen...
7com-corona-test.de/agb/ Berlin Verbraucher Vertrag Bestellung Schnelltest Widerrufsrecht Mail Internetshop
210 Taxi Taxi

13057
Berlin
thomastaxi.com Thomas Dahl Mail Interview Sicherheit Taxibetrieb Home Berlin
211 Gaststätte Ambrosius Gastronomie

10785
Berlin
Traditionelle Köstlichkeiten aus ganz Deutschland Ein Besuch in der Gaststätte Ambrosius im Herzen von Berlin lohnt sich immer...
gaststaette-ambrosius.de/ Berlin Uhr Home Begriff Petrus Küche Fpng Fpublicodcmallbusinessde
212 Augenzentrum Eckert Augenarzt

88662
Überlingen
Im schönen Überlingen am Bodensee können wir Ihnen jetzt Augenheilkunde auf dem modernsten Stand der Technik anbieten...
augenzentrum-eckert.de/standorte/ueberlingen/ Verdana Helvetica Arial Filiale Sans Eckert Augenlasern Karlsruhe
213 Marketing Is The Key Marketing

10115
Berlin
Marketing Is The Key is a marketing blog that features articles on topics like how to hire..
marketingisthekey.com/ Marketing The Inbound It Traditional Key Is Mail
214 Zahnvorsorgecoach Zahnmedizinische Prophylaxe

12357
Berlin
Mein Angebot an Zahnarzt- und Arztpraxen: Mobile Prophylaxe-Assistenz im Raum Berlin Gründe, warum man in einer Zahnarzt- und..
zahnvorsorgecoach.de/ Titillium Font Webfont Feuer Webline Andrea News Zahnreinigung
215 sonnenspiele.com Spielautomaten

12099
Berlin
Bei Sonnenspiele.com geht es um die beliebtesten Spielautomaten in Deutschland. Wir nehmen dabei die bekanntesten Automatenspiele verschiedener..
sonnenspiele.com Spielautomaten Sonnenspielecom Gaming Menü Hersteller Time Anregungen Verbesserungsvorschläge
216 Mittagessen für Adlershof Altglienicke und Bohnsdorf Lieferservice

12524
Berlin
Wir beliefern Sie montags bis freitags kostenlos mit abwechslungsreicher Hausmannskost in den Berliner Ortsteilen Adlershof, Altglienicke &..
lieferservice-mittagstisch.de Essen Adlershof Altglienicke Bohnsdorf Ihr Lieferung Mittagessen Uhr
217 Changelly Kryptobörse

10115
Berlin
Von 2020 bis 2015 erleichtert das Changelly Team seinen Kunden und Partnern den Zugang zu Kryptowährungen. Produkte Der Dienst..
changelly.com/de Changelly Terms Services The Affiliate You We Website
218 Fahrerflucht Anwalt Anwalt

10555
Berlin
Der Fahrerflucht Anwalt informiert auf dem unternehmenseigenen Portal über Strafen und Sanktionen bei Unfallflucht. Interessierte erfahren Wissenswertes..
fahrerflucht.eu/ Fahrerflucht Unfallflucht Unfallort Anwalt Fahrerlaubnis Kfz Unfall Geldstrafe
219 Pioneer DJ Forum Musik

10119
Berlin
Beim PioneerDJ--Forum handelt es sich um ein Onlineforum rund um alle Fragen zur Pioneer DJ Hardware und..
pioneerdj-forum.de Pioneer Beiträge Themen Forum Keine Kanal Mixer Controller
220 memoria-Stein│ individuelle Grabsteine aus Berlin Grabsteine

10115
Berlin
Individuelle Grabsteine aus Berlin. Bildhauerin gestaltet persönliche Grabmale aus Naturstein und anderen Materialien nach Gesprächen über das..
memoria-stein.de Grabstein Berlin Grabsteine Leben Stein Grab Bildhauerin Gedenkstein
221 Tea Deli - Dein Shop für Bio-Tee

13189
Berlin
Bei Tea Deli bieten wir dir leckere Bio Tees in zertifizierter Qualität. Ohne künstliche Aromen, ohne Zuckerzusätze..
teadeli.de Tees Tee Bio You Tea Roboto Futura Deli
222 iSIOS GmbH Roboterkalibrierung

12103
Berlin
Die iSIOS GmbH bietet Roboterkalibrierungen für Industrieroboter an. Durch innovative Technik können Höchstgenauigkeiten bei der Absolutgenauigkeit erzielt..
isios.de Isios Kalibrierung Vermessung Roboter Präzision Wartung Laser Sensorik
223 Key to see GmbH Coaching &

10179
Berlin
Das Leitbild von Key to see basiert auf unserer Überzeugung, dass jeder Mensch den Schlüssel zu einem..
keytosee.de Key Motivation Enneagramm Methode Berlin Leben Coaching Beziehungen
224 Handy Reparatur Berlin Handyreparatur

13089
Berlin
Seit 10 Jahre reparieren wir Display und Akku Austausch in Berlin Pankow unser Service für die Hauptstadt..
handy-reparatur-berlin.com/ Reparatur Berlin Xperia Reihe Pixel Austausch Oswald Apple
225 Rümpelfüchse Entrümpelung Berlin Entrümpelung

10969
Berlin
entruempelung-berlin.de Berlin Google Eventrocket Rümpelfüchse Entrümpelung Entsorgung Fsvg Rocket
226 Webdesign Agentur Berlin Webdesign


Berlin
Unavailable Light Webdesign ist eine Full Service Webdesign Agentur in Berlin und bietet ein umfängliches Leistungsspektrum an...
unavailable-light.de/ Design Web Agentur Webdesign Service Full Website Uncategorized
227 The Connoisseur Of Food Food

10115
Berlin
TheConnoisseurOfFood.com is a food blog that features articles on topics including natural energy drinks, advantages of diary..
theconnoisseuroffood.com/ Connoisseur Of Food The Stringfrom Arrayflag
228 Nikola Fischer Brautkleider Brautmode

88662
Überlingen
Brautmode mit Stil in Überlingen am Bodensee, Wir führen u.a. Küssdiebraut, GreenbyDesign, Modeca, Ladybird, Esther Hofmann und..
brautmode-bodensee.de/ Brautmode Bodensee Stil Dich Brautkleider Friedrichshafen Du Dir
229 Marketing Almanac Marketing

10115
Berlin
Marketing Almanac is a blog that discusses about various types of marketing such as digital marketing, content..
marketingalmanac.com/ Almanac Marketing Stringfrom Arrayflag
230 Mohr Gesprächscoach

14129
Berlin
www.spirituellerbeziehungscoach.de Gordon Konfliktmanagement / Familienkonferenz friedfertige Kommunikation & Ich-Botschaften Mediation Hypnose Heilungsmantra 60, 00 Euro pro Stunde..
spirituellerbeziehungscoach.de Beziehungscoach Spiritueller Konfliktmanagement Familienkonferenz Kommunikation Ich Botschaften Mediation
231 KFZ-Zulassung24.de GmbH - Ihr freundlicher Zulassungsdienst Zulassungsdienst

13053
Berlin
Wir sind ein Berliner Zulassungsdienst mit Abhol- und Bringservice Ihrer Dokumente. Unser Service ist kompetent, schnell und..
kfz-zulassung24.de Berlin Zulassungsdienst Auto Express Online Zulassung Ihr Service
232 DimaPax GmbH Verpackungen

13055
Berlin
Verpackungen aller Art von DimaPax: Für jedes Produkt haben wir die richtige Verpackung Wir sind ein relativ..
dimapax.de/ Html Taschen Luftpolster Schnellkauf Lager Lieferzeit Gr Werktage
233 Dr. med Henning Freiherr von Gregory Plastische und

10719
Berlin
Wir freuen uns über eine Terminvereinbarung für einen persönlichen Besuch in unserer Praxis. Alle Operationen an Nase..
drvongregory.de/ Awesome Freefont Borlabs Brandsfont Sans Code Helvetica Open
234 Scandinavian Biolabs Haarwachstum

12681
Berlin
Bei der Gründung von Scandinavian Biolabs standen Funktionalität, Transparenz und echte Wirkung an oberster Stelle. In der..
scandinavianbiolabs.de/ Re Geld Haarausfall Inhaltsstoffe Garantie Dateget Haar Biolabs
235 Marketing Talk Marketing

10115
Berlin
MarketingTalk.info is a marketing blog that dives deep into topics such as on marketing tips, brand promotion..
marketingtalk.info/ Talk Navigation Marketing Stringfrom Arrayflag Menu
236 Entrümpelungen in Berlin Entrümpelungen

13349
Berlin
Es wird ein Spezialist für die Entrümpelung oder Haushaltsauflösung benötigt? Perfekt, wir sind dafür Ihr Ansprechpartner! Sie..
entruempelunginberlin.de/ Berlin Roboto Firefox Mozilla Sans Font Open Entrümpelung
237 Studio Matthias Last Design Studio

10999
Berlin
Studio Last is a multidisciplinary design studio working primarily in the fields of media, art, culture and..
studio-last.com Berlin Art Design Direction Last Magazine We Identity
238 Blake & Vargas Publishing House

10999
Berlin
Blake & Vargas is a Kreuzberg based space founded by Sarah Bernauer and Matthias Last. The Kunstraum hosts..
blakeandvargas.com Vargas Basis Americana Regularcolorletter Blake Text All Regular
239 The World of Marketing Marketing

10115
Berlin
TheWorldofMarketing is a blog that covers topics related to marketing such as personalized marketing, brand marketing, stealth..
theworldofmarketing.net/
240 Gitarrenunterricht Berlin Musikunterricht

10713
Berlin
Fangen Sie an, Gitarre oder E-Bass bei mir zu lernen: nach einigen Grundübungen können Sie bald Ihre..
gitarrenunterricht-fuer-berlin.de/
241 Gitarrenlehrer Berlin Musikunterricht

10713
Berlin
Fangen Sie an, Gitarre oder E-Bass bei mir zu lernen: nach einigen Grundübungen können Sie bald Ihre..
gitarrenunterricht-fuer-berlin.de/
242 Jevio Jessica Leidel Portal

13403
Berlin
Das optimale Beauty- & Wellness Portal für Nagelstudio, Massage, Kosmetikstudio, Friseure in der Nähe. Auch Maniküre, Entspannung..
beauty-wellness-in-der-naehe.de Nä Portal Kosmetikstudio Nagelstudio Friseure Massage Nagelstudios Wellness
243 ECOCHECK-SachverständigenbüroBaubiologie Baubiologie Schadstoffmessung

13403
Berlin-Reinickendorf
Messungen von Schadstoffen im Wohnraum Luftmessung im Innenraum und Fertigteilhäusern mit Schadstoffanalyse auf Formaldehyd und VOC. Wir..
schadstoffgutachter.eu Elektrosmog Messung Haus Smog Wohnung Messungen Büro Berlin
244 Vis-Render Architektur Visualisierung Dienstleitung

12683
Berlin
Wenn es um fotorealistische 3D Visualisierung geht, sind wir ihr Ansprechpartner. Wir bei Vis-Render spezialisieren uns von..
vis-render.de/ Helvetica Roboto Arial Sans Visualisierung Open Architektur Font
245 The Marketing Blog Marketing

10115
Berlin
TheMarketingBlog.net is a blog loaded with marketing topics including social media marketing, buzz marketing, acquisition marketing, influencer..
themarketingblog.net/ Blog Marketing The Stringfrom Arrayflag
246 Reinigungsservice Niklas Reinigungsservice

10315
Berlin
Seit über zehn Jahren bin ich in der Reinigungsbranche tätig und vollbringe zur höchsten Zufriedenheit meiner Kunden..
reinigungsservice-niklas.de/ Open Sans Bold Regular Niklas Kontakt Grundreinigung Reinigungsservice
247 MEISTERKAMMER Galerie

10249
Berlin
Die Meisterkammer kannst du mieten. Was bieten wir: -Ladengeschäft im Herzen von Friedrichshain -2 Räume, weiss, Galerieschienen, kleines Schaufenster -inkl...
meisterkammer.de Meisterkammer Jeder Meister Stringfrom Arrayflag
248 Bootsschule Weiss Bootsführerschein Berlin

10557
Berlin
Wir bieten in Berlin die Ausbildung zum Bootsführerschein Motor für Binnengewässer (Flüsse) oder für die See (Meer)..
bootsschule-weiss.de/ See Bootsführerschein Binnen Berlin Bootsschule Kurs Kombi Prüfung
249 Green Garden Delivery Catering Catering Partyservice

10249
Berlin
Nachhaltigkeit geht jeden Menschen etwas an. Ebenso die Gastronomie. Green garden delivery steht für genussvolles, frisches und..
greengardendelivery.de Pro Maven Condensed Cabin Service Berlin Green Catering
250 Online-Marketing & Website-Pflege aus Berlin Online-Marketing-Beratung

12051
Berlin
Hier erhalten kleine Unternehmen, Solo-Selbstständige und die, die es werden wollen, Hilfe beim Online-Marketing: Vom Aufbau der..
webseitenliebe.de/ Website Marketing Astra Online Pflege Beratung Noto Serif
251 Supervision Supervision und

10999
Berlin
Supervision dient der beruflichen Reflexion mit dem Ziel Verbesserungspotenziale zu entdecken, Zusammenarbeit zu optimieren und vielfältige Handlungsoptionen..
ruth-kaukewitsch.de Supervision Coaching Teamentwicklung Berlin Stringfrom Arrayflag
252 Halteverbot Berlin24 Halteverbot Berlin

13357
Berlin
Halteverbot berlin Als Fachmann wissen wir genau, worauf es beim Einrichten einer Halteverbotszone ankommt und setzen dies..
halteverbot-berlin24.de Halteverbot Berlin Ihr Umzug Halteverbotszone Halteverbotsschilder Date Seite
253 Trademate Software

10245
Berlin
Online-Shops und Warenwirtschaftssysteme für Hofläden..
trademate.de Online Shop Warenwirtschaft Hofläden Kunden Landwirte Kontakt Hand
254 onrooby Software

10245
Berlin
Online-Shops und Warenwirtschaftssysteme für Hofläden..
onrooby.com Webshops Softwareentwicklung Ihr Unsere Projektmanagement Agile Ruby Unternehmen
255 Umzugsunternehmen-Berlin.de Umzug

10117
Berlin
Das Umzugsunternehmen-Berlin ist ein Familienunternehmen, die Ihren Schwerpunkt seit mehr als 7 Jahren, auf die Umzugsbranche gelegt..
umzugsunternehmen-berlin.de/ Berlin Umzugsunternehmen Umzug Kosten Cookie Wohnung Umzugsgüter Umzugskosten
256 TN-Reinigungsservice Gebäudereinigung Gebäudereinigung

12347
Berlin
TN Reinigungsservice Ihre Reinigungsfirma Ein sauberes Büro, eine aufgeräumte Küche, glasklare Fenster, ein gereinigtes Treppenhaus, oder eine saubere..
tn-reinigungsservice.de Reinigungsservice Gebäudereinigung Grundreinigung Sauberkeit Büroreinigung Industriereinigung Glasreinigung Baureinigung
257 Manu Lemke Heilpraktikerin Heilpraktikerin

14057
Berlin Charlottenburg
Unser Darm- in der Mitte liegt die Kraft In unserem längsten Organ- dem Darm- befindet sich der größte..
manu-lemke.de Lemke Therapie Manuela Lato Helvetica Heilpraktikerin Arial Manu
258 ÖZ Gebäudeservice in Berlin Gebäudeservice

13439
Berlin
ÖZ-Gebäudeservice in Berlin ist Ihr Ansprechpartner für branchenspezifische Reinigungen und sämtliche Leistungen rund um Gebäudeservice. Durch unsere..
oz-gebaeudeservice.de/ Berlin Brandenburg Gebäudeservice Winterdienst Geb Immobilie Leistungen Hausmeisterservice
259 Adomos Immobilien Immobilien

10709
Berlin
Sehr gerne betreuen wir Sie bei dem Verkauf oder der Vermietung Ihrer Immobilie. Lassen Sie sich von uns..
adomos.de/ Immobilien Adomos Home Helvetica Verkauf Kontakt Immobilie Helfer
260 JalouCity GmbH & Co.KG Sicht- und

10627
Berlin
Seit über 30 Jahren bietet JalouCity den Kunden hochwertige und moderne Systemlösungen für Licht-, Sicht- und Sonnenschutz..
jaloucity.de/ Site Jalou Außendienst Sonnenschutz Beratung Jalousien Online Node
261 BMC Bauservice in Berlin Sanierungsunternehmen

12109
Berlin
BAUSERVICE MIT QUALITÄTSGARANTIE Zuverlässigkeit gesucht? Beauftragen Sie den BMC Bauservice aus Berlin! BMC Bauservice aus Berlin hat sich als..
bmcbauservice.de/ Bauservice Berlin Notdienst Wohnungssanierung Sanitär Generalunternehmer Brandenburg Logo
262 BDH Bauservice in Berlin Sanierungsunternehmen

12051
Berlin
Berliner Bauunternehmen und eingetragener Betrieb der Handwerkskammer. Komplette Wohnungs- und Haussanierungen in Berlin und Umland aus einer..
bdhbauservice.de/ Berlin Bauservice Bodenverlegung Hand Trockenbau Wohnungssanierung Küchenaufbau Umland
263 TURBO Entsorgung Clean

10783
Berlin
TURBO Entsorgung Berlin: Wir entsorgen Ihren Sperrmüll | Abfall & führen Ihre Wohnungsauflösung | Entrümpelung durch. Schnell..
turbo-entsorgung.de/ Berlin Entsorgung Sperrmüll Wohnungsauflösung Turbo Entrümpelung Abrissarbeiten Aktuelles
264 Realestating Immibilienmakler

14167
Berlin
Wir sind ein erfahrenes Makler-Unternehmen und emotionale Makler für Immobilien aus Berlin. Unser Team besteht aus jungen..
realestating.de Immobilien Makler Hotelimmobilien Immobilie Luxus Real Haus Gewerbe
265 FriseurTeamKathleenBock Friseur

10623
Berlin
Wir sind leidenschaftliche Friseure mit Schwerpunkten: Haarfarbe, Farbtechniken, Farbkorrekturen, Color Correction, Balayage, Babylights, Pivot Point, Haarverlängerung, Extension..
friseurteamkathleenbock.berlin Kathleen Shampoonieren Bock Strähnen Aufwand Preis Styling Schnitt
266 SeniorenLebenshilfe Silke Morgenstern Seniorenbetreuung

12589
Berlin
Die SeniorenLebenshilfe ist bundesweit das einzige Unternehmen, dass sich auf die vorpflegerische Betreuung spezialisiert hat. Wir unterstützen..
seniorenlebenshilfe.de/lebenshelfer-berlin/lebenshelferin-silke-morgenstern/ Live Senioren Bitte Pflichtfeld Arial Anfrage Applying Mail
267 contract management system cms Software

10115
Berlin
We provide the highest level of quality software products and services globally that meet the needs of..
netsoltech.com/ascent-cms
268 natürliche Kosmetik Naturkosmetik

10115
Berlin
Wir bieten natürliche Kosmetik mit hochwertigen Inhaltsstoffen. farar Kosmetik ist vegan und frei von Tierversuchen. Unser Arganöl..
farar.de/ Zm Nunito Sans Dateget Einkaufswagen Produkte Gründerin Haut
269 Besonnungsstudie Verschattungstudie Umweltverträglichkeitsprüfung

10961
Berlin
sfimm.de/content/schattenwurfgutachten-fuer-hochbauten Schattenwurfgutachten Hochbauten Besonnungsverhältnisse Belichtungs Tageslicht Verschattungsgutachten Leistungen Innenräumen
270 Andreas Kutschke Umweltverträglichkeitsuntersuchung

10961
Berlin
Immissionsprognostik für Lärm, Gerüche, luftgetragene Schadstoffe...
sfimm.de/content/immissionsprognosen Immissionsprognosen Beurteilung Freien Richtlinien Leistungen Lärm Lato Stoffe
271 Immissionsprognose Umweltverträglichkeitsuntersuchung

10965
Berlin
SFI - Sachverständige für Immissionsschutz GmbH..
sfimm.de/content/immissionsprognosen Immissionsprognosen Beurteilung Freien Richtlinien Leistungen Lärm Lato Stoffe
272 Mp Objektschutz Sicherheitsdienst

10117
Berlin
Sie benötigen für Ihr Objekt ein Sicherheitsdienst, dann sind Sie bei Mp Objektschutz in Berlin genau richtig...
mp-objektschutz.de/ Berlin Professionelles Wachpersonal Wachschutz Objektschutz Security Personal Word
273 Sanitärexpress Berlin Sanitärnotdienst

10555
Berlin
Rohrbruch? Dann müssen Sie schnell handeln rufen Sie uns schnell an wir Sanitärexpress Berlin sind Ihr Klempner..
sanitaer-express.berlin Berlin Heizungsnotdienst Klempnerdienste Sanitärdienst Rohrnotdienst Rohrbruch Abflussreinigung Toilette
274 Kammerjäger Berlin Schädlingsbekämpfung

12487
Berlin
Sie suchen einen Kammerjäger in Berlin, dann sind Sie bei uns Vgs Kammerjäger Berlin genau richtig. Wir..
vgs-kammerjaeger.de/ Berlin Open Kammerjäger Sans Schädlingsbekämpfung Bold Regular Schädlingsbekämpfer
275 Kombi Kinderwagen Babybedarf

13599
Berlin
Bequeme Kinderwagen Sets im exklusiv-sportlichen Design, mit ONE Click Kinderbuggy Aufsatz, Auto Kindersitz und Luxus Erstausstattung. In jedem..
kinderwagen.store Babyschale Isofix Set Kinderwagen Komplett Rosegold Offer Du
276 Dentallabor Strziga - Ästhetik & Präzision Dentallabor

12163
Berlin
Dentallabor Strziga - Ästhetik & Präzision für ein strahlendes Lächeln Top qualifizierte Mitarbeiter, eine moderne technische Ausstattung, die..
dentallabor-strziga.de Nunito Dentallabor Grauer Strziga Vibes Schatten Great Lächeln
277 Flexibel Reparaturdienst Haushaltsgeräte Reparatur

10553
Berlin
Der Flexibel Reparaturdienst ist ein Reparaturdienstleister rund um Ihre Haushaltsgeräte. Die Techniker reparieren mit langjähriger Erfahrung Waschmaschinen..
flexibel-reparatur.de/ Reparatur Flexibel Berlin Reparaturdienst Waschmaschinen Kühlschrank Waschmaschine Passwort
278 Umzugshelfer Berlin - Umzug Studenten Berlin Umzug Entrümpelung

13409
Berlin
Ihre zuverlässigen Umzugshelfer Studenten in Berlin. Wir sind Umzug Studenten und helfen Ihnen dabei, Ihren Umzug stressfrei..
umzug-studenten.berlin/umzugshelfer-berlin Umzugshelfer Berlin Umzug Unsere Studenten Stunde Kontakt Küchenbau
279 Schuldnerberatung Kanzlei Bornemann Schuldnnerberatung

10127
Berlin
Wir haben uns als Schuldenhilfe auf die Königsklasse der Schuldnerberatung spezialisiert, die außergerichtliche Schuldenbereinigung...
ralf-bornemann.com Bornemann Schuldnerberatung Berlin Mediator Kanzlei Schuldnerberater Ralf Konfliktberatung
280 Schuldnerberatung Ralf Bornemann Schuldnerberatung

10117
Berlin
Mediator & Schuldnerberater Ralf Bornemann betreut seine Mandanten von Berlin aus in ganz Deutschland stets kompetent, erfolgsorientiert..
ralf-bornemann.com Bornemann Schuldnerberatung Berlin Mediator Kanzlei Schuldnerberater Ralf Konfliktberatung
281 Abalichin Bestattungen Bestattungen

12679
Berlin
Landsberger Allee 545 12679 Berlin Tel 030 54980971 030 55159370 Мы говорим по русски..
bestattungen
282 Abalichin Bestattungen Bestattungen

12679
Berlin
Landsberger Allee 545 12679 Berlin Tel 030 54980971 030 55159370..
bestattungen
283 Erfolgreiche Steuergestaltung durch Beratungskompetenzen. Steuerberater

10117
Berlin
Die Steuerexperten der Kanzlei ASK Steuerberater in Berlin haben sich zur Aufgabe gemacht, reale, steuerliche Gestaltungsspielräume individuell..
ask-steuerberater-berlin.de Steuerberater Berlin Steuerberatung Mandanten Color Ihr Jahresabschluss Großunternehmen
284 Boataround.com Bootsvermietung

10117
Berlin
Wir bieten über 18.000 Boote in mehr als 70 Ländern zum Mieten mit den besten Preisen erhalten..
boataround.com Marina Boataround We Select Show Please Yacht Your
285 Eastrecruiting Werber

10437
Berlin
Eastrecruiting: Ihre Experte für Personal Osteuropa - Fachkräfte Osteuropa - Mitarbeiter Osteuropa - Personalvermittlung Osteuropa - Arbeitskräfte..
eastrecruiting.de/ Osteuropa Personal Personalvermittlung Unternehmen Arbeitskräfte Mitarbeiter Rumänien Polen
286 Abschied und Aufbruch - Eva Vogt Heilpraktiker Für

14057
Berlin
Für den Abschied und für den Aufbruch biete ich Ihnen meine Begleitung an: Wenn Sie zu fassen..
abschiedundaufbruch.de Leben Aufbruch Abschied Lebensberatung Vogt Himmel Ihren Zeiten
287 The World of Health Health

10115
Berlin
TheWorldofHealth.net dives deep on health topics including dental tips, stem cell banks, ice therapy machines, benefits of..
theworldofhealth.net/ World Of Health The Stringfrom Arrayflag
288 Office Evens Personaldienstleister

10115
Berlin
Sie suchen nach einem neuen Job? Dann sind Sie bei uns genau richtig. Bei uns können Sie..
office-events.de/niederlassungen/berlin Berlin Niederlassung Office Events Jobs Mail Ludwigsburg Arbeitnehmerüberlassung
289 Weinhaus Tsinapari Wein Sekt

10405
Berlin
Direktimporteur von Wein, Spirituosen und Geschenke aus Georgien...
tsinapari.de/ Amphorenwein Berlin Wein Qvevri Weinhaus Marken Postkarte Geschenke
290 The Business Talk Business Blog

10115
Berlin
The business blog is dedicated to informative articles on business tips, why you need to hire a..
thebusinesstalk.net/ Talk Business The Stringfrom Arrayflag
291 BARYE GmbH Gebäudeservice Gebäudeservice Trockenbau

10787
Berlin
DAS BARYE SERVICE-PAKET >>> Bauen und Renovieren in Zusammenarbeit mit Fachfirmen >>> Einrichten inklusive Möbel abbauen, entsorgen und..
barye-gmbh.de/ Barye Willkommen Gebäudeservice Menu Grünflächen Kontakt Fragen Alles
292 Praxis für Körperpsychotherapie Psychotherapie

12167
Berlin
Das Beson­dere an der Körper­psycho­therapie ist, dass man neben dem Ge­spräch auch mit Bewegungs­impro­visationen, Atem­übungen, Be­rührungen und..
praxis-katharina-lenz.de Körper Therapie Berlin Coaching Katharina Lenz Sozial Kosten
293 Heilerin Berlin Heilprakitker

10245
Berlin
Ich bin Maria, geistige Heilerin, Coach, Künstlerin und Kreativ Direktorin. Ich leite ein eigenes Design Studio und..
heilerinberlin.de/ Trirong Heebo Berlin Heilung Kontakt Heilerin Maria Arbeit
294 Der Jalousienfachmarkt Sonnenschutz

12109
Berlin
Ein umfangreiches Angebot hält der Jalousienfachmarkt rund um die Themen Sicht- und Lichtschutz, Sonnenschutz und Dekoration für..
295 Prime Umzüge Umzüge

13509
Berlin
Prime Umzüge Berlin. Wir leisten immer gute Arbeit, sind schnell und zuverlässig. Unsere Kunden sind immer äußerst zufrieden mit..
umzuegeberlin.de/ Umzug Umzüge Berlin Umzugsservice Umzugsunternehmen Prime Umzugshelfer Firmenumzug
296 Bullet Shop Berlin Restaurant

10365
Berlin
Bulletshopberlin ist der günstigste Shisha-Laden in Berlin und bietet eine vielfältige Auswahl an Shishas, Wasserpfeifen, Shisha-Tabak, Kohle..
bulletshopberlin.de/ Slab Shop Shisha Laden Online Shishas Tabak Dein
297 Sanft Gebären - Julia Bergmann Coaching

10961
Berlin
Die mentale Geburtsvorbereitung mit Hypnose (Hypnobirthing) kann dich dabei unterstützen dein Kind entspannt, intuitiv, fern von Anspannung..
sanft-gebaeren.de Hypnose Geburt Schwangerschaft Geburtsvorbereitung Sanft Gebären Uhr Zoom
298 Better Business Today Finance

10115
Berlin
BetterBusinessToday blog covers articles on topics such as entrepreneurship, marketing and sales, finance, HR, technology, value chain..
betterbusinesstoday.net/ Today Business Better Stringfrom Arrayflag
299 Spreekind-Fotografie Fotograf |

10247
Berlin
Wünscht du dir Fotos, die begeistern und damit im Gedächtnis bleiben? Dann freue ich mich auf dich!..
spreekind-fotografie.de Playfair Mail Bold Barlow Display Adresse Website Wix
300 tufee® & Grosklos Web Services

12555
Berlin
Online RSS & XML Utilities und Online Web Utilities...
tufee.de Domains Utilities Checker Grosklos Domain Web Sitemap Tool

Kleinanzeigen, Kommentare und Mitfahrgelegenheit Berlin

+ Kommentar oder Kleinanzeige für Berlin eintragen!

301 Home Augenarztpraxis im
10783
Berlin
Augenarztpraxis im Ärzte Centrum Bülowstraße
aerzte-buelowstrasse.de
302 Albers DAS SPORTRESTAURANT Albers Wettboerse GmbH Albers
10783
Berlin
Großzügig konzipiert ist das Albers Sportrestaurant der Treffpunkt aller Besucher des Pferdesportparks BerlinKarlshorst. Der aufmerksame
albers-restaurant.de Albers Berlin Restaurant
303 Home
10783
Berlin
Kultur FREIES MUSEUM BERLIN
artfactory-berlin.de
304 Weihnachtsmarkt auf dem Winterfeldtplatz Berlin
10783
Berlin
Der traditionelle Weihnachtsmarkt auf dem Winterfeldtplatz ist einzigartig und an den Adventssonntagen geöffnet.
weihnachtsmarkt-winterfeldtplatz.de Berlin Weihnachtsmarkt Winterfeldtplatz
305 Formular.de Tipps Formular.de ist ein Angebot der Formblitz AG
10783
Berlin
Auf Formular.de finden Sie umfangreiche Informationen zu juristischen Themen wie Mietvertrag Arbeitsvertrag Patientenverfügung
formular.de
306 Cafe Peri Start
10783
Berlin
Homepage of Cafe Peri
cafe-peri.de
307 Czollek consult Willkommen! Leah
10783
Berlin
Diversity Dialoge Mediatorin Trainerin Dozentin Konflikte produktiv und zufriedenstellend lösen Kommunikation Dialog Unternehmen Kommunikationskultur
czollek-consult.de Leah Carola Czollek
308 PROFORMA Corporate Design Gesellschaft für Unternehmenskommunikation mbH & Co. KG Design
10783
Berlin
Corporate Design Agentur Berlin Agentur für Unternehmenskommunikation WebEntwicklungen und Beratung. Für Unternehmen
proforma.de Design Gestaltung Corporate
309 Business Development Germany German
10783
Berlin
We bring your business on the German market ? contact us today!
businessdevelopmentgermany.de German Companies German Marketing
310 DJ Frank DJService DJ
10783
Berlin
Dj Frank Berlin DJService für Partys Feste Hochzeiten ...
dj-frank-berlin-brandenburg.de DJ Berlin Brandenburg Party Hochzeit
311 Berlin Taekwondo Willkommen Berlinsan Taekwondo Sportverein e.V. Adnan
10783
Berlin
Olympic Sports Center Berlinsan Taekwondo e.V. Adnan Karabulut
berlintaekwondo.de Adnan Karabulut Taekwondo Berlin
312 Wohnungsauflösung Berlin 030 wohnungsauflösung
10783
Berlin
Wohnungsauflösung Berlin günstig und schnell von Complett Räumung 030 261 01 714
berlin-wohnungsaufloesung.de Wohnungsauflösung Berlin Wohnungsauflösungen Entrümpelung Entrümpelungen
313 RAe Böhm MeyerDulheuer §§
10783
Berlin
Rechtsanwälte Rechtsanwalt Matthias Böhm Notar Helmuth MeyerDulheuer RA RAe §
boehmmeyerdulheuer.de §§ § Rechtsanwälte
314 Astrid Elisabeth Stebich
10783
Berlin
Astrid Elisabeth Stebich Make up Artist Friseurmeisterin aus Berlin. Make up Haare
elice-beth.de
315 Home www.berlinevangelisch.de Gesellschaft für Unternehmenskommunikation mbH & Co. KG Abgeltungssteuer
10783
Berlin
www.berlinevangelisch.de ? Das ServicePortal der Evangelischen Kirche in Berlin.
berlin-evangelisch.de Abgeltungssteuer Advent Austritt Bach Berlin
316 Berlin Apartments Potsdamer Str Berlin
10783
Berlin
Apartments in Berlin nähe Potsdamer Platz für Gruppenreisen Gruppenunterkunft
berlin-aparts.de Berlin Apartments Berlin Gruppenreise
317 Bar Voyage barvoyages bar
10783
Berlin
Bar Café Kleinkunstbühne
barvoyage.de Bar Berlin Kleinkunst Berlin
318 Home ? Kunstsaele Berlin Kunstsaele
10783
Berlin
Die Kunstsaele Berlin verbinden Galerie Sammlung und Kulturprojekte an einem Ort. Neben den wechselnden
kunstsaele.de Kunstsaele Oehmen Bergmeier
319 WerbeartikelAgentur für Fahrradsattelbezüge
10783
Berlin
Kultkeks ist Ihr Partner für individuelle Werbemittel und Werbegeschenke. Unser Sortiment reicht von der Handysocke
kultkeks.de
320 TRIO PALMERA Salsa
10783
Berlin
Seit nunmehr 26 Jahren ist das TRIO PALMERA unterwegs um landesweit und über die Landesgrenzen
josefinol.de Salsa Cumbia Merengue
321 Home Labbow Personalleasing e.K.
10783
Berlin
Personalberatung und dienstleistungen
labbow-personalleasing.de
322 Marian Kiss Marian
10783
Berlin
Marian Kiss Film Berlin Filmemacherin Filmmaker Regiesseurin Director
mariankiss.de Marian Kiss Film
323 Marianne Rosenberg | RoseWeb Public Image GmbH Marianne
10783
Berlin
Die offizielle Website von Marianne Rosenberg mit aktuellen Infos SongDownloads Biografie Diskografie
rosenberg.de Marianne Rosenberg Pop
324 MännerMinne e.V. Erster schwuler choir
10783
Berlin
MännerMinne e.V. Erster schwuler Männerchor Berlin gegründet 1987 Mitglied im Berliner Sängerbund.
maennerminne.de Choir Chorus Gay
325 | MARTINA DOEHRING | c/o Formblitz AG Martina
10783
Berlin
Dies ist die offizielle Website der Sopranistin Martina Doehring
martinadoehring.de Martina Doehring Sängerin
326 EVA GmbH EVA GmbH
10783
Berlin
KFZ Reparatur oder Ausfuhrversicherung:sofort in unserem OnlineShop. Auch Gebrauchtwagengarantie und Finanzierung für Privatpersonen und Händler
eva-evb.de
327 Diversitygendertraining.de joomla
10783
Berlin
Joomla! dynamische PortalEngine und ContentManagementSystem
energydeal.de Joomla Joomla
328 :: Keding / ESS Keding / ESS Elektronische Sicherheitssysteme GmbH / Keding GmbH & Co. KG sicherheitssystem
10783
Berlin
ESS GMBH Planung Lieferung Montage Inbetriebnahme von elektronischen Signal und Anzeigeanlagen
ess-sicherheit.de Sicherheitssysteme Alarmanlagen Brandmeldetechnik Brandmelder Brandmeldeanl
329 Hauptstadtplan | interaktiver stadtplan Adler & Schmidt GmbH Bundeshauptstadt
10783
Berlin
Interaktiver häusergenauer Stadtplan der Berliner Innenstadt. Suchmöglichkeit nach den Kategorien Sehenswürdigkeiten Kultur Regierungsbauten
hauptstadtplan.de Bundeshauptstadt Berlin Hauptstadt Bundesregierung Reichstag
330 Home GmbH & Co. KG ML4
10783
Berlin
Personalleasing ML4 Personalmanagement GmbH Co.
ml4-dienstleistungen.de ML4 ML4Personalmanagement ML4
331 Keding GmbH Co.KG Integral
10783
Berlin
IntegralSecurity Integralsecurity Integral Security Integral Security Antennentechnik und Sicherheitstechnik Alarmanlagen Brandmeldeanlagen Einbruchmeldeanlagen Videoüberwachung und mehr)
keding.de Integral Security IntegralSecurity Integralsecutity Integral
332 Start Kauffeld und
10783
Berlin
Kauffeld und Jahn
kauffeldundjahn.de
333 Willkommen bei Pascha Grill joomla
10783
Berlin
Joomla! dynamische PortalEngine und ContentManagementSystem
pascha-grill.de Joomla Joomla
334 PartytechnikBerlin Verleih von Berlin
10783
Berlin
Partytechnik Berlin verleiht Lichttechnik und Tontechnik für Eure Party/Veranstaltung
partytechnik-verleih-berlin.de Berlin Partytechnik Verleih Party Verleih
335 Home
10783
Berlin
Tierärzte Tierarztpraxis Marianne Gass
petstation.de
336 Willkommen bei perko profundus! Perko
10783
Berlin
perko profundus
perko-profundus.de Perko Gudrun Profundus Wissenschaftscoach Education
337 Ludger Jungnitz Men's Maenner
10783
Berlin
Ludger Jungnitz Men's Care Men's Studies
mensstudies.de Maenner Lebensqualitaet Gesundheit
338 Berlin Apartments Potsdamer Str Berlin
10783
Berlin
Apartments in Berlin nähe Potsdamer Platz für Gruppenreisen Gruppenunterkunft
cityapartsberlin.de Berlin Apartments Berlin Gruppenreise
339 HumanistischSystemische Beratung Frank systemisch
10783
Berlin
Erkennen und Auflösen von Verstrickungen Familienstellen Psychodrama Gestaltherapie Trauma
frankstamer.de Systemisch Familienstellen Aufstellung
340 Flowers of life Flowers
10783
Berlin
Flowers of life richtet sich an alle Menschen die Begleitung Gesellschaft oder eine persönliche
flowers-of-life.de Flowers Of Life Brigitte
341 INTEGRAL SECURITY Sicherheitstechnik Keding GmbH & Co. KG IntegralSecurity
10783
Berlin
Sicherheitstechnik von Integral Security dem deutschlandweiten Firmenverbund für Sicherheitstechnik (Alarmanlagen Brandmeldeanlagen Einbruchmeldeanlagen
integralsecurity.de IntegralSecurity Sicherheitstechnik Integral
342 IJam.de ? mediendesign Webdesign
10783
Berlin
10 Schritte zur eigenen Website | iJam.de Mediendesign
ijam.de Webdesign Mediendesign Homepage
343 Startseite » Gesine Palmer » Herzlich Willkommen auf Gesine
10783
Berlin
Dr. Gesine Palmer leitet das Berliner Büro für besondere Texte. Die Religionsphilosophin bietet Kommunikationsberatung und
gesine-palmer.de Gesine Palmer Redenschreiben
344 Politikmanagement mit Gitta Stieber Politikmanagement
10783
BERLIN
Gitta Stieber Berlin Politikmanagement Qualifizierung und Weiterbildung die Sie in sozialen
gittastieber.de Politikmanagement Kommunikation SoftSkills
345 Gift Music Gift Music GmbH Weltmusik
10783
Berlin
Ein kleines Weltmusiklabel aus Berlin
giftmusic.de Weltmusik Label Berlin
346 GEAG Immobilienverwaltung Berlin:Wir verwalten GEAG Immobilienverwaltungs GmbH Wirtschaft
10783
Berlin
GEAG Immobilienverwaltungs GmbH: kompetente Verwaltung und Betreuung von Immobilien in Berlin Brandenburg Sachsen
geag-berlin.de Wirtschaft Immobilien Immobilienverwaltung
347 Business Development Germany German
10783
Berlin
We bring your business on the German market ? contact us today!
business-development-germany.de German Companies German Marketing
348 Moritz Tilman Achelis | rechtsanwalt
10783
Berlin
Rechtsanwalt Arbeitsrecht Achelis Baurecht Architektenrecht Grundstücksrecht Wohnungseigentumsrecht Medizinrecht
ra-achelis.de Rechtsanwalt Arbeitsrecht Achelis
349 RDM: Startseite Landesverband Berlin und Brandenburg e.V. rdm
10783
Berlin
RDM Ring Deutscher Makler Landesverband Berlin und Brandenburg e.V.
rdm-berlin-brandenburg.de Rdm Ring Deutscher
350 Startseite Willkommen
10783
Berlin
Willkommen:  
hd-computer24.de
351 Rita Leinenweber · Astrologie Astrologie
10783
Berlin
Ich freue mich Ihnen meine Kenntnisse in Astrologie Massage energetischen Heilweisen
ritaleinenweber.de Astrologie Horoskop Geburtshoroskop
352 GEAG Immobilienverwaltung Berlin:Wir verwalten GEAG Immobilienverwaltungs GmbH Wirtschaft
10783
Berlin
GEAG Immobilienverwaltungs GmbH: kompetente Verwaltung und Betreuung von Immobilien in Berlin Brandenburg Sachsen
sabinespehr.de Wirtschaft Immobilien Immobilienverwaltung
353 Rundum Ich Ihr massage
10783
Berlin
Massage Ernährungsberatung Fitness und Personal Training Hypnosetherapie in Berlin für Privatkunden
rundum-ich.de Massage Ernährung Hypnose
354 Astrologische Gesundheits und Lebensberatung Astrologie
10783
Berlin
Astrologische Gesundheits und Lebensberatung Yvonne v. Bechtolsheim: Astrologie Reiki Ernährungsberatung und Radionik in
schwarzer-second-hand-shop.de Astrologie Reiki Ernährungsberatung
355 Roger Thilo EDV Service Roger
10783
Berlin
Wir bieten ITLösungen im Businessbereich für alle Branchen und Unternehmensgrößen. innovativ zuverlässig
rthilo.de Roger Thilo EDV Service
356 PROBase easy PROFORMA GmbH & Co. KG CMS
10783
Berlin
Mit PROBase easy erstellen wir individuell hochwertige Webauftritte Sie brauchen nur noch die Texte
pro-base-easy.de CMS ContendManagemnetSystem Contend
357 Sm hope ick Kindermode
10783
berlin
Die Teilnahme am Wettbewerb ?Meine Heimat? auf der Kreativplattform Dawanda.de war Anlass Designs zu
smhope.de Kindermode
358 LOOK22 Home LOOK22 LOOK22
10783
Berlin
LOOK22 MediaService ~ zielgruppenoptimiertes Webdesign ~ aussagekräftige Fotografie ~ perfekte Grafik ~ treffsichere Texte ~
look22.de LOOK22 MediaService Internet Fotografie Grafik
359 Raumdesignerin .Silke Smida. kunst
10783
Berlin
Art by Silke Smida composed drawings find new places!
raumdesignerin.de Kunst Design Graffiti Wandtattoos Acryl
360 BEGINE Treffpunkt und Frauen
10783
Berlin
Interkulturelles Frauenkulturzentrum Künstlerinnenförderung Konzerte Ausstellungen Potsdamer Str. 139 BerlinSchöneberg
begine.de Frauen Lesben Frauencafé
361 Complett Räumung | Wohnungsauflösung wohnungsauflösung
10783
Berlin
Wohnungsauflösung Berlin günstig und schnell von Complett Räumung 030 261 01 714
complett-berlin.de Wohnungsauflösung Berlin Wohnungsauflösungen Entrümpelung Entrümpelungen
362 Contravision breaking news contra medienwerkstatt e.v. ContraVision
10783
berlin
short film festival in berlin germany march 20th to march 28th
contravision.de ContraVision Cinema Contra
363 Doktus.de Dokumente uploaden FORMBLITZ AG doktus
10783
Berlin
Hier findet man Dokumente zu allen Themen und kann Dokumente suchen verwalten
doktus.de Doktus
364 | MARTINA DOEHRING | c/o Formblitz AG Martina
10783
Berlin
Dies ist die offizielle Website der Sopranistin Martina Doehring
martina-doehring.de Martina Doehring Sängerin
365 Wolfgang Kommerell | kommerell.de Wolfgang
10783
Berlin
Website von Wolfgang Kommerell: Segeln Fotografie.
kommerell.de Wolfgang Kommerell Fotografie
366 Marianne Rosenberg | RoseWeb Public Image GmbH Marianne
10783
Berlin
Die offizielle Website von Marianne Rosenberg mit aktuellen Infos SongDownloads Biografie Diskografie
roseclub.de Marianne Rosenberg Pop
367 Linux auf CD/DVDR linux
10783
Berlin
LinuxDistributionen auf CDR und DVDR tuxpost.de Shop
tuxpost.de Linux Iso Shop
368 Home Texts and Birgit
10783
Berlin
Dr. Birgit Hollenbach brings language and science together. Her university studies of translation and biochemistry
textsandtranslations.de Birgit Hollenbach Translation
369 .:|Stadtrundfahrten|Originelle Alternative Stadtrundfahrt|Berliner Dialekt Berlin
10783
Berlin
| BerlinerSchnauze Stadtrundfahrten | Alternative Stadtrundfahrt im Berliner Dialekt | Mundart sehr Orginelles Geschenk
berliner-schnauze.de Berlin Stadtrundfahrt Stadtrundfahrten Information Private
370 Übersetzer Deutsch Rumänisch Rumänisch
10783
Berlin
Übersetzungen Deutsch Rumänisch Dolmetscher für Rumänisch in Berlin profesionelle Übersetzung kundenorientiert
turbatu-translations.de Rumänisch Übersetzer Deutsch Rumänisch
371 Home / tausendschwarz.de Angebot
10783
Berlin
HomepageTitel Berlin
tausendschwarz.de Angebot Kompetenz Beratung
372 Subversionen.de | praeludium
10783
Berlin
??? Beuys + Agnoli
subversionen.de
373 Betreutes Wohnen in Demenz betreutes
10783
Berlin
Der FAW e.V. begleitet und verwaltet ambulant betreute Wohngemeinschaften für Menschen mit Demenz.
verein-faw.de Betreutes Wohnen Demenz Wg
374 TRIO PALMERA Salsa
10783
Berlin
Seit nunmehr 26 Jahren ist das TRIO PALMERA unterwegs um landesweit und über die Landesgrenzen
trio-palmera.de Salsa Cumbia Merengue
375 Astrologische Gesundheits und Lebensberatung Astrologie
10783
Berlin
Astrologische Gesundheits und Lebensberatung Yvonne v. Bechtolsheim: Astrologie Reiki Ernährungsberatung und Radionik in
sternen-klar.de Astrologie Reiki Ernährungsberatung
376 Italienische Weine Online Weine
10783
Berlin
Vinila Weine aus Italien. Wer via eCommerce in Deutschland die besten italienischen Weine online
vinila.de Weine Wein Aus Italien
377 NAS Planung Baumanagement Nas Planung & Baumanagement GmbH & Co. KG Berlin
10783
Berlin
NAS Planung Baumanagement GmbH Co. KG Telefon +49 (0)30. 216 95 45
xn--nas-planungsbro-cwb.de Berlin Ahmet Nas
378 AllmendeKontor Gemeinschaftsgarten Allmende-Kontor e.V.
10783
Berlin
Allmende = Gemeingut = Commons: Berliner AllmendeKontor Gemeinschaftsgarten und eine der größten Hochbeetanlagen der
allmende-kontor.de
379 Beste Hunde: OnlineMagazin für
10783
Berlin
Das Online Hundemagazin mit aktuellen Artikeln zu Gesundheit Ernährung Erziehung und Verhalten
bestehunde.de
380 Berliner Schlagerfest 2012 berliner
10783
Berlin
Das Berliner Schlagerfest geht in die 2. Runde.
berliner-schlagerfest.de Berliner Schlagerfest 2012 Schlagerfest Berlinmitte
381 Birgit Schlieps Birgit
10783
Berlin
Urban Sculpture. Die Künstlerin Birgit Schlieps arbeitet mit dem urbanen Raum als Phantom Mythos
birgitschlieps.de Birgit Schlieps Kunst
382 Startseite Willkommen
10783
Berlin
Willkommen:  
ep-store.de
383 Business Development Germany German
10783
Berlin
We are the leading German Marketing Company bringing your business on the German market. Our
cockpit-germany.de German Companies German Marketing
384 Coworkingberlinsquarehaus.de coworkingberlinsquarehaus Webseite! Square Haus am Nollendorfplatz GmbH
10783
Berlin
SquareHaus work meet share collaborate coworking büros konferenzraum
coworking-berlin-squarehaus.de
385 Business Development Germany German
10783
Berlin
We are the leading German Marketing Company bringing your business on the German market. Our
dashboard-germany.de German Companies German Marketing
386 Herzlich Willkommen Willkommen Forner + Forner GbR
10783
Berlin
Als kreatives und innovatives Unternehmen für Beratung und Kommunikation möchten wir Sie als vertrauensvoller Partner
ff-beratung.de
387 Home SchwarzweißFotogr
10783
Berlin
Neue Wege Neue Sichten Neue Fotografien Du möchtest besser wahrnehmen und kreativ sein
fotografisch-sehen-lernen.de SchwarzweißFotografie Konzeptfotografie Fotografisch
388 Fotostudio Altman. Hochzeit Wettbewerb Studioalex.de
10783
Berlin
Suchen Sie einen professionellen Fotografen mit über 25 Jahre Erfahrung in der Fotografie? Dann sind
fotostudioalex.de Studioalex.de Hochzeit Wettbewerb Meine Traumhochzeit!
389 DIF | Dit is mirapodo ? operated by myToys.de GmbH
10783
Berlin
DAS Berliner Modeblog zu Fashiontrends und Modesünden Parties und Veranstaltern Designern und Kollektionen
dit-is-fashion.de
390 Heilpraxis Susanne Weis Heilpraxis
10783
Berlin
Heilpraxis Susanne Weis
heilpraxisweis.de Heilpraxis KLANGTHERAPIE HOMÖOSYNERGETIK AUSLEITUNG ERNÄRUNG
391 BAKUNAPOLI BakuNapoli
10783
Berlin
BAKUNAPOLI.Aserbaidschanische und italienische Küche.
baku-napoli.de BakuNapoli Restaurant Berlin Aserbaidschanische Küche
392 Kristina Jacoby Startseite Ghostwriter
10783
Berlin
Kristina Jacoby unterstützt Autoren bei der Erstellung ihrer Bücher
kristinajacoby.de Ghostwriter Ghostwriting Wissenschaftliches
393 Startseite Klinisches Krebsregister Klinisches Krebsregister für Brandenburg und Berlin gGmbH Klinisches
10783
Berlin
Informationen zur klinischen Krebsregistrierung in Brandenburg
kkrbb.de Klinisches Krebsregister Brandenburg
394 Kniggeinberlin.de Willkommen bei Knigge
10783
Berlin
Gesellschaftlicher Schliff selbstsicheres und stilvolles Auftreten ist heute wichtiger denn je. Jeder kann Benehmen
knigge-in-berlin.de Knigge Seminare KniggeSeminare Benehmen Benimmkurse
395 PROJECT318 photography
10783
Berlin
Homepage für die Vernissage / Ausstellung PROJECT318 der SRH Hochschule der populären Künste (hdpk).
project318.de Photography Design Motion
396 Ludger Jungnitz Prozessbegleitung Prozessbegleitung
10783
Berlin
Prozessbegleitung Berlin Ludger Jungnitz
prozessbegleitung-berlin.de Prozessbegleitung Coaching Projekte
397 SPAM Magazin SPAM
10783
Berlin
SPAM Magazin Ausgabe 01
spam-music.de SPAM; Magazin Musik
398 Text Julia Richter
10783
Berlin
Erstklassige Unternehmenskommunikation Texte und Konzepte in Berlin
text-juliarichter.de
399 ReBuy der einfache An reBuy reCommerce GmbH gebraucht
10783
Berlin
An und Verkauf für gebrauchte Handys Tablets Videopiele Filme CDs
rebuy.de Gebraucht Kaufen Gebraucht Verkaufen
400 Pasta e Più Startseite Frische
10783
Berlin
Frische Pasta in Berlin
pasta-e-piu.de Frische Pasta Berlin Raviolli Ghnochi
401 Aktuelles Bürgerinitiative
10783
Berlin
Stadtplanung von unten Stadtentwicklung TempelhofSchoeneberg Berlin
stadtplanung-von-unten.de Bürgerinitiative Bürgerbegehren Bürgerentscheid Anwohnerversammlung Gleisdr
402 Taxi Bildungscenter Berlin Treffpunkt Bildung GmbH Taxischein
10783
Berlin
Wir schulen seit 18 Jahren erfolgreich auf die Ortskundeprüfung mit eigenem ständig aktuellem
taxi-bildungscenter.de Taxischein PSchein Taxifahrer Fahrgastbeförderung Ortskundeprüfung
403 Studio NiMa Produktion Mode Kauffeld und Jahn GbR
10783
Berlin
Vom Entwurf bis zur Produktion. Mode und Textil. Studio NiMa ist in der Bekleidungsindustrie
studionima.de
404 Schuhe Online Shop myToys, mirapodo und ambellis - Shops der myToys.de GmbH
10783
Berlin
Schöner Schuhe shoppen ? riesige Auswahl für Damenschuhe ? Herrenschuhe ? und Kinderschuhe ? Bestellen
mirapodo.de
405 Yoga in Kreuzberg Yoga
10783
Berlin
Yoga in Berlin an Ihrem Arbeitsplatz oder besuchen Sie YogaKurse in Berlin Kreuzberg mit
yoga-und-massage.de Yoga Am Arbeitsplatz Yoga
406 MyToys | Alles für myToys, mirapodo und ambellis - Shops der myToys.de GmbH
10783
Berlin
myToys Ihr OnlineShop für Spielzeug Kindermode Babyausstattung und vieles mehr. Über 100.000
mytoys.de
407 Werbung auf dem Sattelschoner|
10783
Berlin
Sattelschützer als Werbemittel: Bedrucken Sie Sattelbezüge mit Ihrem Logo. Individuelle Gestaltungsmöglichkeiten Lieferung nach drei
kultsattel.de
408 Finest Whisky Shop Whisky
10781
Berlin
Unsere Philosophie ist es hochwertige seltene und alte Flaschen der verschiedensten Destillen und Abfüller
finestwhisky.de Whisky Verkauf Berlin
409 Black meadow music production Martin Klein und Christian Kociolek GbR
10781
Berlin
black meadow music production is a label situated in Berlin.
black-meadow.de
410 Immocollect.de by Portal Financecollect Immocollect.de by Portal Financecollect GmbH Immocollect.de
10781
Berlin
Immobilienangebote von Immocollect.de by Portal Financecollect GmbH
immocollect.de Immocollect.de By Portal Financecollect GmbH
411 Simply : pr + simply
10781
Berlin
simply : die PR und Marketing Agentur für erklärungsbedürftige Produkte! fon +49 (0) 30. 21
agentur-simply.de Simply Public Relation
412 Ashtanga Yoga Schule Berlin Ashtanga
10781
Berlin
Ashtanga Yoga Schule in Berlin Schöneberg am Winterfeldtplatz Pallasstr. 89 10781 Berlin
ashtangayogaschoeneberg.de Ashtanga Yoga Berlin Schöneberg
413 Rosenscharf und Edelsüß Catering ZOE
10781
Berlin
Restaurant ZOE Berlin. Asiatische und mediterrane Küche zwischen Hackeschem Markt und Alexanderplatz in Berlin Mitte.
aromamanufaktur.de ZOE Restaurant Lounge
414 Online Marketing: Wissen
10781
Berlin
Endlich von Online Marketing profitieren. Portal Ratgeber für erfolgreiches Internetmarketing mit Grundlagen Tipps
omkt.de
415 :: NATURKOSMETIK CALLA
10781
Berlin
Fachgeschäft für Naturkosmetik und Naturwaren. Kosmetische Behandlungen nach Dr. Hauschka und M.Gebhardt.
calla-naturkosmetik.de
416 Architektur Planung Beratung
10781
berlin
Architekten Hannover Berlin Architekturplanung Bauberatung Projektentwicklung Wertermittlung Architektur architectura nova
chocmoc.de
417 ChristianErdmann.de Christian
10781
Berlin
Willkommen auf der privaten Site von Christian Erdmann. Erfahren Sie mehr über meine Dozententäigkeit und
christian-erdmann.de Christian Erdmann Dozent Verwaltungsrecht Doppik.kom.bb
418 Christine Ordnung | Home xxxxx
10781
Berlin
xxxxx
christine-ordnung.de Xxxxx
419 CORINO 4 MEN CorinoArt
10781
Berlin
Photographer for beauty nude art fashion faces lingerie interieur
corino4men.de CorinoArt Photography Fotografie
420 Claudia Scholl Aktuelle Claudia
10781
Berlin
Claudia Scholl Buchkonzeption Gestalterische Konzepte Kinderkunstprojekte Illustration und Corporate Design
claudia-scholl.de Claudia Scholl Berlin Kartonzauber Grafikdesign
421 URBANIS Startseite URBANIS GmbH URBANIS
10781
Berlin
Herzlich willkommen bei der URBANIS GmbH
bvg-holding.de URBANIS Berlin Unternehmen
422 Home Chatwins Chatwin
10781
Berlin
CHATWINS: Bücher rund ums Reisen gibt es hier nach Ländern und Kontinenten sortiert. Reisen heißt:
chatwins.de Chatwin Chatwins Bruce Chatwin A
423 52. DeutschFranzösisches Volksfest Schaustellerverband Berlin e.V. Deutsch
10781
Berlin
Das mit Abstand größte jährliche Volksfest in Berlin Willkommen auf über 40.000m² Erlebnisfläche!
deutsch-franzoesisches-volksfest.de Deutsch Französisches Volksfest Laune
424 Beateberlin AGENTUR FÜR EVENTS beateberlin
10781
Berlin
beateberlin Agentur für Events und Stadterlebnisse in Berlin und Umgebung
beateberlin.de Beateberlin Agentur Agency
425 Berliner Berufsverband der Gesundheitsaufseher/Hygieneinspektoren BBGH
10781
Berlin
Der Berliner Berufsverband der Gesundheitsaufseher/Hygieneinspektoren stellt sich vor und bietet Informationsmaterial rund um den öffentlichen
bbghev.de BBGH BVH Hygiene
426 Organisationsberater Berater für Bio
10781
Berlin
Unternehmensberater für Ökologische Landwirtschaft (Biolandbau) und Biomarkt (Biohandel) ? Experte für Bio Lebensmittel und Biolandbau
bio-projektmanagement.de Bio Lebensmittel Bioprodukte
427 BeGreen Netzwerk für nachhaltiges beGreen Netzwerk für nachhaltiges Wirtschaften e.V. Verein
10781
Berlin
Alles Wissenswerte von der Historie über Ergebnisse Veranstaltungen und neueste Trends bis hin zur
begreen-net.de Verein Mitgliedschaft Beitrittserklärung
428 IOB Internationale OmnibusBetreibergesellschaft ZOB
10781
Berlin
ZOB Zentraler Omnibusbahnhof Berlin an Funkturm und Messegelände:
berlinzob.de ZOB Zentraler Omnibusbahnhof Berlin APC
429 Blauwerke verlag # groschenhefte blauwerke
10781
Berlin
Verlag aus Berlin fuer konkrete Literatur und konkrete Wissenschaft. Gebrauchstexte für die Westentasche.
blauwerke-berlin.de Blauwerke Blauwerke Berlin
430 Werbe und Vertriebsmangement GSW
10781
Berlin
Die “ FIGARO news” sind das GSW Club Magazin für die Mieter der GSW Immobilien
effektivwerbung24.de GSW Club Figaro News
431 Elena nehrmann promotion
10781
Berlin
Kultur Kommunikation
elenanehrmann.de Promotion P.r. Pr
432 MACKE Boutique Berlin
10781
Berlin
Mode ist Kultur Entsprechend diesem Motto bieten wir Ihnen stil und anspruchsvolle Mode und
macke-berlin.de
433 DigitalphotoBerlin Foto
10781
Berlin
Phototechnik Fehling Fotografie Bearbeitung Entwicklung Vergrößerung von Diabildern Digitalfotografien
digitalphoto-berlin.de Foto Fotografie Photo
434 Diethard Küster Regisseur
10781
Berlin
Diethard K¸ster Regisseur Produzent Autor Regie Produktion
diethard-kuester.de
435 HOME MEDIATION
10781
Berlin
ALEXANDER STAUBACH | MEDIATION | STAUBACHBERATUNG
staubach-beratung.de MEDIATION | KONFLIKT | KONFLIKTKLÄRUNG
436 BEOBOOKS Bücher aus Bücher
10781
Berlin
BEOBOOKS Bücher aus Serbien Katarina Belovukovic
beo-books.de Bücher Serbien
437 Bettina Willumeit | Styling bettina
10781
Berlin
innovatives kundenorientiertes Fashion Styling für die Bereiche Werbung Editorialproduktionen und Onlinevermarktung
bettina-willumeit.de Bettina Willumeit Stylistin
438 HOME
10781
Berlin
HOME
kunsttherapieraum.de
439 Joomla Toplist Hauptseite joomla
10781
Berlin
Dies ist die deutsche JoomlaTopseitenliste. Hier finden Sie die wahrscheinlich besten Seiten die mit
joomla-toplist.de Joomla Toplist Best
440 Jugendhilftweiter.de Jugend
10781
Berlin
Modellprojekt Jugendräte: Eine Homepage von den Jugendräten des Modellprojekts Jugendräte von Berlin SchönebergNord
jugend-hilft-weiter.de Jugend Hilft Weiter
441 LumpenPrinzessin ... Kinderkleidung Kinderkleidung
10781
Berlin
Die LumpenPrinzessin bietet seit über 15 Jahren Alles für Baby und Kind in gut erhaltener
lumpenprinzessin.de Kinderkleidung Kindermode Kinderschuhe
442 Herzlich Willkommen auf LittleThailand.de thai
10781
Berlin
Die neuesten und beliebtesten ThaiMassagen ThaiRestaurants Shops und mehr Mit vielen Bewertungen
little-thailand.de Thai Verzeichnis übersetzer Shops Restaurants
443 Evelyn Bornemann Berlin Berlin
10781
Berlin
Evelyn Bornemann in Berlin Physiotherapie Psychotherapie (HPG) Coach nach der TippingMethode hilft
evelyn-bornemann.de Berlin Physiotherapie Psychotherapie
444 ||| EuroKaukAsia     EuroKaukAsia e.V.
10781
Berlin
KaukasischEuropäischer Kultur und Wissenschaftsverin e.V.
eurokaukasia.de
445 Excelle.consulting | Produktions und excelle.consultin
10781
Berlin
excelle.consulting bietet kundenindividuelle Lösungen zu Fragen der strategischen Unternehmensentwicklung und der Gestaltung operativer Leistungsstrukturen sowie
excelle-consulting.de Excelle.consulting Excelle Excelle.de
446 F/21 Büro für Nora
10781
Berlin
f/21 Büro für Zukunftsfragen ist Beratungsinstitut und Denkfabrik. f/21 beobachtet die Gegenwart identifiziert
f-21.de Nora Stampfl Nora S. Stampfl
447 MEHR ALS STERNE |
10781
Berlin
Natalia Domagala
mehr-als-sterne.de
448 Investieren wie die Superreichen Investieren
10781
Berlin
Wie auch Sie schnell und einfach die Investments der Superreichen finden die nur ein
superreichtum.de Investieren Geld Anlegen
449 Mediation in Diversity Mediation
10781
Berlin
Mediation in Konfliktfällen Preisgünstige Mediationsausbildung nach anerkannten Standards von Bundesverbänden oder erfahrene Mediatoren? Kontaktieren
meddiv.de Mediation Berlin Mediationsausbildung Berlin
450 Jura Service Berlin | kaffeevollautomat
10781
Berlin
Jura Service Berlin| Kaffeemaschine u. Kaffeeautomat ReparturWartung u. Kundendienst in Berlin.Reparaturen von Kaffeemaschinen u.
jura-service-berlin.de Kaffeevollautomaten Reparatur Jura Service Kaffeemaschinen
451 Kanzlei Klaus Koblitzek homepage
10781
Berlin
homepage dokument webpage page web netz
kanzlei-koblitzek.de Homepage Dokument Webpage Page Web
452 Kanzlei Rechtsanwalt Böcker joomla
10781
Berlin
Joomla! dynamische PortalEngine und ContentManagementSystem
kanzleiboecker.de Joomla Joomla
453 Rechtsanwaltskanzlei und Notariat Michael Rechtsanwalt
10781
Berlin
Rechtsanwaltskanzlei und Notariat Michael Müller Rechtsanwalt und Notar Michael Müller in Berlin Schöneberg berät
kanzlei-mmueller.de Rechtsanwalt Notar Berlin
454 Schauspieler Coaching Berlin Karin
10781
Berlin
Mit dem KarriereTraining für Schauspieler durchstarten und dranbleiben. Die eigene Karriere lustvoll und aktiv gestalten.
karin-kleibel.de Karin Kleibel PR
455 LumpenPrinzessin ... Kinderkleidung Kinderkleidung
10781
Berlin
Die LumpenPrinzessin bietet seit über 15 Jahren Alles für Baby und Kind in gut erhaltener
kind-in-berlin.de Kinderkleidung Kindermode Kinderschuhe
456 Claudia Scholl Aktuelle Claudia
10781
Berlin
Claudia Scholl Buchkonzeption Gestalterische Konzepte Kinderkunstprojekte Illustration und Corporate Design
kartonzauber.de Claudia Scholl Berlin Kartonzauber Grafikdesign
457 Krups | Siemens | aeg
10781
Berlin
Krups | Siemens | AEG | ReparaturServiceWartung und Kundendienst in Berlin.Kaffeemaschinen und Kaffeevollautomaten
kaffeemaschine-reparatur.de Aeg Krups Siemens Kaffeevollautomaten Kaffeemaschinen
458 Home
10781
Berlin
Elzers Seiten zum Wohnungseigentumsrecht
oliverelzer.de
459 Patwork
10781
Berlin
Feinmechanik
pat-work.de
460 Peter Bruns Homepage Peter
10781
Berlin
Homepage von Peter Bruns
peterbruns.de Peter Bruns Cello
461 Rechtsanwälte PfaffHofmann u. Lee Rechtsanwalt
10781
Berlin
Die Rechtsanwaltskanzlei PfaffHofmann u. Lee legal Rechtsanwaltsgesellschaft bietet eine und zielorientierte Beratung. Schwerpunkt Wirtschaftsrecht z.B.
phl-legal.de Rechtsanwalt Rechtsanwaltskanzlei Arbeitsrecht
462 ..::Phoenix Lounge::.. Phoenix
10781
Berlin
Phoenix Lounge. Bar Restaurant Cafe in Schöneberg.
phoenix-lounge.de Phoenix Lounge Phoenix
463 Physimetron Elektronische Messtechnik Transimpedanzvers
10781
Berlin
Rauscharme analoge und digitale elektronische Messtechnik
physimetron.de Transimpedanzverstärker Pikoamperemeter Vorverstärker
464 Mobilienberlin.de living
10781
Berlin
mobilien: die schönen dinge zum leben wohnen und arbeiten! besuchen sie uns in berlinschöneberg...
mobilien-berlin.de Living Wohnen Wohnaccessoires
465 Otto Events Veranstaltungstechnik veranstaltungstec
10781
Berlin
Otto Events organisiert Ihre Veranstaltung in Berlin Brandenburg und Potsdam. Wir vermieten Veranstaltungstechnik
ottoevents.de Veranstaltungstechnik Berlin Potsdam
466 Naturheilpraxis im Hofbogen behandlung
10781
Berlin
Naturheilkunde Praxis Hofbogen Heilung Anwendung Rheuma Therapie Heilpraktiker
heilpraktikerin-schoeneberg.de Behandlung Therapie Körper
467 HALBE STUNDEN // HALF Kurzfilm
10781
Berlin
Film
halbestunden.de Kurzfilm Leere Familie
468 Flamencomeetsclassic flamenco
10781
Berlin
flamencomeetsclassic ist ein Tanztheater aus Berlin das klassische Texte Flamencomusik und Tanz zu
flamenco-meets-classic.de Flamenco Tanz Tanztheater
469 Flats Co. Flats & Co. GmbH Waldmannstr.
10781
Berlin
Eigentumswohnungen Waldmannstr. 3 BerlinLankwitz
flatsandco.de Waldmannstr. 3
470 Praxis für integrale Medizin Integral
10781
Berlin
Arztpraxis Dr. Martin Bosch BerlinSchöneberg
integralmedicine.de Integral Medicine Arztpraxis
471 Startseite
10781
Berlin
Anwälte Steuerberater PSInkasso
inkasso-in-berlin.de
472 Gerd Brendel | Journalist Gerd
10781
Berlin
Gerd Brendel Journalist
gerdbrendel.de Gerd Brendel Journalist
473 Autorin Martina Gneist CBT
10781
Berlin
Autorin Martina Gneist Projekte und Philosophie
gn-konzepte.de CBT WBT Lernkonzepte
474 Startseite hanslux Open
10781
Berlin
Beratung und Dienstleistungen für Computer Netze und ITSicherheit unter Verwendung von OpenSource Produkten
hanslux.de Open Source Freie Software
475 Theater Hans Wurst Nachfahren Grüffelo
10781
Berlin
Hans Wurst Nachfahren Theater für Kinder und Erwachsene in BerlinSchöneberg zeigt Spielplan
hasn-wurst-nachfahren.de Grüffelo Puppentheater Berlin
476 Organisationsberater Berater für Bio
10781
Berlin
Unternehmensberater für Ökologische Landwirtschaft (Biolandbau) und Biomarkt (Biohandel) ? Experte für Bio Lebensmittel und Biolandbau
handel-und-wandel.de Bio Lebensmittel Bioprodukte
477 Fachanwalt für Arbeitsrecht Berlin Fachanwalt
10781
Berlin
Fachanwalt für Arbeitsrecht Erbrecht und Versicherungsrecht in Berlin sowie Notar Berlin. Kanzlei Gäbelein
gaebelein-veith.de Fachanwalt Arbeitsrecht Versicherungsrecht
478 DFRV Regionalgruppe Berlin
10781
Berlin
| Website der Regionalgruppe Berlin des Deutschen Fundraising Verbands
fundraisingverband-berlin.de
479 Fußballwörterbuch in 7 Sprachen
10781
Berlin
FußballWörterbuch in 7 Sprachen: Homepage des Buches von Kaya Yildirim
fussballwoerterbuch.de
480 Felicitas Jacobs Theaterpädagogin Theater
10781
Berlin
Ich biete vielfältige theaterpädagogische Qualifikationen als Ausbildung oder Fortbildung initiiere theatrale Prozesse und entwickle
felicitasjacobs.de Theater Pädagogik Spiel
481 Organisationsberater Berater für Bio
10781
Berlin
Unternehmensberater für Ökologische Landwirtschaft (Biolandbau) und Biomarkt (Biohandel) ? Experte für Bio Lebensmittel und Biolandbau
conradthimm.de Bio Lebensmittel Bioprodukte
482 Startseite constant balance Fußpflege
10781
Berlin
Heilsame Behandlungen für Körper Geist und Seele Fußpflege Massagen und Heilarbeit
constant-balance.de Fußpflege Wellness Entspannung
483 Organisationsberater Berater für Bio
10781
Berlin
Unternehmensberater für Ökologische Landwirtschaft (Biolandbau) und Biomarkt (Biohandel) ? Experte für Bio Lebensmittel und Biolandbau
consultantfororganictrade.de Bio Lebensmittel Bioprodukte
484 Querschnitt Weine
10781
Berlin
Querschnitt Weine Weinhandlung in BerlinSchöneberg
querschnitt-weine.de
485 Startseite
10781
Berlin
Rechtsanwältin Sylvia PfaffHofmann: Ihr Recht in guten Händen! Spezialgebiete: Europarecht Einbuergerungsrecht und Asylverfahrensrecht
rechtsanwaeltinpfaff-hofmann.de
486 Praya ThaiMassage Startseite Massage
10781
Berlin
Praya ThaiMassage Ihre Praxis in Berlin bietet professionelle Physiotherapie und Massagen als therapeutisches
prayathai.de Massage Praxis
487 Startseite
10781
Berlin
Anwälte Steuerberater PSInkasso
ps-inkasso-berlin.de
488 Kanzlei Rechtsanwalt Böcker joomla
10781
Berlin
Joomla! dynamische PortalEngine und ContentManagementSystem
rechtsanwaltskanzlei-24.de Joomla Joomla
489 Fachanwalt Strafrecht Rechtsanwalt Fachanwalt
10781
Berlin
Fachanwalt Strafrecht Rechtsanwalt Feldkamp Berlin
rechtsanwaltskanzlei24.de Fachanwalt Strafrecht Rechtsanwalt
490 Reinigung360.de | Professionelle Gebäudereinigung Reinigung
10781
Berlin
Gebäudereinigung Büroreinigung Bauendreinigung Glassreinigung Laborreinigung Praxisreinigung Spezialreinigung Teppichreinigung
reinigung360grad.de Reinigung Reinigung Berlin
491 REISEDIENST WITTER: Tolle Reisen. Witter
10781
Berlin
REISEDIENST WITTER: Tolle Reisen. Viel Vergnügen!
reisedienst-witter.de Witter Reisedienst REISEDIENST
492 Schiek Sports Germany Bodybuilding Schiek
10781
Berlin
Offizieller Distributor Schiek Sports in Deutschland erhältlich Schiek Sports Schiek Sport Handschuhe
schiek-store.de Schiek Sport Handschuhe
493 Schiek Sports Germany offizieller Schiek
10781
Berlin
Offizieller Distributor von Schiek Produkten in Deutschland Fitness Bodybuilding Zubehör Fitnesshandschuhe Zughilfen Handgelenkschutz Bandagen
schiek-germany.de Schiek Fitnesshandschuhe Trainingsgürtel
494 HOME
10781
Berlin
Schulshirt Schulkleidung Schuluniform TShirts PoloShirts Sweatshirts Kapuzenshirts Kleidung Uniform Schule Freizeit Caps
scoolchic.de
495 Senioren Beratung Berlin Seniorenberatung
10781
Berlin
Seniorenberatung Berlin
senioren-beratung-berlin.de Seniorenberatung Pflegeheimberatung Neue
496 Datenschutzanalyse externer Datenschutzbeauftragter PrivCom Datenschutz GmbH Datenschutz
10781
Berlin
Wir organisieren als externe Datenschutzbeauftragte mit DatenschutzAudits Schulungen und Sicherheitstests datenschutzkonforme und sichere Prozesse.
privcom.de Datenschutz Audits Datensicherheit
497 PROMINENTENBAU© Prominentenbau
10781
Berlin
Erwachsene bauen mit LEGO Elementen für Kinder
prominenten-bau.de Prominentenbau Prominent DAI Lego Hellweg
498 PME PME
10781
Berlin
PME ProBau Management und Entwicklungsgesellschaft mbH
pme-gmbh.de PME ProBau Management Entwicklungsgesellschaft
499 Startseite
10781
Berlin
Rechtsanwältin Sylvia PfaffHofmann: Ihr Recht in guten Händen! Spezialgebiete: Europarecht Einbuergerungsrecht und Asylverfahrensrecht
recht24-berlin.de
500 IOB Internationale OmnibusBetreibergesellschaft ZOB
10781
Berlin
ZOB Zentraler Omnibusbahnhof Berlin an Funkturm und Messegelände:
iob-berlin.de ZOB Zentraler Omnibusbahnhof Berlin APC
501 Nina Petrick ? Autorin Nina
10781
Berlin
Nina Petrick freie Autorin für Kinder und Jugendbücher Belletristik und Kurzgeschichten. Ihr Jugendbuch
nina-petrick.de Nina Petrick Autorin
502 Digital Innovation Facilitator GuentherLange GmbH digitale
10781
Berlin
Mit Design Thinking systematisch zu kreativen Problemlösungen für das InternetBusiness: Jens Otto Lange moderiert Ideen
jensottolange.de Digitale Innovation Kreativität
503 Berlinatnight.de :: Stadtmagazin für Musikkalender
10781
Berlin
NightlifeGuide für Berlin: Clubs Bars Parties Tickets Kinoprogramm Konzerte
berlinatnight.de Musikkalender Movie Genießen
504 Www.djembeberlin.de
10781
Berlin
Du möchtest die westafrikanische Trommel Djembe spielen lernen. Hier findest du eine Liste von Lehrern
djembe-berlin.de
505 Naturheilpraxis im Hofbogen behandlung
10781
Berlin
Naturheilkunde Praxis Hofbogen Heilung Anwendung Rheuma Therapie Heilpraktiker
hofbogen.de Behandlung Therapie Körper
506 Theater Hans Wurst Nachfahren Grüffelo
10781
Berlin
Hans Wurst Nachfahren Theater für Kinder und Erwachsene in BerlinSchöneberg zeigt Spielplan
hans-wurst-nachfahren.de Grüffelo Puppentheater Berlin
507 Berliner Berufsverband der Gesundheitsaufseher/Hygieneinspektoren BBGH
10781
Berlin
Der Berliner Berufsverband der Gesundheitsaufseher/Hygieneinspektoren stellt sich vor und bietet Informationsmaterial rund um den öffentlichen
hygieneinspektoren.de BBGH BVH Hygiene
508 Kanzlei Rechtsanwalt Böcker joomla
10781
Berlin
Joomla! dynamische PortalEngine und ContentManagementSystem
kanzlei-boecker.de Joomla Joomla
509 ..::Phoenix Lounge::.. Phoenix
10781
Berlin
Phoenix Lounge. Bar Restaurant Cafe in Schöneberg.
phoenixlounge.de Phoenix Lounge Phoenix
510 Rosenscharf und Edelsüß Catering ZOE
10781
Berlin
Restaurant ZOE Berlin. Asiatische und mediterrane Küche zwischen Hackeschem Markt und Alexanderplatz in Berlin Mitte.
rosenscharf-edelsuess.de ZOE Restaurant Lounge
511 Tucanu Webseiten leicht Jürgen
10781
Berlin
tucanu der Weg zur eigenen Homepage leicht zu haben einfach zu bedienen
tucanu.de Jürgen Kubens Beratung
512 Nicolai Thärichen Komponist Arrangeur Thärichens
10781
Berlin
Nicolai Thärichen Komponist Arrangeur Pianist Aktuelles 2009 Thärichens Tentett Konzerte
thaerichen.de Thärichens Tentett Konzerte Myspace
513 Felicitas Jacobs Theaterpädagogin Theater
10781
Berlin
Ich biete vielfältige theaterpädagogische Qualifikationen als Ausbildung oder Fortbildung initiiere theatrale Prozesse und entwickle
theaterpaedagogische-kunst.de Theater Pädagogik Spiel
514 URBANIS Startseite URBANIS GmbH URBANIS
10781
Berlin
Herzlich willkommen bei der URBANIS GmbH
urbanis-berlin.de URBANIS Berlin Unternehmen
515 Ihre Website erstellen
10781
Berlin
Alles rund um die Website. Vorkonfiguriert oder maßgeschneidert für lokale Unternehmen aus Dienstleistung Handwerk
spreelink.de
516 Studio la voce Sängerin
10781
Berlin
Stefania Erzmoneit Habsburgerstrasse 5 10781 Berlin fon: 03021 99 68 23 fax:
studiolavoce.de Sängerin Sängerin Klang
517 Home Andrea Schlinkert Queer
10781
Berlin
Dies ist die Seite von Andrea Schlinkert Tanzlehrerin und Djane in Berlin.
tangoschlampen.de Queer Tango Queer Argentino
518 Willkommen auf der Startseite Tango
10781
Berlin
Tango Rueda eine Begegnung in vier Takten in Berlin
tangorueda.de Tango Rueda Berlin
519 VIEV | NEW
10781
Berlin
VIEV ? das sind Wagner Werner ein deutschchilenisches Designerkollektiv aus Berlin.
viev.de
520 Excelle.consulting | Produktions und excelle.consultin
10781
Berlin
excelle.consulting bietet kundenindividuelle Lösungen zu Fragen der strategischen Unternehmensentwicklung und der Gestaltung operativer Leistungsstrukturen sowie
excelle.de Excelle.consulting Excelle Excelle.de
521 Wanderreisen Pierolt Wanderreisen
10781
Berlin
Wanderreisen Pierolt Wandern im Spreewald Hüttenwanderung in den Lienzer Dolomiten Wandern rund
wanderreisen-pierolt.de Wanderreisen Pierolt Wandern Im
522 SammlungsVerkauf coupon
10781
Berlin
Webdealscout Suche deine Gutscheine Deals und Rabatte
webdealscout.de Coupon Gutschein Geschenk
523 Theo G. Gilbers Sexualpädagoge
10781
Berlin
Sexualpädagogische Fortbildung für pädagogische und psychosoziale Fachkräfte
theogilbers.de Sexualpädagoge Und Sexualtherapeut
524 Schmuckmanufaktur Berlin Goldschmiedin Schmuckmanufaktur
10781
Berlin
Schmuckmanufaktur Berlin Goldschmiedin Schmuck Trendart
schmuckmanufaktur-berlin.de Schmuckmanufaktur Berlin Goldschmiedin
525 LumpenPrinzessin ... Kinderkleidung Kinderkleidung
10781
Berlin
Die LumpenPrinzessin bietet seit über 15 Jahren Alles für Baby und Kind in gut erhaltener
schuhchen.de Kinderkleidung Kindermode Kinderschuhe
526 Robert Berghoff Berlin robert
10781
Berlin
Mit einfachem Blick auf die Dinge: Bildgestaltender Kameramann Director Of Photography Cinematographer
robertberghoff.de Robert Berghoff Filme
527 Schuldnerberatung Berlin Schuldenberatung Berlin Schuldnerberatung
10781
Berlin
? Schuldnerberatung Berlin vom Anwalt Privatinsolvenz Restschuldbefreiung Verbraucherinsolvenz Schuldenberatung Verbraucherinsolvenzverfahren. Rechtsanwalt Pillig Berlin
restschuldbefreiung.de Schuldnerberatung Berlin Privatinsolvenz Restschuldbefreiung Schuldenberatu
528 HOME
10781
Berlin
Schulshirt Schulkleidung Schuluniform TShirts PoloShirts Sweatshirts Kapuzenshirts Kleidung Uniform Schule Freizeit Caps
schulschick.de
529 Home ? Goldschmiede Schmuckbotschaften
10781
Berlin
Goldschmiede Schmuckbotschaften aus Berlin entwirft individuellen Schmuck!
schmuck-gewecke.de
530 Startseite
10781
Berlin
Anwälte Steuerberater PSInkasso
schygulla-inkasso.de
531 Gabriele Steiner Praxis für Ärztin
10781
Berlin
Gabriele Steiner Praxis für Homöopathie am Winterfeldtplatz in BerlinSchöneberg Ärztin für Allgemeinmedizin
steiner-gabriele.de Ärztin Homöopathie Homoeopathie
532 Stephan Szasz Startseite Über
10781
Berlin
Ich bin Stephan Szasz aus Berlin und erzähle euch auf dieser Webseite ein paar Geschichten
stephan-szasz.de Über Mich Hobby
533 Patwork
10781
Berlin
Feinmechanik
viosk.de
534 52. DeutschFranzösisches Volksfest Schaustellerverband Berlin e.V. Deutsch
10781
Berlin
Das mit Abstand größte jährliche Volksfest in Berlin Willkommen auf über 40.000m² Erlebnisfläche!
volksfest-berlin.de Deutsch Französisches Volksfest Laune
535 Apartment Dr. Claudia Malzfeldt
10781
Berlin
Startseite
westerlandapartment.de
536 Wirtschaftsmediatoren Berlin Wirtschaftsmediat
10781
Berlin
Wirtschaftsmediatoren Berlin
wirtschaftsmediatoren-berlin.de Wirtschaftsmediator Mediator Madiation Spannagel Eckolt
537 Home Musik
10781
Berlin
Kinderlieder Wir Kinder vom Kleistpark gute Musik für Kinder Konzerte für Kinder
wirkindervomkleistpark.de Musik Für Kinder Kinderkonzerte
538 Ölmühle Berlin Olivenöl
10781
Berlin
Olivenöl aus der ölmühle Berlin Schöneberg. Bei uns finden Sie ein Sortiment von über 60 meist
xn--lmhleberlin-qfb4f.de Olivenöl Olivenholz Balsamico
539 Home
10781
Berlin
Sachverständiger von der Handwerkskammer Berlin öffentlich bestellter und vereidigter Sachverständiger für das Dachdeckerhandwerk Steildacheindeckungen
xn--stutenbumer-heinz-wqb.de
540 Brautkleider alles für Kalamov und Kalamova GbR
10781
Berlin
Bei uns finden Sie moderne und günstige Brautkleider Abendmode Accessoires Dessous. Schneller
weddingssecrets.de
541 Anke Sevenich | Schauspielerin
10781
berlin
Anke Sevenich gehört zu den besten wenn auch eher unauffälligen Schauspielerinnen des deutschen Fernsehens
anke-sevenich.de
542 Restaurant AltÖsterreich Startseite Restaurant
10781
Berlin
Restaurant AltÖsterreich heißt: Echtes Wiener Schnitzel duftende Frittatensuppe eine ordentliche Portion Kaiserschmarrn oder
alt-oesterreich.de Restaurant AltÖsterreich Alt
543 Startseite Queer
10781
Berlin
Musikversierte und begeisterte Djane mit breitgefächertem Musikrepertoire für jegliche Anlässe buchbar. Ob Standard und Lateinmusik
andrea-schlinkert.de Queer Tango Queer Argentino
544 Welcome to Berlin Gym aktiv
10781
Berlin
Auf diesen Seiten findet Ihr alle Informationen rund um den Verein Berlin Gym ? Verein
berlin-gym.de Aktiv Fitness Kampfsporttraning
545 Berliner Berufsverband der Gesundheitsaufseher/Hygieneinspektoren BBGH
10781
Berlin
Der Berliner Berufsverband der Gesundheitsaufseher/Hygieneinspektoren stellt sich vor und bietet Informationsmaterial rund um den öffentlichen
bhbbev.de BBGH BVH Hygiene
546 Bing Ma Communication China
10781
Berlin
Neue Seite
bingma.de China Business Marketing
547 Schreibcoaching in Berlin Schreibcoaching
10781
Berlin
Schreibcoaching: Sie schreiben gerade an einer wissenschaftlichen Abschlußarbeit? Bringen Sie sich mit Schreibcoaching wieder in
faden-verloren.de Schreibcoaching Wissenschaftliche Abschlussarbeit
548 Ferienhaus Wittingen
10781
Berlin
Ferienhaus Wittingen
ferienhaus-wittingen.de
549 Organisationsberater Berater für Bio
10781
Berlin
Unternehmensberater für Ökologische Landwirtschaft (Biolandbau) und Biomarkt (Biohandel) ? Experte für Bio Lebensmittel und Biolandbau
consultantorganictrade.de Bio Lebensmittel Bioprodukte
550 Home
10781
Berlin
Brandenburger Tor Variationen mit FotoGalerie TorVariationen Brandenburg Berlin Logo
brandenburger-torheiten.de
551 Floorwalker.de Einfach. Schnell. floorwalker
10781
Berlin
Ein Floorwalker bietet nicht nur bei der Einführung neuer Software effektiven Support sondern auch
floorwalker.de Floorwalker Floorwalking Office
552 FHING Aktuell Werbung
10781
Berlin
für heute ist nichts geplant
fhing.de Werbung Postkarte Schwul
553 Restaurant AltÖsterreich Startseite Restaurant
10781
Berlin
Restaurant AltÖsterreich heißt: Echtes Wiener Schnitzel duftende Frittatensuppe eine ordentliche Portion Kaiserschmarrn oder
diodata-restaurant.de Restaurant AltÖsterreich Alt
554 Startseite House of House of Queer Sisters e.V. Queer
10781
Berlin
Wir sind Sisters und Guards die Gutes tun und dies überall wo wir gebraucht
house-of-queer-sisters.de Queer Sisters Schwulen
555 OnlineShop Bastelkits. Made
10781
Berlin
Wir haben ein Kit entwickelt mit dem man gleich loslegt in dem gute
bastelkits.de
556 Linda Sixt Linda
10781
Berlin
Linda Sixt
linda-sixt.de Linda Sixt
557 Lofts Co. Lofts & Co. GmbH lofts
10781
Berlin
Lofts Co. Best in Lofts!
loftsandco.de Lofts Berlin Dachwohnung Berlin
558 Antiquariat Mertens und Pomplun Antiquariat Mertens & Pomplun GbR Antiquariat
10781
Berlin
Antiquariat antiquarische Bücher OriginalPhotographien Fotografie Plakate Landkarten Luxuspapier
mp-rarebooks.de Antiquariat Antiquarische Bücher
559 MR Patterns Willkommen Nähen
10781
Berlin
Mr Patterns das Schnittstudio fuer SelberMacher
mrpatterns.de Nähen Schnittmuster Schnittkurs
560 Psychotherapie und Coaching in
10781
Berlin
Sie suchen einen Psychotherapeuten oder Coach in Berlin? Sie sind in einer schwierigen privaten oder
monika-holz.de
561 Gaastra Napapijri Diesel online Markenmode
10781
Berlin
Fashiontex 24 Online Shop. Ihr Designer Online Shop mit Markenbekleidung wie Gaastra Jacke Poloshirt
fashiontex24.de Markenmode Gaastra Napapijri
562 Heilpraktikerin in Berlin Schöneberg Homöopathie
10781
Berlin
Isabel Blume Heilpraktikerin Klassische Homöopathie und Shiatsu in Berlin
isabel-blume.de Homöopathie Klassische Homöopathie
563 Http://www.KinderladenKonfetti.de
10781
Berlin
Mitten im Schöneberger Winterfeldtkiez in Berlin liegt der kleine bunte Kinderladen Konfetti. Zwei Erzieherinnen
kinderladen-konfetti.de
564 MUTTER RESTAURANT BAR BERLIN thai
10781
Berlin
Die MUTTER in Berlin Schöneberg bietet vom Frühstück im Außenbereich thailändischer Küche und Cocktails
mutter-berlin.de Thai Bar Berlin Thaifood Frühstück
565 Zuhause Mundgerecht Magazin Save
10781
Berlin
MUNDGERECHT ist mehr als nur ein Magazin. Eigentlich sind wir ein soziales Startup mit einer
mundgerecht-magazin.de Save Food Nachhaltiges Essen
566 Home Siebergraphic Siebergraphic Berlin
10781
Berlin
siebergraphic macht die Grafik für Sie in Berlin Nürnberg und Umgebung. Egal was
siebergraphic.de Berlin Grafik Illustration
567 Schlüsseldienst Tempelhof Endpreise direkt Schlüsseldienst
10781
Berlin
Günstiger Schlüsseldienst für Tempelhof. Probleme mit Ihrem Türschloss? Kein Problem. Wir helfen kostengünstig schnell
schluesseldienst-tempelhof-berlin.de Schlüsseldienst Tempelhof Ihr Schlüsseldienst
568 StoppRitalin | Die ScherretMethode Wachstumsstörunge
10781
Berlin
Bei immer mehr Kindern und Jugendlichen in Deutschland stellen Ärzte Aufmerksamkeits und Hyperaktivitätsstörungen fest.
stopp-ritalin.de Wachstumsstörungen ADHS Ritalin StoppRitalin ScherretMethode
569 HOME
10781
Berlin
HOME
ulrikespeyerer.de
570 Wellfina Wellness Fitness Naturheilkunde
10781
Berlin
Angebot: Personal Training Ernährungsberatung Mesotherapie (Anti Aging) Kinesiologie Neuraltherapie Schröpfen
wellfina.de Naturheilkunde Heilpraktiker Personaltraining

Ergebnisse der Bewertung der Themenseite zu Neueröffnungen, verkaufsoffene Sonntage, Gutscheine und Coupons in Berlin
33 Bewertungen ergeben 4 StadtBranche Punkte

Berlin
Berlin ist die Bundeshauptstadt der Bundesrepublik Deutschland und zugleich eines ihrer Länder. Die Stadt Berlin ist mit rund 3,5 Millionen Einwohnern die bevölkerungsreichste und mit 892 Quadratkilometern die flächengrößte Gemeinde Deutschlands sowie nach Einwohnern die zweitgrößte der Europäischen Union. Sie bildet das Zentrum der Metropolregion Berlin/Brandenburg und der Agglomeration Berlin . Der Stadtstaat unterteilt sich in zwölf Bezirke. Neben den Flüssen Spree und Havel befinden sich im Stadtgebiet kleinere Fließgewässer sowie zahlreiche Seen und Wälder.

LandkreisKreisfreie Stadt Berlin
BundeslandBerlin
Postleitzahl10789
Vorwahl030
Bahnhof
Finanzamt

Berlin Karte

Berlin Karte Kreisfreie Stadt Berlin Berlin Berlin Stadtplan Kreisfreie Stadt Berlin Berlin