Brandenburg

Schmuck in Neuenhagen bei Berlin My Address › Landkreis Märkisch-Oderland

Schmuck Neuenhagen bei Berlin

Landkreis Märkisch-Oderland
1 van branch Schmuck

12527
Berlin
Du bist auf der Suche nach außergewöhnlichen, handgefertigten Schmuckstücken aus Holz? Dann schau Dir unsere wundervollen Produkte..
vanbranch.de/ My Address Web Condensed Courier Holz Accessoires Plugs
2 Haeger GmbH - Goldankauf Berlin Edelmetall An-

12207
Berlin
Vertrauen Sie auch beim Goldankauf auf die Kompetenz unserer Mitarbeiter. In diskreter und sicherer Atmosphäre nehmen sie..
goldankauf-haeger.de/berlin/ Berlin Goldankauf Gmb Haeger Gold Daten Münzen Mail
3 Wohnungsauflösung Berlin | Beier & Pechke Wohnungsauflösung

14167
Berlin - Tempelhof
Zuverlässige Wohnungsauflösung durch erfahrendes Fachpersonal und modernen Fahrzeugen. Hierbei handelt es sich um Mitarbeiter mit mehreren Jahren..
beier-peschke.de/ Berlin Peschke Nachlassverwertung Beier Wohnungsauflösung Gmb Web Erfahrung
4 SCHMUCKE Galerie-Werkstatt für zeitgenössischen Schmuck und Galerie Schmuck

10625
Berlin
schmucke.net Schmucke Arbeiten Berlin Galerie Werkstatt Künstler Individualität News
5 Halleluja Styles Schmuck

10559
Berlin
Hochwertiger Christlicher Schmuck - Ob für die eigene Hochzeit als Brautschmuck - Finde das perfekte Geschenk für..
halleluja-styles.de Z Y
6 Global Investment - Schließfachvermietung in Berlin Investment

10711
Berlin
Bankschließfach mieten sicher & mit Versicherung Die Zeiten sind nicht mehr so sicher, wie vor vielen Jahren noch...
safes-berlin.de/ Global Investment Sicherheit Schutz Preisliste Berlin Aufbewahrung Geld
7 Avonprodukte Kosmetik Schmuck

10365
Berlin
Ich bin Avonberaterin in Berlin. NEU! Ihr könnt jetzt online bei mir bestellen, mich aber natürlich auch persönlich..
avon.de/store/silke
8 Schmuckankauf Berlin Lichterfelde Juwelier Haeger Juwelier

12207
Berlin
Möchten Sie Ihr Altgold verkaufen? Sind Sie im Besitz von altem Schmuck, Zahngold oder Industriegold? Dann überlegen..
juwelier-haeger.de/berlin Schmuck Gold Geschenke Diamanten Berlin Rolex Modi Vertrauen
9 Schmuckankauf Berlin Juwelier Haeger Juwelier

10711
Berlin
Sie möchten Platinschmuck veräußern? Sie wollen einen Ring verkaufen? Ihr alter Silberschmuck entspricht nicht mehr Ihrem Geschmack?..
juwelier-haeger.de/berlin Schmuck Gold Geschenke Diamanten Berlin Markenschmuck Freundschaftsringe Schmückendes
10 Antiquitäten Schmuck und Altgold Ankauf Berlin Antiquitäten

12207
Berlin
Antique Galerie: Hier können Sie Antiquitäten, Altgold, Schmuck und Diamanten in Berlin Lichterfelde verkaufen. Der Schmuckankauf der..
antiquegalerie.de/standorte/antiquitaeten-berlin-lichterfelde Antiquitäten Kurfürstendamm Berlin Händler Verkauf Ankauf Info@antiquegaleriede Finden
11 Antiquitäten Schmuck und Altgold Ankauf Berlin Antiquitäten

10711
Berlin
Antique Galerie: Hier können Sie Antiquitäten, Altgold, Schmuck und Diamanten in Berlin am Kurfürstendamm verkaufen. Der Schmuckankauf..
antiquegalerie.de/standorte/antiquitaeten-berlin Z Y
12 Goldankauf Berlin Goldankauf Haeger GmbH Goldankauf

10711
Berlin
Der Goldankauf in Berlin: In vielen Haushalten schlummern Werte, die ihren Besitzern gar nicht bekannt sind. Möglich..
goldankauf-haeger.de/berlin Berlin Ankauf Goldmünzen Goldankauf Kaufen Verkaufen Anfahrt Goldbarren

Kostenloses Buch Tipps & Tricks für Arbeitswelt & Leben:
Erhalten Sie Ihr Buch "Tipps und Tricks für Arbeitswelt und Leben"
kostenlos per E-Mail als .pdf Datei:


13 Mode Onlineshop für Damen Herren und Textilien Onlineshop

13595
Berlin
Sie suchen Mode die nicht teuer ist? Dann freuen wir uns, Ihnen unsere Artikel zu präsentieren.Wir führen..
easy-klamotten.de Dessous Anmelden Set Warenkorb Eur Schmuck Schuhe Weihnachtsmütze
14 ute köhnen schmuck - galerie und Goldschmiede

10115
Berlin
Goldschmiede, Werkstatt für Anfertigungen, Umarbeitungen und Reparaturen von Schmuck. Alle Edelmetalle und Edelsteine. Die Galerie zeigt Arbeiten von..
ute-koehnen.de Schmuck Galerie Werkstatt Berlin Khnen Köhnen Ute Silber
15 ULRIKE POELK SCHMUCK ulrike
10999
Berlin
Ulrike Poelk | Schmuck | Produkt ... deutsch english SCHMUCK attraente chainge playline PRODUKT mutabilon wallchair KONTAKT IMPRESSUM
ulrikepoelk.de Ulrike Poelk Schmuck Produkt Design
16 Laurea Schmuck Laurea
13353
Berlin
Laurea Schmuck bietet edelsten Schmuck moderne Trauringe und Luxusuhren bzw. Markenuhren. ... Hersteller Im Onlineshop von Laurea Schmuck finden Sie eine grosse Vielfalt an modischen Uhren
laurea-schmuck.de Laurea Schmuck Altgold Berlin Luxusuhren Berlin
17 Moutell: Marion Moutell Malerei Marion
10777
Berlin
Malerei und Schmuck ... Marion Moutell Malerei und Schmuck Startseite Schmuck Malerei Fliesen Kontakt
marion-moutell.de Marion Moutell Moutell Moderne Malerei Art
18 Göttlicher Schmuck Startseite Juwelier
16321
Bernau bei Berlin
Göttlicher Schmuck Inh. Eliane Göttlich Jedes Stück ein Unikat Handgefertigte Schmuckstücke aus NespressoKapseln Aluminiumdraht FotoSchmuck u.v.m. finden Sie in meinem Shop. ... Navigation aufklappen/zuklappen Startseite Foto-Schmuck Kettenanhänger Armschmuck Haarspangen
goettlicher-schmuck.de Juwelier Schmuckhändler Unikate Schmuckstücke Eheringe
19 Perlengöttin Perlenketten und Perlengöttin
14165
Berlin
Perlenketten und Schmuck. Kreatives arbeiten und Workshops. ... Perlengöttin – Perlenketten und Schmuck aus Berlin. Perlenketten Schmuck Kreatives Arbeiten
perlengoettin.de Perlengöttin Perlen Schmuck Ketten Kreativ
20 Salome Schmuck Modeschmuck Schmuck
10629
Berlin
Edlen Schmuck in einzigartigen Designs online kaufen bei Salome Schmuck ? ? ? ? ? Gratis Rückversand ? Schnelle Lieferung ? Handmade with Love ? ... in Ihrem Browser zu aktiveren. Salome Schmuck Individueller Schmuck handgefertigt in Berlin Tage Rückgaberecht
salome-schmuck.de Schmuck Modeschmuck Online Kaufen Berlin
21 Designeruhr.de Informationen rund MSP Concept GmbH & Co. KG uhren
10719
Berlin
Informationen rund um uhren armbanduhren wanduhren schmuck ... designeruhr Uhren Armbanduhren Wanduhren Schmuck Alle aktuellen Meldungen Wie sieht
designeruhr.de Uhren Armbanduhren Wanduhren Schmuck
22 Digitaluhr.de Informationen rund MSP Concept GmbH & Co. KG uhren
10719
Berlin
Informationen rund um uhren armbanduhren wanduhren schmuck ... digitaluhr Uhren Armbanduhren Wanduhren Schmuck Alle aktuellen Meldungen Wie sieht
digitaluhr.de Uhren Armbanduhren Wanduhren Schmuck
23 Www.rosenvogel.de *** Schmuck Schmuckdesign
13187
Berlin
Rosenvogel Schmuck und Accessoires. ...Kleinserien Einzelstücke und Auftragsarbeiten ... von Schmuck und textilen Accessoires. Unter dem Label Rosenvogel entstehen Kleinserien und Einzelstücke sowie
rosenvogel.de Schmuckdesign Schmuck Accessoire Accessoires Haarschmuck
24 StarBijou Uhren und Schmuck schmuck
10625
Berlin
Trollbeads Schmuck Daniel Wellington Uhren GÜNSTIG ? SICHER kaufen ? Gratis Versand in DE ? BlitzVersand ? Jetzt einfach Schmuck von Trollbe... ... Service rund um Schmuck und Uhren. Unser Store in Berlin Goethestr. Berlin Mo-Fr. - -
star-bijou.de Schmuck Uhren Armband Ringe Ring
25 Uhren Schmuck uhren
12489
Berlin
'Seit 1996 besteht das Geschäft Uhren und Schmuck von Birgitt Schimmelpfennig in Berlin Adlershof. Mit über 40 Jahren Berufserfahrung können Sie hier sämtliche Uhren reparieren / restaurieren oder Schmuck ... Uhren Schmuck Wir sind umgezogen! Inh. Birgitt Schimmel­pfennig Werkstatt Verkauf
birgitt-schimmelpfennig.de Uhren Reparatur Berlin Schmuck Anfertigung Berlin Festina
26 Schmuckhaendler.de Informationen rund MSP Concept GmbH & Co. KG Schmuck
10719
Berlin
Informationen rund um Schmuck ringe uhren ketten ohrringe ... schmuckhaendler Schmuck Ringe Uhren Ketten Ohrringe Alle aktuellen Meldungen Shops
schmuckhaendler.de Schmuck Ringe Uhren Ketten Ohrringe
27 Grandma's Paradise Schmuck Grandma´s
10717
Berlin
Grandma's Paradise Schmuck aus Briefmarken. SchmuckStücke zum Anfassen Probieren und Kaufen. SchmuckStücke aus Briefmarken laminierte oder lackierte Postwertzeichen aus aller Welt kreativ verwandelt in schmückende Unikate ... Grandma's Paradise Schmuck-Kollektion aus Briefmarken Home Ohrstecker Ohrhänger Perlenarmbänder
grandmas-paradise.de Grandma´s Paradise Grandmasparadise Schmuck Schmuck Aus Briefmarken Unikate
28 SchmuckFun Ihr online SchmuckFun
12353
Berlin
Schmuck Fun steht im Angebot für Silberschmuck Ohrringe und Ohrstecker. Goldschmuck Ringe und Anhänger mit und ohne Steinbesatz. Perlenschmuck Perlenanhänger Perlenringe und Perlen Ohrringe. Uhren Damenuhren ... Passwort ? Passwort vergessen ? Neu hier? Jetzt registrieren Schmuck - Goldschmuck - Perlenschmuck
schmuck-fun.de SchmuckFun Schmuck Goldschmuck Perlenschmuck Silberschmuck
29 Bettelarmband Online Shop – Schmuck
12357
Berlin
Bettelarmband Schmuck Online Shop für Charms Schmuck. Bettelarmbänder und BettelarmbandAnhänger bzw. Charms Anhänger aus Silber bzw. 925er Silber goldplattiert. ... verrät begrüßen wir hier vor allem die Freunde von Charm Schmuck. Wir bieten Ihnen ausschließlich Charms
bettelarmband-schmuck.de Schmuck Schmuck Shop Bettelarmband Charms Shop
30 Chamilia Armband Schmuck zum Chamilia
10623
Berlin
Alles über Chamilia Armband und Armbänder Chamilia Charms und Shops wo man den Schmuck kaufen kann. ... Armband-chamilia Chamilia Willkommen Chamilia Chamilia ist eine Schmuck Design Firma aus den USA
armband-chamilia.de Chamilia Schmuck Armband Armbänder Händler
31 Goldschmiede Stratmann GmbH Schmuck
13465
Berlin
Goldschmiede Stratmann GmbH Ihr Goldschmied für Schmuck und Edelsteine aller Art Goldschmiede Berlin ... Startseite Virtueller Rundgang Schmuck Innovativer Schmuck Edelsteinlexikon Anlagediamanten
stratmanngold.de Schmuck Uhren Schmuck Handel Schmuck Goldschmuck Silberschmuck Modeschmuck Goldschmied
32 CorAArt Skulpturen und MammutElfenbein
13156
Berlin
Skulpturen und UnikatSchmuck aus Naturmaterialien (MammutElfenbein Knochen Geweih und Taguanuss) sowie Restauration von Chryselephantinen Figuren ... Auf diesen Seiten zeige ich Ihnen Skulpturen und Schmuck aus meinen Kollektionen die ich aus Naturmaterialien
cora-art.de MammutElfenbein Skulpturen Schmuck Galerie Elfenbeinschnitzer
33 Schmuckmanufaktur Berlin Goldschmiedin Schmuckmanufaktur
10781
Berlin
Schmuckmanufaktur Berlin Goldschmiedin Schmuck Trendart ... Freie Schmuckmanufaktur Berlin Hier entsteht die Internetseite von www.schmuckmanufaktur-berlin
schmuckmanufaktur-berlin.de Schmuckmanufaktur Berlin Goldschmiedin Schmuck Trendart
34 Domain juweliereberlin.de steht zum Impressum Harold Dienstleistungs GmbH Juwelier
10115
Berlin
Juwelier Juweliere Gold Silber Schmuck Uhren Diamanten Trauringe Berlin ... " ist leicht zu finden. Überzeugen Sie sich selbst! Stichworte Juwelier Berlin Goldschmied Berlin Schmuck
juweliere-berlin.de Juwelier Juweliere Gold Silber Schmuck Uhren Diamanten Trauringe Berlin
35 Goldankauf Schmuck Profi Kostenlose
12107
Berlin
Gold Bruchgold Goldschmuck Zahngold Silber Platin Schmuck Luxusuhren Antiquitäten. Kostenlose Bewertung und beste Preise. ... Navigation überspringen DE FR EN Der seriöse Händler in Ihrer Nähe! Ankauf in Berlin
schmuck-profi.de Kostenlose Bewertung Ankauf Edelmetall Schmuck
36 SCHMUCK UND KUNST SCHERK Berlin
12207
Berlin
In meiner GoldschmiedeWerkstatt in Berlin stelle ich UnikatSchmuck aus edlen Materialien her der von der Kunst inspiriert ist. In meinem Atelier male ich mit Acrylfarben/Mischtechnik auf Leinwand von gegenständlich ... Navigation loading... Toggle navigationMenü Schmuck Kunst SCHERK individuell und anders HOME
gabriele-scherk.de Berlin Schmuck Ring Ohrring Ohrstecker
37 1. KFZ Pfandleihhaus Berlin Inh. AAAA. & M. Schadow OHG KFZ
12247
Berlin
1. KFZ Pfandleihhaus in Berlin für Autos Motorräder. Leihhaus für Schmuck Wertsachen Goldankauf und KFZBarankauf ... . KFZ Pfandleihhaus in Berlin für Autos Motorräder Leihhaus für Schmuck Wertsachen
1-kfz-pfandleihhaus.de KFZ Leihhaus Pfandkredit Autos Motorräder
38 Schatzprofi Ankauf u. schatzprofi
12105
Berlin
Wir kaufen Ihre alten Pelze Altgold Schmuck Diamanten Münzen Tafelsilber Gemälde Porzellan Antiquitäten und Nachlässe. Machen Sie Ihre Schätze zu barem Geld! ... Über Uns Kontakt Schatzprofi kauft alles an Pelze Altgold Schmuck Diamanten Münzen
schatzprofi.de Schatzprofi Schatz Profi Ankauf Bewertung Von Goldmünzen Silber Gold
39 PREMIUM UPCYLING ? exklusive nobrands GmbH nobrands
13403
Berlin
Grösster deutschsprachiger Einkaufshelfer rund um Nachhaltigkeit und Originalität: Mode Taschen Schuhe Schmuck Naturkosmetik Möbel Wohnen ... Mode Accessoires Schmuck Design PREMIUM UPCYCLING + RECYCLING Exklusive und einzigartige Upcycling
nobrands.de Nobrands Brands Ratgeber Einkaufshelfer Nachhaltigkeit
40 Dunkelwelt Gothicshop Gothic Gothic
10247
Berlin
Dunkelwelt Gothicshop Laden und Onlineshop für Gothic Kleidung Accessoires und Schmuck von Queen of Darkness Neccessary Evil ReAgenz Black Pistol und vielen weiteren Szenemarken in ... Gothicshop Berlin Die aktuelle Winterkollektion von Queen of Darkness Gothic Kleidung von RE-AGENZ
dunkelwelt-laden.de Gothic Kleidung Schmuck Acessoires Onlineshop Bestellen Laden Berlin Kaufen
41 Main : temur: Schmuck Schmuck
10119
Berlin
... Schmuck - Galerie mit Werkstatt GALERIE Aktuelles Einblicke Künstler Ausstellungen SCHMUCK Schmuck
temur-schmuck.de Schmuck Ausgefallener Schmuck Moderner Schmuck Schmuck
42 Sentiment Schmuck Home unikatschmuck
10245
Berlin
Wie man sich schmückt so fühlt man denn Schmuck ist vor allem Gefühlssache. Schmuck als Medium sein Innerstes nach aussen zu tragen in der schönsten vollendeten Form ... "Wie man sich schmückt so fühlt man denn Schmuck ist vor allem Gefühlssache". Schmuck
sentiment-schmuck.de Unikatschmuck
43 :: SILBERSTEIN :: Schmuck Silber
10435
Berlin
Schmuck + Kunst für kreative Leute. Edelsteine Natursteine Perlen Silber und Gold sind die Zutaten für unsere ausgefallenen und modischen Schmuckkreationen.
silberstein-berlin.de Silber Gold Steine Perlen Edelsteine
44 Willkommen bei der Goldschmiedin Schmuck
10629
Berlin
Unikate Schmuck Objekte von Gisela SeibertPhilippen Berlin
seibertphilippen.de Schmuck Goldschmuck Ringe Ketten Armreifen
45 Schmuck zu günstigen Preisen artvera GmbH & Co. KG
10627
Berlin
Jacolia.de: OnlineSchmuckshop für Damen versandkostenfrei und einfach Schmuck aus aller Welt bestellen. 60 Tage Rückgabe möglich. ... Finden Sie dekorative und modische Anhänger für Ihre Halsketten! zu den Anhängern Schmuck
jacolia.de
46 Perlenfarm Berlin Schmuck Perlen
10707
Berlin
Perlen Schmuck individuelle Beratung Service Nähe Ku'damm Berlin [10707 Berlin]
perlenfarm-berlin.de Perlen Schmuck Service Beratung Kurfürstendamm
47 Motorclothes Berlin GmbH | Motorclothes Berlin GmbH berlin
10719
Berlin
Im Onlineshop der Motorclothes Berlin GmbH finden Sie Motorradbekleidung Kleidung Schmuck Uhren Geschenkartikel Collectibles der Marken HarleyDavidson® Belstaff® ROKKER® und vieles mehr! ... ) - Damenhandschuhe - Herrenhandschuhe Gürtel/Bags/Wallets Accesoires/Schmuck Collectibles (
motorclothes-berlin.de Berlin Mode Fashion Style Shirts
48 Schmuckschmiede Berlin Völker Goldschmiede
10625
Berlin
Die Schmuckschmiede Völker ist eine Goldschmiede und fertigt individuellen DesignerSchmuck in Berlin ... Schmuck Unikate von der Goldschmiedin In meiner Schmuckschmiede in Berlin-Charlottenburg finden
schmuckschmiede-berlin.de Goldschmiede Designerschmuck Schmuck Goldschmied
49 SCUDERI · Schmuck Ringe Schmuck
10405
Berlin
Die Schmuckwerkstatt SCUDERI liegt im Herzen des Prenzlauer Berg. Die Schmuckdesignerinnen Bettina Siegmund und Daniela Nagi fertigen hier Ringe Ketten Armbänder Ohrringe Trauringe und Manschettenknöpfe von ... Wörther Berlin Fon - Öffnungszeiten Mo - Fr - Uhr Sa
scuderi-schmuck.de Schmuck Scuderi Berlin Goldschmuck Ring
50 SCENARIO GmbH Berlin SCENARIO Bobert und Schindler GmbH Accessoires
10623
Berlin
SCENARIO GmbH Berlin Accessoires Schmuck Geschenke Papeterie Ausgewählte Postkarten ... Navigation aufklappen/zuklappen Startseite Aktuelle Informationen Schmuck Accessoires Uhren
scenario-gmbh.de Accessoires Schmuck Uhren Papeterie Geschenke
51 Blackyard Schmuck aus Doris Christ & Manfred Lübbas GbR
13585
Berlin
blackyard stellt HerrenSchmuck aus Leder Edelstahl und Silber her. Zu den Produkten gehören Lederanrbänder SurferKetten EdelstahlAnhänger und Creolen und schwere Panzerketten aus Silber. ... ist ein Schmuck-label aus Berlin. Trendige Lederarmbänder Anhänger aus Edelstahl schwere Silberketten
black-yard.de
52 Opalschmuck Onlineshop für Schmuck Opalschmuck
12526
Berlin
Opalschmuck Onlineshop bietet wunderschöne Schmuckstücke Ringe Ohrringe Kettenanhänger mit exklusiven Opalen z.B. Edelopalen zum online kaufen. ... Onlineshop! Im Opalschmuck Onlineshop finden sie wundervollen Schmuck. Opale die mit Gold und Silber
opalschmuck.de Opalschmuck Online Kaufen Opal Schmuck Kaufen Opale
53 Schmuck Uhren online VALMANO GmbH
10999
Berlin
Garantierte Lieferung bis Weihnachten bei Bestellung mit DHL Express bis zum 23.12.2014 um 12 Uhr! Jetzt Last Minute Schmuck Uhren verschenken | VALMANO ... Kategorien Damen Schmuck Armschmuck Armbänder Armreifen Bettelarmbänder Charms Anhänger Charms
valmano.de
54 Goldschmiede HELGA RITSCHER & ALEXANDER SANDMEIER OHG Goldschmiede
14165
Berlin
Helga Ritscher Alexander Sandmeier Historischer Schmuck von der Antike bis zum 21.Jh. ... Historischer Schmuck Telefon inforitscher-sandmeier Termine
ritscher-sandmeier.de Goldschmiede Kunsthandel Historischer Schmuck Schmuck
55 Gold Shaker Ankauf ImmoCom 2001 GmbH Goldankauf
12309
Berlin
Goldshaker kauft Ihr Gold Ihren Schmuck Ihre Uhren Ihre Antiquitäten Ihre Pelze und reinigt Ihre Gemälde ... Berlin infogold-shaker FESTNETZ - MOBIL Tragen
112gold.de Goldankauf Schmuckankauf Uhrenankauf Antiquitätenankauf Pelze
56 SchmuckPalast Inhaber: Thomas Schmuck
10318
Berlin
Wir bieten Ihnen eine sorgfältige Auswahl einzigartiger Schmuckstücke zu unschlagbar günstigen Preisen wie beim Großhändler u.a. hochwertiger Brillant Diamant und Perlschmuck. ... Über uns Information Preise und Versand Datenschutzerklärung AGB Kontakt Schmuck-Palast Inhaber Thomas Stolt
galerie-stolt.de Schmuck Diamant Brillant Ohrschmuck Ohrring
57 Reparaturen aller Art von Uhren
12103
Berlin
... Reparaturen von Schmuck und Uhren aller Art durch. Auch in Fragen von Edelsteinen Anfertigungen
juwelier-dolphin.de Uhren Umbauten Schmuck Reparaturen Umarbeitungen
58 Uhren und Schmuck |
14169
Berlin
Uhren Schmuck und Service ? von Gravur bis Reparatur in Berlin SteglitzZehlendorf gibt es bei UhrmacherMeisterbetrieb Weniger ... Uhrenbeweger Schmuck Trauringe Verlobungsringe Freundschaftsringe und -Schmuck Perlenschmuck Gold
uhren-weniger.de
59 BellaCarina Grosshandel Silberschmuck Silberschmuck
13585
Berlin
Großhandel für Silberschmuck Silberketten Esoterik Shiva Auge Kristall Schmuck ... schwere Panzerketten Rosè vergoldet Schmuck mit Swarovski Elements Kristall Kugel
bella-carina-grosshandel.de Silberschmuck Schmuck Silberketten Esoterik Shiva Auge Großhandel
60 Trollbeads und Lapponia Schmuck
13507
Berlin - Tegel
Trollbeads und Lapponia sowie TeNo Schmuck finden Sie hier günstig und versandkostenfrei im Onlineshop der Goldschmeide Wingerath aus Berlin. ... Manu Schmuck COSMOS - Carbon Berlin-Beads Lapponia Armschmuck Broschen Ohrschmuck Ring Halsketten
trollbeads-laden.de
61 Center Juwelen Juwelier Juwelier
12559
Berlin
Juwelier Berlin und Goldankauf Berlin | Juwelier in Berlin Köpenick: Uhren Schmuck Trauringe Berlin vom Juwelier ... Junghans Uhren Skagen Uhren Schmuck Bering Schmuck Endless Esprit Fossil Joop Lotus MY iMenso Xenox
juwelier-in-berlin.de Juwelier Berlin Goldankauf Berlin Treptow Köpenick
62 Vanheit handgearbeiteter Schmuck
10997
Berlin
Handgearbeiteter Schmuck und Objekte aus Glas
vanheit.de
63 Juwelier Zucker Uhren
15366
Neuenhagen bei Berlin
... " ist ein inhabergeführtes Fachgeschäft für Uhren und Schmuck in Neuenhagen bei Berlin. Ganz gleich ob Gold Silber
zucker-uhren-schmuck.de Uhren Schmuck Juwelier Reparatur Altgold Ankauf Weihnachtsgeschenke Uhrmacher Werkstatt
64 Günstig Mode Schmuck Lesara GmbH
10435
Berlin
Damenmode Kinder Herrenbekleidung Schuhe Schmuck Sport Wohnen Lifestyle ?günstig bestellen ?BestPreisGarantie bei ? Lesara ... Sicherer Versand Tage Rückgaberecht Kundenservice mit Herz DE Italien - Niederlande - (NL
lesara.de
65 Juwelier Bernd Reiher Berlin Juwlier
13051
Berlin
Website des Juweliers Bernd Reiher aus Berlin. Trauringe Uhren Schmuck Goldankauf und ein Onlineshop erwarten Sie hier. ... Juwelier Reiher Home Trauringe Uhren Schmuck Marken Thomas Sabo Rado Union Glashütte Bruno Söhnle
juwelier-reiher.de Juwlier Hochzeitsringe Trauringe Eheringe Schmuck
66 Christoph Schmuck|| Berlin
10961
Berlin
... Start Kontakt Christoph Schmuck
christoph-schmuck.de
67 Aktuelles Keywords
10243
BERLIN
Schmuck FROLLEIN ELSTER ... Aktuelles "SUMMER IN THE CITY" AUF DEM BREITSCHEIDTPLATZ IN BERLIN ..-.. täglich von
frollein-elster.de Keywords Schmuck Modeschmuck Geschenke Ewa Wischnewski
68 Raspe SchmuckDesign Raspe/Wäcke Schmuckdesign GbR Raspe
10823
Berlin
Seit 1987 fertigt Christa Raspe Modeschmuckkollektionen in eigener Herstellung an. Alle Kollektionen entstehen in handgearbeiteten Kleinserien und werden in unserer eigenen Werkstatt in Berlin produziert. In limitierten Sonderkollektionen werden unterschiedliche
raspe-schmuck-swarovski.de Raspe SchmuckDesign SchmuckDesign Design Raspe
69 Traumhafter Schmuck ? meinTraumschmuck.de Nomination
13503
Berlin

meintraumschmuck.de Nomination Armband Armbänder Sammelbänder Pandora Schmuck Armschmuck Bettelarmband
70 Schmuck Anziehen Keywords
10405
Berlin
... Kleider sind wie Häuser in denen wir wohnen Schmuck Anziehen Webdesign by angelapeter
mariaschorr.de Keywords
71 Antiquitäten am Breslauer Platz Antik
12105
Berlin
Bei uns finden Sie antike Möbel Weichholzmöbel Schränke Tische Stühle Regale antiken Schmuck und antike Leuchten in unserem Ladengeschäft in Berlin Friedenau ... Wollmann Antiquitäten Antike Weichholzmöbel in Berlin - Antike Möbel in Berlin - Antiquitäten - Ankauf
antikmoebel-wollmann.de Antik Antik Antike Antiker Antiquitäten Möbel Weichholz Weichholzmöbel Tisch
72 Startseite HOTANI ImportGrosshandel Hotani
13403
Berlin
Hotani ImportGroßhandel Ihr Importeur aus Berlin für Räucherware Tücher Schmuck Speckstein Kunsthandwerke aus Holz und mehr. ... -Kunsthandwerk Räucherware Schmuck Textilien Tücher Schals Wellness Wohnaccessoires Beistelltische Holzboxen
hotani.de Hotani ImportGroßhandel Hotani ImportGrosshandel Berlin Räucherstäbchen
73 Trauringe Berlin Ohrringe Anhänger trauringe
10435
Berlin
Trauringe Ohrringe Manschettenknöpfe Edelsteine Altgoldankauf Goldschmiede Berlin Prenzlauer Berg ... DE EN Trauringe Verlobungsringe Schmuck Leistungen Galerie Kontakt Öffnungszeiten Links
heidenreich-schmuck.de Trauringe Berlin Verlobungsringe Goldankauf Goldankaufberlin Altgoldankauf Altgoldankaufberlin
74 Markenprodukte zu günstigen Preisen createyourtemplate GmbH & Co. KG Schmuck
10247
Berlin
Preiswert24 ? Uhren Schmuck und Accessoires günstig kaufen ? schneller kostenloser Versand innerhalb Deutschlands ? sofort Lieferbar ? 1 monatiges Widerrufsrecht ? Bestellen Sie jetzt!! ... Kontakt Warenkorb Artikel ? Warenkorb ansehen Preiswert Uhren Schmuck Accessoires Sale Marken
preiswert24.de Schmuck Uhren Uhr Accessoires Ring
75 Orakelfreunde Shop und Erlebnisseite: Schmuck
10559
Berlin
Bei Orakelfreunde.de kann man Tarotkartenlegen und magische Produkte bestellen: Amulette Talismane Rituale Schmuck Liebeszauber Schutzzauber GrisGrisZauberbeutel Wunschpuppen Raeucherkraeuter. Ausserdem koennen Besucher ihre ... Voodoozauber Orakel-Wahrsagekarten Amulette Schmuck Silberanhänger Colliers Ein Ritual von Angelika
orakelfreunde.de Schmuck Orakelkarten Liebesamulett Zauberbeutel Talisman Karmajaeger Artusorakel Herzorakel Wet
76 Home Juwelier Amber Goldankauf
12163
Berlin Steglitz
Goldankauf Juwelier Amber Berlin. Ihr Berliner Juwelier Fachgeschäft mit über 35 Jahren Erfahrung in der Juweliers Branche. Über 5000 Trauringe stehen zur Auswahl. Wir führen viele renommierte Marken für ... Marken Uhren Marken Schmuck Marken Trauring Marken Dienstleistungen Juwelier Amber Berlin Ihr Juwelier
amber-juwelier.de Goldankauf Amber Juwelier Berlin Steglitz
77 Kamya Kamya GmbH
10435
Berlin
Schmuck aus Berlin ... ? Da sind Sie hier genau richtig! Wir bieten Ihnen eine große Auswahl edlem Schmuck. Bei uns finden Sie - formvollendeten
kamya-design.de
78 Home Schmuck
10317
Berlin
Handgefertigter Schmuck aus Gold Silber Edelholz Kokosnuss. Auf Wunsch kompatibel zu Charlotte. Unikatschmuck von Yvonne Rieder ... Schmuck Hier finden Sie meist handgefertigtes von Goldschmiedin und Schneiderin Yvonne Rieder Bevorzugtes
yvonneschmuck.de Schmuck Ringe Armschmuck Herrenringe Verlobungsringe
79 Papierschmuck Kibuku.de Papier
10961
Berlin
Schmuck aus PapierhandgemachtWillkommen im KibukuShop
kibuku.de Papier Kunstschmuck Handgemacht Japanpapier Ausgefallener Schmuck Papierschmuck Handmade Schmuc
80 Liya Love you Nazar Berlin UG (haftungsbeschränkt) LIYA
14050
Berlin
Inspirierender Schmuck individuell und handgefertigt ... Freiheit und Lebenslust. Die Armbänder und Ketten des jungen Berliner Jewellery-Labels strahlen
liya-love.de LIYA Love Liya Love Jewellery Bijoux
81 BoA Beauty Of Afrika
12045
Berlin
Alles zum Thema Afrika Westafrika afrikanische Kunst Antiquitäten Handwerk Schmuck Interieur Dekoration Innenausstattung Schmuck Accessoires Halskette Skulpturen ... wunderschönen Schmuck Broschen Ringe Handtaschen Mode und exklusiven Wein aus Afrika. Alle Produkte
beautyofafrica.de Afrika Interieur Dekoration Afrika Innenausstattung
82 Gerxx GmbH Gerxx GmbH chmuck
10247
Berlin
Schmuck selber online günstig kaufen ... home Philosophie Händlersuche Schmuck WIKI Schmuck selber online günstig kaufen home
gerxx.de Chmuck Selber Online Günstig Kaufen 0? Versand Gratis Innerhalb
83 Silke spitzer silkespitzers
10969
Berlin
zeitgenössischer Schmuck Schmuck Holz Bündelringe ... -spitzer-breathing SILKE SPITZER Schmuck jewelry Contact Verkauf Retail HINTERGRUND ABOUT
silkespitzer.de
84 Mara Schmuck Berlin Schoeneberg M.u.R. Engelhardt GbR
10823
Berlin
... MARA SCHMUCK BERLIN Liebe Kunden von MARA Nach fast Jahren MARA in Berlin-Schöneberg
maraschmuck.de
85 ARTBOXES ARTBOXES
10999
Berlin
ARTBOXES bietet Luxus für Individualistinnen Individualisten. Mobile Galerien. Themen Schmuck. Ketten der besonderen Art. Mode für Menschen mit Phantasie. Made in Berlin. ... in a BOX ARTBOXES - MADE in BERLIN Wir gestalten Themen. Eine mobile Galerie für mobile Menschen
artboxes.de ARTBOXES Luxus Boxen Anhänger Kunst
86 LEGUAN Schmuck ? Design
10629
Berlin
... Christoph Oechsle Wielandstr. Berlin Hochwertiger Unikat Schmuck und Trauringe
leguan-schmuck-design.de
87 Goldankauf Juwelier Amber Berlin Goldankauf
12163
Berlin
Goldankauf Juwelier Amber Berlin. Ihr Fachgeschäft mit über 35 Jahren Erfahrung in der Juweliers Branche. Über 3000 Trauringe stehen zur Auswahl. Wir führen viele renommierte Marken für Schmuck und ... ! Ihr Juwelier Amber Team Berlin Steglitz Gold Ankauf zu hohen Preisen! - NEU bei uns Schmuck Uhren von MICHAEL
ambercollection.de Goldankauf Amber Juwelier Berlin Steglitz
88 David Aubrey Schmuck | David
10115
Berlin
David Aubrey.de Offizieller Onlineshop der Marke David Aubrey für Deutschland Österreich und Schweiz.
david-aubrey.de David Aubrey Schmuck Halsketten Ketten Ohrringe Armbänder
89 Daniela Halm individuelle Schmuck
10559
Berlin
Schmuck von Daniela Halm Ketten Armbänder Ohrringe Engel Arbeiten mit Edelstein
individuelle-kunst.de Schmuck Schmuck Ketten Armbänder Ohrringe
90 Grebe Schmuck Trauringe Trauringe
10969
Berlin
Trauringe á la Carte individuelle Trauringe und Verlobungsringe nach Ihren Wünschen sind typisch für die ManuFaktur Grebe Berlin und das seit 1966. ... die ManuFaktur Grebe Berlin fertigt bereits seit Trauringe und Unikat Schmuck aus Platin und Gold
grebe-schmuck.de Trauringe Berlin Trauringe In Berlin Verlobungsringe Hochzeitswelt
91 Start Henry Fuchs henry
12487
Berlin
Henry Fuchs Uhrmachermeister ... Start Trauringe Trollbeads Öffnungszeiten Uhren Schmuck Altgoldankauf Kontakt Uhren und Schmuck
henry-fuchs.de Henry Fuchs Uhren Schmuck Uhrenfuchs
92 Edler Antikschmuck www.antikschmuckkaufen.de Antikschmuck
10585
Berlin
Antikschmuck Ringe Broschen Ketten Ohrringe Jugendstil Biedermeier ArtDeco Gold Silber Granat Diamanten Saphir Smaragd ... Mobil + infoantik-schmuck-kaufen Werte Kunden herzlich Willkommen
antik-schmuck-berlin.de Antikschmuck Ringe Broschen Ketten Ohrringe
93 Home ? Goldschmiede Schmuckbotschaften
10781
Berlin
Goldschmiede Schmuckbotschaften aus Berlin entwirft individuellen Schmuck! ... -Schmuck Herren-Schmuck Anfertigung von individuellem Schmuck Nachbau Umarbeitungen Service Reparaturen
schmuck-gewecke.de
94 Elmira Berlin Elmira
10245
Berlin
Elmira Berlin ist Shop für Handgefertigten Schmuck. ... Berlin Kategorien Aufnäher Allgemein Haarschmuck Schmuck Rechtliches AGB Datenschutz
elmira-berlin.de Elmira Berlin Anstecker Etc.
95 Dorothea Bierkämper Schmuck
10623
Berlin
... Schmuck und Skulptur Atelier für Entwurf und Anfertigung von Schmuck und Skulpturen Dörte
schmuckundskulptur.de
96 Amely Spaeth Goldschmiedemeisterin Berlin Julia Ziehn & Amely Späth GbR schmuck
10245
Berlin
Amely Spaeth Goldschmiedemeisterin aus Berlin Goldschmiede Berlin Trauringe Unikate Schmuck ... Home Arbeiten Über mich Kontakt Aktuell Besucht mich in der Wühlischstr. b in Berlin
amelyspaeth.de Schmuck Goldschmiede Trauringe Eheringe Verlobungsringe Unikate Unikatschmuck Einzelanfertigung
97 Kristallwerk.de Schmuck aus swarovski
12555
Berlin
Kristallwerk ist ein Onlineshop für Schmucksachen aller Art ... wir Ihnen versichern dass unser Schmuck ausschließlich in Deutschland produziert wird. Wir wünschen Ihnen viel Spaß
kristallwerk.de Swarovski Elements Ketten Mit Gravur Schmuckset Vergoldet
98 TIME STORE Lifestyle uhr
12619
Berlin
Time Store aus Berlin Uhren und namhafte Marken ... Sie uns im Spree Center Berlin und lassen Sie sich von unseren exklusiven Schmuckkollektionen verzaubern. TIME
timestore-berlin.de Uhr Armband Zeiger Time Store
99 Uhren Maeckert in 10965
10965
Berlin
... ? wir nehmen uns die Zeit um Ihre Wünsche zu erfüllen. Uhren Schmuck und Pokale ? Uhren Maeckert in Berlin
uhren-maeckert.de
100 Juwelier Schmuck Goldschmuck
12587
Berlin
... . Dadurch können einige Animationen und Effekte nicht genutzt werden. Schmuck vom Juwelier Unser Angebot
uhren-gold-schmuck.de
101 Perlenladen und Onlineshop |
14057
Berlin
... Pressestimmen Blog Perlenladen und Onlineshop Perlen Schmuck Zubehör Accessoires Herzlich willkommen
bonitaperla.de
102 Schadow Automobile Berlin Autos Inh. AAAA. & M. Schadow OHG KFZ
12247
Berlin
1. KFZ Pfandleihhaus in Berlin für Autos Motorräder. Leihhaus für Schmuck Wertsachen Goldankauf und KFZBarankauf ... Schadow Automobile Seit Autos und Motorräder in Berlin Lankwitz Home
schadow-automobile.de KFZ Leihhaus Pfandkredit Autos Motorräder
103 Juwelier Ersay Herzlich JuwelierErsay
10789
Berlin
Mit Ihrem Juwelier Ersay in Berlin und Leipzig haben Sie einen leidenschaftlichen Juwelier und Partner an Ihrer Seite gefunden. Lesen Sie mehr! ... und Trauringe in Berlin und Leipzig Schmuck Ausgewöhnlicher Schmuck bei Juwelier Ersay Uhren Begehrte Zeitmesser
juwelier-ersay.de JuwelierErsay Schmuck Leipzig Juwelier Berlin
104 Schmuck Berlin | simplyu keyword1
14089
Berlin
website description ... ? Suche nach simply-u Schmuck Berlin Edelsteinschmuck Startseite Shop Kontakt
schmuckberlin.de Keyword1 Keywords2
105 Das Feinste vom Feinen. Nicole + Robert Fritz GbR
14165
Berlin
... Das Feinste vom Feinen. Energetix Magnetschmuck Schmuck Vertriebspartner Geschäftspartner Friseur
dasfeinstevomfeinen.de
106 TrendMafia Der Designermarkt Trendmafia
10247
Berlin
Aufstrebende Designer Modeschöpfer und Grafiker laden ein um ihre selbst entworfenen und selbst produzierten Erzeugnisse in punkto Mode Design Schmuck Fotografie Kunst zu entdecken ... CUP FESTIVAL - . Juli Malzfabrik Am Samstag den . Juli findet in der Berliner Malzfabrik
trendmafia.de Trendmafia Designermarkt Designmarkt Weihnachtsmarkt Kreativmarkt
107 Diehansens Torsten
12526
Berlin
Torsten Hansen Autismus Malerei Fotografie Orchideen Kakteen winterharte Kakteen Klettern Dolomiten Schmuck Lichtmalerei lightpainting light painting ... weiter ?Es sind die Begegnungen mit Menschen die das Leben lebenswert machen.? Guy de Maupassant
diehansens.de Torsten Hansen Autismus Malerei Fotografie
108 Goldschmiede Gorlt Home Schmuck
10719
Berlin
... Massage Mustermann Home Schmuck Berlin Ringe Ausstellungen Service Kontakt Herzlich
goldankauf-berlin.de Schmuck Anfertigungen Berlin Ring Goldankauf
109 Bandow24 der WebJuwelier Uhr
13405
Berlin
Entdecken Sie die neue ShoppingDimension der Goldschmiede Bandow. Entdecken Sie Bandow24! Der WebGoldschmied/Juwelier der Superlative ist jetzt rund um die Uhr für Sie geöffnet. Mit den Marken Festina ... Bandow der Web-Juwelier/Goldschmied im Internet Textversion Top Angebote Schmuck Miniaturuhren
bandow24.de Uhr Uhren Elysee Lotus Calypso
110 Die Exchange AG
10117
Berlin
... und Goldbarren Schmuck Travelers Cheques Berlin Schöneberg Steglitz Kreuzberg-Mehringdamm Kreuzberg-Kottbusser
leihhaus24.de
111 Home atelierberlin Swarowski
14167
Berlin
Willkommen bei atelierberlin Jeder ist kreativ genug um seinen individuellen Schmuck herzustellen.Hier finden sie jap.Miyukis Swarowskis Glas u. Metallperlen RegalizLederband Schmuckzubehör...
atelierberlin.de Swarowski Kristalle Rivolis Doppelkegel Jap.Miyuki
112 Goldschmiede Gorlt Home Schmuckgutachen
10719
Berlin
... Home Schmuck Berlin Ringe Ausstellungen Service Kontakt Herzlich Willkommen
goldschmiede-gorlt.de Schmuckgutachen Schmuckservice Schmuck Anfertigungen Berlin
113 Petretti platindesign Platin
13629
Berlin
... am Schmuck Die Freude am Schmücken Die Freude am Schmuck machen Die Freude an schönen Dingen aus edlen
olafpetretti.de Platin Platindesign Schmuck Ringe Broschen
114 ? Designerschmuck und Accessoires melovely GmbH & Co. KG Schmuck
13086
Berlin
melovely.de vereint außergewöhnlichen Designerschmuck wie Ketten Ringe Armschmuck sowie Taschen und viele weitere Accessoires versandkostenfrei. ... mit Käuferschutz. Mehr... Home Neu Schmuck Frauen Armschmuck Halsschmuck Ohrschmuck Ringe Charms Gravurschmuck
melovely.de Schmuck Damenschmuck Herrenschmuck Designerschmuck Schmuck
115 Bazaar Berlin Startseite Messe Berlin GmbH Bazaar
14055
Berlin
Der Bazaar Berlin ehemals Import Shop Berlin ist eine internationale Verkaufsausstellung für exotische Geschenke orientalisches Wohnen indische Mode exotischer Schmuck afrikanische Trommeln Alpakapullover aus ... Sitemap Datenschutz Kontakt Bazaar Berlin Startseite . - . November +++ Der BAZAAR
bazaar-berlin.de Bazaar Berlin Import Shop Berlin Exotische Geschenke
116 Www.schmuckmanufakturkoenigsblau.de
10715
Berlin
Onlineshop für Polarisschmuck Polarisketten Polarisarmbänder und kreativen Modeschmuck. Veranstaltung von kreativen Kindernachmittagen in Berlin SchmuckWorkshops oder partys! ... Frisch fröhlich jung! Schmücke dich mit liebevoll handgefertigen Polarisketten aus farbenfrohen
schmuckmanufaktur-koenigsblau.de
117 Ob Kamine Balkone Zaunanlagen
15366
Hoppegarten
Hier bekommen Sie alles rund ums Haus. Ob es nun der Wintergarten oder Fenster und Türen sind eine Treppe sowie ein Kamine sollte auch nicht fehlen. Zaunanlage ... ist vom Selbermacher zu bewältigen. Kontakt Aktiv Bau Management Kiefernstrasse Hoppegarten (OT
aktiv-bau-management.de Zaunanlagen Carports Fenster Türen Kamine
118 Goldankauf Berlin Pfandleihhaus Daniel Leihhaus Berlin GmbH goldankauf
10627
Berlin
Wir kaufen Ihr Gold Silber Edelsteine Münzen Schmuck Zahngold Dentalgold und Uhren zu tagesaktuellen Preisen. Jetzt anfragen 030 3110 2296! ... Menu Ihr Partner für Gold in Berlin seriös ? zuverlässig ? sicher Wir kaufen Ihr Gold Ob Altgold
gold-berlin.de Goldankauf Berlin Pfandleihhaus Berlin Scheideanstalt Berlin
119 Schmuckräume Berlin ? Schmuck Oliver Hofmann GmbH
10719
Berlin
... ? Berlin Tel + ? ? + ? ? schmuckschmuckraeume-berlin
schmuckraeume-berlin.de
120 SupaRina: Home schmuck
10247
Berlin
SupaRina bietet Euch WitzigSkurilSchmückendes für Ohr und Hals. Von Kitsch über Gothic bis hin zu Romantischem findet Ihr hier einiges das ein echtes LadyHerz höher schlagen lässt. ... der alles mitmacht. Heute bestellen und schon am Wochenende per Post im Briefkasten >> Schmuck verschenken SupaRina
suparina.de Schmuck Berlin Ohrringe Ketten Ringe Modeschmuck Friedrichshain Plexiglas Farbe
121 Www.dasbernsteinzimmer.de Herzlich willkommen! opal
10407
Berlin
Finden Sie schönenSchmuck Opal Larimar Achat Smaragd Saphir Rubin Koralle Ring Ringe Silberringe Steinschmuck Designerschmuck Anhänger Pendel Kristalle Kristallanhänger bei dasbernsteinzimmer. Wir verkaufen Ohrhänger Ohrring Ohrringe
baltic-amber.de Opal Larimar Achat Smaragd Saphir
122 Monika Glöss Design Monika
10999
Berlin
Homepage von Monika Glöss ... Monika Glöss Design Home Schmuck Kollektion Design Innovation Vita Service + Kontakt Shop AGB
monika-gloess.de Monika Glöss Schmuck Schmuckdesign Design
123 LeChatVIVI BERLIN Design Armbänder Schmucklabel
12157
Berlin
LeChatVIVI BERLIN Schmuck aus Berlin. LeChatVIVI BERLIN steht für individuell hergestellte Armbänder und Ketten die im Berliner Atelier produziert werden. ... H E R B S T W I N T E R - KOLLEKTION LeChatVIVI BERLIN® DORNEN KEINE ROSEN OHNE DORNEN
lechatvivi.de Schmucklabel Design Berlin Jewelry Katzenlogo
124 Juwelier Leopold Berlin |
10719
Berlin
... gebrauchten Luxusuhren und Schmuck in Berlin Charlottenburg. Lassen Sie sich von unserem umfangreichen Angebot
juwelier-leopold.de
125 Außergewöhnliche Geschenkideen und personalisierte
10117
Berlin
Finden Sie ausgefallene Geschenkideen und personalisierte Geschenke sowie Inspiration für alle schönen Dinge wie etwa Wohndeko Fashion oder Schmuck. Alles bei notonthehighstreet.de ... Sie auch durch unsere Haushaltswaren Angebote durch unser Schmuck-Sortiment und viele weitere. Überraschen
notonthehighstreet.de
126 LeChatVIVI BERLIN Design Armbänder Schmucklabel
12157
Berlin
LeChatVIVI BERLIN Schmuck aus Berlin. LeChatVIVI BERLIN steht für individuell hergestellte Armbänder und Ketten die im Berliner Atelier produziert werden. ... bei LeChatVIVI BERLIN®. Sanfte Grau- Beige- und Blautöne natürliche Materialien Silber Gold und Kupfer
vivianekoch.de Schmucklabel Design Berlin Jewelry Katzenlogo
127 Home uhren
10961
Berlin
Juweliere Uhrmacher ... an edlem Schmuck . Unser freundliches und kompetentes Team freut sich auf Ihren Besuch. Gerne stehen
argento-berlin.de Uhren Schmuck Juwelier Goldschmied Diamanten
128 KIRKARA: Atelier Atelier
12053
Berlin
AtelierAtelier KirKara Berlin Galerie Kirsten Karacan ... Atelier- HOME KURSE KURSE INFO KURS-SCHMUCK GALERIE UNIKATSCHMUCK PAPIERMACHÉ SHOP FOSSILIEN VITA
kirkara.de Atelier Kirkara Berlin Schmuckdesign Schmuckschmiede
129 WHAT´s NEW LeChatVIVI Schmucklabel
12157
Berlin
LeChatVIVI BERLIN® Armbänder und Schmuck für Frauen und Männer Bekannt aus Presse und Fernsehen Neue Styles für 2014. ... ! Das Schmucklabel LeChatVIVI BERLIN® macht Schmuck für Menschen die nicht nach einem Namen oder Status suchen
lechatvivi-berlin.de Schmucklabel LeChatVIVI Berlin Wickelarmbänder Lederarmband
130 Unikate Einzelstücke und Schmuck
12163
Berlin
Modeschmuck Unikate Einzelstücke und mehr gibt es hier ! Zertifiziert kostenfreie Lieferung ... Ihr Warenkorb keine Produkte Entdecken Sie unsere Kategorien Schmuck war schon immer ein Zeichen von Wohlstand
mein-schmuckzauber.de Schmuck Online Günstig Modeschmuck Online Kaufen Billig Unikat Einzelstück
131 Goldankauf Berlin und Brandenburg Goldankauf
12163
Berlin
Sie wollen Ihr Gold in Berlin und Brandenburg verkaufen wir bieten eine faire Partnerschaft. Genaue Wertermittlung faire Preise Diskretion und eine schnelle Auszahlung sind garantiert. ... Ankauf Uhren Ankauf Platin Ankauf Schmuck Ankauf Münzen Ankauf Palladium Ankauf Online Goldrechner
berlin-altgoldankauf.de Goldankauf Berlin Gold Verkauf Zahngoldankauf Zahngold
132 Uhren günstig kaufen bei
10829
Berlin
Chronographen Uhren für Damen Uhren für Herren sowie Vielzahl an Markenuhren und Schmuck finden sie bei watchhouse.de ... ) DAMENUHREN HERRENUHREN SCHMUCK PARTNERUHREN WANDUHREN KINDERUHREN Jetzt einkaufen Festina Keramikuhren
watchhouse.de
133 Center Juwelen Juwelier Juwelier
12524
Berlin
Center Juwelen in der TautPassage Berlin TreptowKöpenick. Center Juwelier seit 1999. ... Center Juwelen - Juwelier Berlin Treptow Köpenick - Center Juwelen Taut Passage - Bruno-Taut
centerjuwelen.de Juwelier Treptow Köpenick Berlin Trauringe
134 Juwelier Barok ist Ihr Juwelier
12163
Berlin
Mitten im Boulevard Berlin finden Sie Ihr für Goldschmuck und Uhren Juwelier Barok. Wir freuen uns auf Sie und Ihren Besuch in BerlinSteglitz. ... Willkommen Juwelier Barok Schmuck Uhren Goldankauf Reparaturen Galerie Bewerten Sie uns! HEAD
juweliersteglitz.de Juwelier Barok Juwelier Steglitz Fachgeschäft Goldschmuck
135 Bling bijoux by beate
12247
Berlin
... Schmuckstück. Neu dazu kommt mein Hand - gestempelter Vintage und Silber Schmuck - von Hand geprät. Über
bling-bijoux.de
136 Trauringe anders individuelle trauringe
10437
Berlin
trauringe anders bietet außergewöhnliche Trauringe schlicht einfach und dennoch anders! Gestaltet von DiplomDesignern DesignerRinge wenn Sie so wollen im wahren Sinne des Wortes! trauringe anders ... schaufenster kontakt anfahrt impressum schmuckes - Thomas Bartussek Berlin
trauringe-anders.de Trauringe Anders Außergewöhnliche Trauringe Schlicht Einfach Anders
137 Hochzeit Luxus Geschenk 9p strategy GmbH Hochzeit
10629
Berlin
Hochzeitsgeschenk das GLAMLOC Liebesschloss ist ein LuxusGeschenk zur Hochzeit ... nah. Es geht mit auf Reisen und ist an jedem Platz Schmuck. Denn GLAMLOC ist von Hand gefertigt
hochzeit-geschenk-glamloc.de Hochzeit Geschenk Liebesschloss Schmuck LiebesschlossBrücke Partnergeschenk Verlobung Gold Silb
138 Gold als Wertanlage
13086
Berlin

goldthemen.de
139 Startseite | Marthe Labs
10435
Berlin

schmuck-marthelabs.de
140 Leihhaus Goebel Pfandkfredit Barkredit Berlin
13353
Berlin
Das Pfandhaus Goebel wurde 1900 gegründet. Zwei mal in Berlin Wedding und Moabit.Das Leihhaus mit dem schnellen Sofortkredit steht in der dritten Generation. Hier gibt es auf die freundliche ... auf die nette Art Höchstpreise für Ihren Schmuck Uhren Münzen Fototechnik und Technik des täglichen Lebens
pfandhaus-moabit.de Berlin Leihhaus Pfandhaus Mitte Wedding Moabit Tiergarten Pfandkredit Beleihung
141 Designermode accessoires | fischer mode berlin GmbH Fischer
10435
Berlin
fischer mode bietet Ihnen tragbare und ausgefalle Designermode und passende Accessoires von Schal über Schmuck bis hin zum Schuh. Sie finden bei uns Mode von ausgewählten deutschen und internationalen ... und ausgefalle Designermode und passende Accessoires von Schal über Schmuck bis hin zum Schuh. Sie finden
fischer-mode.de Fischer Mode Berlin Brandenburg Bekleidung
142 Manufakturgalerie Manufakturgalerie
10178
Berlin
Die Manufakturgalerie ... Grafik Schmuck Keramik Plastik Glasgestaltung Ausstellungen Künstler Finissage am . Dez
manufakturgalerie.de Manufakturgalerie Meissener Porzellan Königliche Porzellan Manufkatur
143 O3BERLIN Shopping
10435
Berlin
Unique Berlin Shop. More than 100 Designers on 100 sqm. Fashion jewelry and accessories for every occasion and gifts or souvenirs for your loved ones. ... -Berlin! Bei uns findet Ihr Unikate und individuelle Einzelstücke von ausgewählten Designern die uns ans
o3-berlin.de Shopping Berlin Clothing Souvenir Stores
144 PrincessMari Märchenhaftes Design PrincessMari
12557
Berlin
Entdecken Sie die wundervollen Designs von PrincessMari. ... aktuell von Vintage-Schmuck über trendige Accessoires bis hin zu individuell hergestellten Hals
princessmari.de PrincessMari Berlin Modeschmuck Claudia Meitz
145 TunnelPlugs Flesh Tunnel Piercings
15366
Hoppegarten
Tunnel Plugs Shop für gedehnte Piercings Flesh Tunnels Tapers Expanders Plugs Ohrpiercings und Fake Plugs. ... und Fake Plugs. Du bist auf der Suche nach dem passenden Schmuck für Deine gedehnten Ohren
tunnel-plugs.de Piercings Flesh Tunnels Tapers Expanders
146 Point for Wellness Bücher
12347
Berlin
Point for Wellness Ihr geprüfter Online Shop von Rakuten ? Trusted Shop zertifiziert sicher ? GeldZurückGarantie ? Bis zu 11 sichere Zahlungsarten ... sensitiv chi-enterprise Gesichtspflege i+m Berlin Face Age Protect Face Hydro Performence Face Phyto
pointforwellness.de Bücher CDs DVDs Geschenkideen Gesundheit
147 Studio handgemacht BerlinHoppegarten Nagelstudio
15366
Hoppgarten
Mit langjähriger Erfahrung bieten wir Ihnen professionelle Nagelpflege und Nageldesign. ... Close Please wait... Home Schmuck-Kollektion Ringe Ohrringe Anhänger Leistungen Studio Preise
studio-handgemacht.de Nagelstudio Berlin Nagelstudio Hoppegarten Nagelstudio Neuenhagen
148 Markemaja foto
10967
berlin
markemaja fotografie fotodesign visuelle gestaltung ... schmuck freie arbeiten print etc. about kontakt impressum
markemaja.de Foto Photo Fotografie Photographie Fotographie
149 Fräulein Liebenswert fraeuleinliebenswerts
15366
Neuenhagen
Produkttest mit Bericht und Fotos Verlinkung Veröffentlichung auf Facebook Twitter Dauerhafte Links DIY Kinderkram swafing nähen Stoffe Heilkräuter Wildkräuter ... eine Berbermütze aus Marokko tollen Schmuck aus Kolumbien oder Hüftwärmer und Stulpen aus Nepal. Larissa Brettel
fraeuleinliebenswert.de
150 Juwelier EuroGoldBerlin Trauringe
12051
Berlin
Markenuhren Schmuck Trauringe Freundschaftsringe und Kinderschmuck zu Toppreisen online und im Ladengeschäft. Unsere Marken: Festina Bruno Söhnle Glashütte/Sa. Breuning Junkers Zeppelin Maximilian ... -Platin Silber Silver Diamonds Schmuck Armani Breuning Brosche (
euro-gold-berlin.de Trauringe Berlin Eheringe Berlin Goldschmuck Berlin
151 Start vonberlin Schmuck
10437
Berlin
Marion Heilig Joachim Dombrowski Friederike Maltz Angewandte Kunst und modern crafts ... Berlin Dioramen Eröffnung .. - Uhr von Marion Heilig Joachim Dombrowski Friederike
von-berlin.de
152 ANMUTH Grafikdesign und Konzeption Grafik
10318
Berlin
Anmuth Grafikdesign und Konzeption Antje Würdemann Berlin. Gestaltung von individuellen Kommunikationslösungen in den Bereichen Print Internet und Mode. Das Leistungsspektrum von Anmuth Grafikdesign und Konzeption ... Berlin T. + .
anmuth.de Grafik Grafik Berlin Grafikdesign Designer Berlin
153 MOne Fashion Berlin Accessoires
10623
Berlin
Damenbekleidung Damenschuhe Accessoires Taschen Schmuck ... Berlin + infom-one-fashion Herzlich Willkommen M-One Fashion Ihr Multibrand-Store
m-one-fashion.de Accessoires Armbänder Bermuda Jeans Blazer
154 Gold Piercing Shop  Gold Piercing Goldpiercings
13051
Berlin
In der Kategorie Echt Gold Piercing kannst Du die verschiedensten Piercings aus GelbGold und WeissGold finden ... Bauchnabelpiercings Brustwarzenpiercings sowie Zehen Schmuck Ringe finden. Mit Gold Piercings bist Du auf jeden Fall
gold-piercing-shop.de Goldpiercings Echt Gold Piercing Piercing Aus Echt
155 Beste Deals für Luxus
12099
Berlin
luxus premium günstig schnäppechen treffer uhren luxusware männer hugo boss beste qualität discount angebote reduziert swissmade verkauf handler luxury original berlin luxusmarken schmuck joop sexy gut deals rate links premiumware ... Startseite Herren-Uhren Damen-Uhren Schmuck Brillen H.O.D best deals Über uns Startseite Herren
homeofdeals.de
156 Silberankauf zu besten Preisen Kostenlose
12107
Berlin
Wir kaufen an: Silberschmuck Silberbestecke Tafelsilber Silbermünzen Industriesilber medizinisches Silber. Kostenlose Bewertung und beste Preise. ... Filiale Berlin Grimmingweg Berlin sowie im Haus Leopold
abc-silber.de Kostenlose Bewertung Ankauf Edelmetall Schmuck
157 TITANEN PIERCINGATELIER BERLIN ULLRICH & JENNE GbR piercing
10777
BERLIN
PURE BODY PIERCING. Zu unserem Angebot gehören alle erdenklichen Arten von Piercings: ob klassisches Intimpiercing oder modisches Oberflächenpiercing. Zusammen mit einer umfassenden Aufklärung über die Technik verwendetes Material und ... PIERCINGSCHMUCKEINE AUSWAHL UNSERES SCHMUCKS HANDPOKED-TATTOO-GALERIEEINE AUSWAHL UNSERER ARBEITEN UNSER TEAM
titanen-piercing.de Piercing Berlin Studio Titanen Titan
158 Darkstore Gothicshop der Darkstore
10245
Berlin
Der Gothic Online Shop aus Berlin. Klamotten Schuhe Schmuck Taschen Gürtel in verschiedenen Stilrichtungen wie Klassischer Gothic Burleska Steampunk Barock ... Darkstore - der Gothicshop aus Berlin Suche Suche Kundenkonto Wunschliste Warenkorb Ihre Sprache
darkstore.de Darkstore Gothic Onlineshop Berlin Kontaktlinsen Halloween Korsagen Korsetts Kilts
159 World's Luxury Guide | Magazin
10888
Berlin
Der World's Luxury Guide ist der Luxusund Lifestyle Guide von Welt Online und die zentrale Anlaufstelle für alle Informationen zum Thema Luxus. ... ACCESSOIRES SCHMUCK TRENDS FASHION-BLOG BEAUTY-BLOG LIVING BUSINESS GADGETS INTERIOR SCHÖNE SEITEN SOCIETY
dieweltbesten.de Magazin Travel Essen Und Trinken Motor
160 EsoterikWellnessshop Keltischer Schmuck Buddha esoterikwellnesss
12203
Berlin
In unserem Esoterik Wellness Wellnessshop bieten wir Produkte an wie Naturkosmetik Goldkosmetik von ChiEnterprise Primavera das Programm enthält Shampoos Hautpflege Haarpflege Gesichtspflege desweiteren führen wir Benny Energiebären und Hopi Ohrkerzen
esoterik-wellnessshop.de Esoterikwellnessshop Esoterik Esoterikshop Wellness Wellnessshop Hinduismus Götter Kwan Ying
161 WallStreetGallery ein Ort Peter
10969
Berlin
Die WallStreetGallery ist ein Ort des Wandelns und Verwandelns also eine BildhauerGalerie und spannt den hellen demokratischen Bogen von Kunst zu Vernunft. ... -frontierende Maßnahme vor der Berliner Mauer zu gleichen Teilen auf Ost- und West-Berliner Territorium eröffnet
wall-street-gallery.de Peter Unsicker Claudia Croon WallStreetGallery Wall Street Gallery Wallstreet
162 Brautschuhe und Brautmode große Brautschuhe
13409
Berlin
Brautschuhe und Brautaccessoires sowie über 200 BrautschuhModelle zur Auswahl. Besuchen Sie uns in unserem Geschäft für Brautmode / Brautmoden in Berlin. ... in Berlin besuchen und beispielsweise Ihre gewünschten Brautschuhe vor Ort anprobieren. Selbstverständlich
brautmoden-direkt.de Brautschuhe Berlin Brautmode Berlin Brautmoden Berlin
163 Markenschmuck | meineschmuckzeit.de Ihr NOMINATION
12351
Berlin
meineschmuckzeit.de Ihr Spezialist für Marken und Sammelschmuck. Aktuelle Kollektionen von Nomination Trollbeads Kado und vielen mehr. Alle Artikel auch im Ladengeschäft vorhanden. ... Newsletter Besuchen Sie unser Fachgeschäft in den Gropius Passagen - Berlin » mehr Newsletter
meineschmuckzeit.de NOMINATION FESTINA BREUNING GUESS PANDORA
164 Kikila Zauberhaftes für Wohnen
12209
Berlin
Ausgefallen Schönes für Mutter und Kind: liebevoll gestaltete Möbel Geschirr Spielzeug Textilien und Accessoires. Große Auswahl an Dekorations und Geschenkideen von GreenGate Stoffe und Nähzubehör von ... Löffel Textilien Kochen Backen Abwaschen Baby Kind Stoffe Nähen Bänder Ribbons Schmuck
kikila.de Wohnen Tisch Küche Baby Kind Geschenktipps Stoffe
165 Ihr Piercingstudio und Tattoostudio Tattoo
13051
Berlin
Ihr erfahrener Piercer und Tätowierer in Berlin. Sie wollen ein neues Tattoo oder Piercing? Lassen Sie sich von uns beraten! – BOSSI Berlin ... Home Unser Team Tattoo Piercing Microdermals Schmuck Galerie Tattoovorlagen Preise Newsletter
bossi-berlin.de Tattoo Tatoo Tato Tattoos Tätowierungen
166 TöppelDesign Edelstahlschmuck und Schmuck
12587
Berlin
Töppel Design Edelstahlschmuck Titanschmuck der besonderen Art ... . Home Zum Onlineshop Goldankauf Unser Schmuck Trauringe Partnerringe Ringe Halsschmuck Armschmuck
clock-store.de Schmuck Berlin Goldankauf Berlin Titan Trauringe Edelstahl Trauringe
167 Webkatalog webkatalog
12627
Berlin
... Hochzeitsfotograf LICHT und LIEBE fuer Berlin Potsdam Brandenburg Umzug Hamburg - Kostenlose Angebote von teambee
webkatalog-wk.de Webkatalog Webverzeichnis Artikelverzeichnis Branchenverzeichnis Regionalverzeichnis
168 Startseite: Alles von AZ Amazon
13589
Berlin
Finden Sie hier alles von A(nzüge) bis Z(eitschriften). STORE10.DE Genau mein Ding! ... Getränke Musik-CDs Vinyl Musikinstrumente DJ-Equipment Parfümerie Kosmetik Schmuck Schuhe
store10.de Amazon Footactive Auto Motorrad Bücher
169 ATELIER HÜHNLEIN Goldschmiede
10965
Berlin
... schmuck brandneu shop kurse kontakt anfahrt impressum SCHMUCK
atelier-huehnlein.de
170 Eyes of pearl Schmuck
12157
Berlin

eyes-of-pearl.de Schmuck Perlen Glasschmuck Kette Ketten
171 Startseite Perlen
10119
Berlin
Perlenschmuck Ketten Armbänder Halsbänder Ringe alles in Handarbeit gefertigte Einzelstücke ... Sie den Besuch im Shop und lassen Sie sich verführen! Brunnenstrasse Berlin. Öffnungszeiten Di-Fr
nutsandpearls.de Perlen Schmuck Ketten Armbänder Halsbänder
172 Morseketten individuelle Perlenketten Morsecode
10247
Berlin
Gestalten Sie Ihre individuellen MorsecodeKetten mit verschlüsselter Botschaft. Handgefertigte KeramikPerlen jede Kette ein Unikat!
morseketten.de Morsecode Kette Schmuck Perlen Gestalten
173 LasportsTattoo Startseite Tättowierer
13349
Berlin
lasportsTattoo aus Berlin findet mit Ihnen das ideale Tattoo für Sie und bringt es professionell unter Ihre Haut. ... Sie uns LA Tattoo Müllerstr. Berlin Kontakt Rufen Sie einfach an unter oder nutzen
lasports-tattoo.de Tättowierer Tätowierungen Tattoo Piercing Piercen
174 THE DISTRICT SIX STORE
12435
Berlin

districtsix.de
175 Leihhaus BB / Pfandhaus Pfandhaus
12099
Berlin
Pfandhaus Berlin Leihaus Tempelhof Berlin Geld gegen Pfand Bargeld ohne Schufaauskunft und ohne Gehaltsabrechnung in Berlin ... ) Silber Antiksilber Schmuck Erbschmuck Markenuhren Antiquitäten Gemälde KFZ-Beleihung Kommen
bb-leihhaus.de Pfandhaus Leihaus Tempelhof Leihhäuser Pfandhäuser Geld Sofort Kredit
176 Ankauf Berlin Technik PC
10243
Berlin
Technischer An Verkauf (SecondHand) in Berlin Ankauf Ankauf Berlin Handys Tv HiFi Video Computer Spielkonsolen SOFORT BARGELD !!! ... Der Laden Ankauf Anfahrt Kontakt ? Skype us facebook Sie finden uns in Berlin
anundverkauf-berlin.de PC PC System Notebook Computer
177 Startseite | Bohm und Bohm und Bohm GmbH Packseiden
13403
Berlin
Bohm und Bohm GmbH Antonienstraße 57 13403 Berlin Großhandel für Tragetaschen Flachbeutel und Bodenbeutel SchmuckEtuis Geschenkverpackung ... - Berlin Willkommen bei Bohm und Bohm High Class und Premium Kollektion Hochwertiges und edles
bohmundbohm.de Packseiden Papiertaschen Schmucketuis Geschenkbänder Papiertragetaschen
178 Agentur Beverly Berlin
12047
Berlin
Beverly Berlin außergewöhnlicher Schmuck von N2 Les Nereides Rock around my neck Schiepek ... Willkommen in der wunderbaren Welt der Beverly Berlin! MESSEN . - . Januar TRENDSET
beverly-berlin.de
179 Woodvisions Edle Füllfederhalter schreibgeräte
10367
Berlin
Edle Geschenke aus edlen Hölzern. Hier finden Sie Unikate aus feinsten Maserhölzern. Schreibgeräte Schalen Dosen Schmuck und vieles mehr.
woodvisions.de Schreibgeräte Füller Füllfederhalter Kugelschreiber Geschenke Aus Holz
180 Agentur DE BOER PR SOPHIE
10119
Berlin
Seit mehr als 15 Jahren ist die Agenturinhaberin Vanessa de Boer in den Bereichen PR/Management/Vertrieb tätig. ... . Über uns Neuigkeiten Kunden SOPHIE by SOPHIE Retailers Kontakt Über uns Agentur DE BOER ist eine Repräsentanz
agentur-deboer.de SOPHIE By SOPHIE Ist Ein Namhaftes Schmucklabel Aus Stockholm.
181 Island Tribe Berlin
10437
Berlin
Willkommen bei Island Tribe Berlin street wear amp; organic piercings. Bei uns bekommen Sie handgedruckte TShirts Hoodies sowie PiercingSchmuck wie Plugs und Tunnels. ... willkommen beim island tribe Island Tribe - Wir führen Berliner street wear organic piercings Handgedruckte
island-tribe.de
182 Die Kraft des Feuersteins Mineralien
10789
Berlin
Feuerstein Jaspis Rügen Ostsee Schmuck aus Feuerstein geschliffener Feuerstein Souvenir aus Deutschland Ostseeküste Mineralienschmuck Infos Steinzeit Herkunft und Entstehung von
jasper-flint.de Mineralien Feuersteine Hühnergötter Kugelketten Splitterketten
183 Home Boutique Monique Tunika
12555
Berlin
Herzlich Willkommen bei Boutique Monique ! Getreu dem Motto Klasse statt Masse finden Sie bei uns viele ausgefallene und extravagante neue Lieblingsstücke.....
monique-design.de Tunika Boho Vintage Kleider Cardigans
184 Juwelier Höltge Juwelier
12099
Berlin
... . Uhrmachermeister J. Körber Tempelhofer Damm Berlin Telefon Tele
uhren-koerber.de Juwelier Schmuck Goldschmied Uhrmacher Juwelen
185 Pfandleihhaus Lohmann Berlin seit Christian Lohmann e.K. Goldankauf
10559
Berlin
Pfandleihhaus Lohmann in Berlin Charlottenburg und in Berlin Mitte. Goldankauf und Pfandkredite schnell diskret und unbürokratisch. ... www.leihhaus-lohmann-berlin -- Ihr Leihhaus in Berlin Mitte und Berlin Charlottenburg
leihhaus-lohmann-berlin.de Goldankauf Gold Ankauf Pfandleihhaus
186 Susanna Kuschek Kuschek
10437
Berlin
Susanna Kuschek Berlin ist Schmuckdesignerin und Goldschmiedin: Ringe Ketten Armbänder Pins und mehr. ... Schmuck Händler Termine Kontakt Ringe Ketten Armbänder Ohrschmuck Pins
duette-lunette.de
187 Goldschmiede Sommer Berlin Steglitz
12163
Berlin
... Schmuck Werkstatt Vita Kontakt Galerie Home l l Datenschutz
goldschmiedesommer.de
188 Susanna Kuschek Kuschek
10437
Berlin
Susanna Kuschek Berlin ist Schmuckdesignerin und Goldschmiedin: Ringe Ketten Armbänder Pins und mehr. ... Schmuck Händler Termine Kontakt Ringe Ketten Armbänder Ohrschmuck Pins
susannakuschek.de
189 Www.unikaton.de Strato AG
10587
Berlin
Unikaton Töpfermanufaktur In der Töpfermanufaktur Unikaton entstehen vielfältigste Keramikprodukte in interessanten Materialkombinationen. Angewendet werden die traditionellen Techniken: Drehen Modellieren Gießen. ... AccessoiresInterieurWohninventarSchmuckGeschenkeEinrichten
unikaton.de
190 INDIO Market indianisches Kunsthandwerk mexikanisches
10409
Berlin
Indianische Azteken und Maya Handwerkskunst aus Mexiko und Guatemala. Handgefertigte Produkte aus Mittelamerika. Lateinamerikanischmexikanisches Kunsthandwerk. ... ... ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- .. - Unsere Schafwolljacken Unsere Schafwolljacken aus San Cristóbal de las Casas Chiapas Mexico
indiomarket.de Mexikanisches Kunsthandwerk Mexikanische Handwerkskunst Maya Kunst
191 FriebeArt SchmuckUnikate und DrechselKunst FriebeArt
13125
Berlin
Entwurf und Fertigung von Schmuckunikaten Brautschmuck und Accessoires. Entwurf und Fertigung von Objekten der Drechselkunst Schreibgeraeten Dekoration und Spielgeraet.
friebe-art.de FriebeArt FriebeArt Friebe Renate Friebe
192 Home wohnaccessoires
12157
Berlin
Accessoires
katzbleu.de Wohnaccessoires Geschenke Fanartikel Schmuck Waesche
193 PremiumWaren Webverzeichnis für Qualitativ Premium
12555
Berlin
PremiumWaren.de Suchen Sie qualitativ hochwertige Produkte dann besuchen Sie unser Portal.
premium-waren.de Premium Waren Premium Katalog Luxus Katalog
194 Juwelier Warbinek Uhren
13507
Berlin
Ihr Juwelier im Norden Berlins. Wir bieten Uhren und Schmuckmodelle saemtlicher Hersteller ... Berlin erreichen. USt.-ID DE BGFE Öffnungszeiten Mo. bis Fr.
warbinek.de Uhren Schmuck Bestecke Warbinek Gravuren
195 Hobbystuebchen basteln
10243
Berlin
alles rund ums basteln materialien tipps und tricks
xn--hobby-stbchen-3ob.de Basteln Malen Hobby Serviettentechnik Lampen
196 Mailaden Verein zur Förderung keramischen Gestaltens - Mailaden e.V. Mailaden
10827
Berlin
Mailaden Wir sind eine Keramikwerkstattgemeinschaft in BerlinSchöneberg mit einem vielfältigen Angebot in unserem Laden.
mailaden-keramik.de Mailaden Keramik Berlin Schöneberg Werkstattgemeinschaft Gemeinschaftswerkstatt Kollektiv Laden
197 Onlineshop für Damen und Kauf
10435
Berlin
Online Shoppen bei uns soll Freude bereiten und dabei glücklich machen! Schuhe und Mode gibts sowohl von Skandinavischen Labels als auch von unserer eigenen Kollektion. ... Shorts Hosen Overall Schmuck Blazer Jacken Mäntel Taschen Rucksäcke Taschen Rucksäcke Schals Mützen
kaufdichgluecklich-shop.de Kauf Dich Glücklich Wood Wood Ganni
198 Home
10179
Berlin
... Willkommen auf der Website von Uhren-Schmuck-Foto. Hier befinden Sie sich in unserem
kueppers-schmuckzeit.de
199 Esomena | Esoterik Shop esomena
10825
Berlin
Esomena EsoterikShop ... Räucherwerk Edelsteine Statuen Schmuck Spirituelles und vieles andere an. Sie haben Ihr Passwort vergessen
esomena.de Esomena Esoterik Blume Des Lebens Achatscheiben Pendel Klein Pendel
200 Antiklager24.de Antik
13583
Berlin
Antiklager24.de Antiquitäten in Berlin und Brandenburg ... Goldankauf Herzlich Willkommen im Antiklager.de + + + + + + + + + + + + + + + + + + + + + + Noch mehr
antiklager24.de Antik Lager Antiquariat Antikes Gold Schmuck KPM Meissen Militaria
201 Berlinbombay berlinbombay
14193
berlin
berlinbombay store showroom textilien accessoires Indienshop in Berlin Grunewald Maa Tribal Jewellery Produkte von NonProfit Organisationen ... berlin-bombay textilien accessoires berlin-bombay store showroom berlin-bombay zwei Metropolen
berlin-bombay.de Berlinbombay Indienshop Berlin Grunewald Berlin Charlottenburg
202 Juwelier am Mehringdamm juwelier
10961
Berlin
Goldankauf Schmuckankauf Juwelier MoneyService ... Berlin Sollten Sie Fragen haben wenden Sie sich bitte an Inhaber Sabine Linhart
juwame.de Juwelier Mehringdamm Berlin Trauringe Ringe
203 Juwelier Bonze | Startseite Wedding
13409
Berlin
Juwelier Bonze Residenzstr. 137 in 13409 Berlin Tel. 030 47907767 ... Residenzstr. Berlin tel web. www.juwelier-bonze
juwelier-bonze.de Wedding Verlobungsringe Verlobung Trauringe Silberschmuck
204 Bernd Masche
12169
Berlin
... nicht an. Home Atelier Schmuck Partner Kontakt Datenschutz
bernd-masche.de
205 Kumasi Shop Home Afrikanische
10437
Berlin
Berlin bietet Gegenstände aus Kunst und Kunsthandwerk Afrikas insbesondere Ghanas an.
kumasi-shop.de Afrikanische Kunst In Berlin Afrikanische Masken Afrikanische
206 Archaeform archaeform GmbH Archaeform
14163
Berlin
... Home Artikel Schmuck Perlenketten Kettenanhänger Pins Armbanduhren Seide Seidentücher Seidenschals
archaeform.de Archaeform
207 Knifetech.de Berliner Messermacher Messer
13353
Berlin
... Home Kydex Messer Knife-tech Friends Netsuke Inro Sagemono Schmuck Kontakt Home Robert Hoffmann
knife-tech.de Messer Kydex Netsuke Inro Sagemono
208 Photorainbow Fotografie Stadt fotografie
13189
Berlin
Fotografie Momente in Bildern festhalten Fotos aus Fauna und Flora von Tieren und Landschaft ... wie Sonnenbrillen Gürtel und Schmuck und schöne Wohndeko wie Feen Drachen Fantasyfiguren und Tierfiguren
photo-rainbow.de Fotografie Foto Tiere Blumen Pflanzen
209 H0ME
10967
Berlin
... Home Goldankauf Service Trauringe Uhren Schmuck Spezialanfertigung Reparaturen Standorte Kontakt
prens-juwelier.de
210 Startseite Schmuckdesign
10437
Berlin
... Heike Walk Schmuckdesign Startseite Schmuck Aktuelles Kontakt Datenschutz Sitemap
heikewalk.de
211 Stefanie Holtz Schmuckdesign Anfertigungen Stefanie
10829
Berlin
Stefanie Holtz Schmuckdesign Anfertigungen Unikate ... und Anfertigungen auf Wunsch Home Öffnungszeiten Arbeiten Schmuck Referenzen Kontakt ORONDA - Fair Trade
stefanie-holtz.de Stefanie Holtz Schmuckdesign Anfertigungen Unikate
212 Ulrike stabe blüteneich Ulrike
14089
Berlin
Ulrike Stabe blütenreich bluetenreich Blumen Blumenladen Blumen Pflanzen Vasen Geschenke
bluetenreich-berlin.de Ulrike Stabe Blumenladen Blütenreich Bluetenreich
213 Welcome to Per4 Piercing
10249
Berlin
Per4 Ihr Piercing Tattoo Jewellery ? Medical Equipment ? Permanent Make Up Online Shop
piercingrestposten.de Piercing Tattoo Grosshandel Studiobedarf Medical Equipment Cutting Branding Scarification
214 Der KeltenShop  Runen Kelten runen
10367
Berlin
Keltisches und germanisches aus Holz. Hier finden Sie Runen Runenanhänger Schalen und Dosen aber auch sehr viele Informationen rund um die Kelten und Germanen.
kelten-shop.de Runen Kelten Germanen Druiden Runenanhänger
215 ✩ Berlin SunShine und Detlef
12687
Berlin
Sunshine und Tattoo Studio Alles rund um den Bereich Wellness Solarium Tattoo Piercing und Nagelstudio. In angenehmer Atmosphäre und einem tollen Ambiente können Sie sich ... sie einen Kurzurlaub für die Seele. SunShine Tattoo-Studio Mehrower Allee c Berlin + info
sunshine-tattoo-studio.de Detlef Niegisch 12685 Berlin
216 SCHALLER BEWEGO Gold
13465
Berlin
Goldschmiede Hans Schaller BeWeGo Schmuckdesign Gutachten ... Wir freuen uns Ihnen werte Besucher wieder unsere Galerie der "Berliner Werkstatt für Goldschmiedekunst
bewego.de Gold Und Silberschmuck Sowie Informationen Und Services Rund Um
217 Home kunstgalerie
12057
Berlin
VaniFaceS *** Gute *** Laune *** Emotionen*** kreiert von Silvana Czech ... Ist es wirklich war Du bist sooo goldig! Mein Sommer in Berlin! Iss mir übel! Ich bin soooo sauer
vani-living-art.de Kunstgalerie Antiquitaet Antiquität Barock Mobiliar
218 Ulrike stabe blüteneich Ulrike
14089
Berlin
Ulrike Stabe blütenreich bluetenreich Blumen Blumenladen Blumen Pflanzen Vasen Geschenke
xn--bltenreich-beb.de Ulrike Stabe Blumenladen Blütenreich Bluetenreich
219 Superskull – der Onlinestore Pletz & Behringer GbR Dia
10961
Berlin
Dia de los Muertos – große Auswahl an Kunsthandwerk TShirts sowie Skeletten aus Mexiko ... mexikanischen Skulls und den üblichen Devotionalien rund um den Dia de los Muertos - dem Tag der Toten finden
superskull.de Dia De Los Muertos Tag Der Toten
220 Reevoo Sein Revolutionärer Schmuckblog
13465
Berlin
Reevoo sein revolutionärer Uhrenblog ... Start Die Welt des Schmucks Allgemein » Schmuck selber gestalten [. Jul.
reevoo.de
221 Kunsthandel Fuchs Berlin – Kunsthandel
10117
Berlin - Mitte
Kunsthandel Fuchs ist in Berlin eine der ersten Adressen für Kunstgegenstände aus dem Jugendstil sowie dem Art Deco. Hier finden Sie zahlreiche Kunstobjekte welche die Herzen der Kunstliebhaber höher ...  Kunsthandel Fuchs Berlin – Kunsthandel für Jugendstil Art Deco Home English Kontakt
kunsthandel-fuchs.de Kunsthandel Fuchs Berlin Jugendstil Art
222 Home
10435
Berlin
... Ihr Fachberater in allen Lagen - für Uhren- Schmuck- und Servicefragen! Meisterbetrieb seit
meister-friedrich.de
223 Afrikanische Kunst Berlin Afrikanische
10623
Berlin
Galerie Dogon Berlin bietet Afrikanische Kunst in Berlin sowie Tribal Art in Berlin ... BERLIN - TRIBAL ART AUSSTELLUNG IN DER BLACK BOX KLEIN ABER FEIN. >>> Galerie ? Showroom "Black
galeriedogon.de Afrikanische Kunst Berlin Tribal Art Berlin Afrikanische
224 Produktmanufaktur marcel wältring; metallgestaltung Wältring
10625
Berlin
Handgefertigte Kleinserien und Unikate vornehmlich aus Metall aber auch weiteren Materialien wie Holz Stein und Glas aus dem Umfeld Wohnen und gedeckte Tafel. Die Produkte und Objekte ... > GerätGefäß > Objekt > Schmuck handgefertigte Kleinserien Unikate > Produktübersicht > Vita
produkt-manufaktur.de Wältring Berlin Design Designer Metaldesign
225 KATEYEPHOTOGRAPHY.COM Photographie
14163
Berlin
... -SESSIONS KINDER SCHMUCK HOCHZEITEN TIERE SCHWARZ-WEISS SEPIA BODY DELUXE [ ENGLISH LANGUAGE
kateye-photography.de
226 Ihr kompetenter Ansprechpartner für vegas
12043
Berlin
Ihr kompetenter Ansprechpartner für hochwertige Kosmetik Parfum und Silberschmuck von Vegas Cosmetics. Wir geben Ihnen eine Möglichkeit für eine finanziell unabhängige Zukunft. Bauen Sie mit uns Ihr Geschäft im ... Autobonus Geschäftspartner Geschäftspartner werden Produkte Qualitätszertifikat Der neue Schmuck-Katalog Eau
vegaspartner.de Vegas Cosmetics Vegaspartner Aloe Vera Network
227 Willkommen
12161
Berlin
... . Die Haare sind unser natürlicher Schmuck und wie Schmuck sollten die Haare auch gepflegt
haarkreation-lopez.de
228 Dekorationen aus Asien Kunsthandwerk
10965
Berlin
In unserem online shop finden sie eine große Auswahl an Dekorationen aus Asien. ... Figuren Windspiele Textilien Musikinstrumente Accessoires Albecia Berlin + Info
albesia.de Kunsthandwerk Dekorationen Holzschnitzerei Holzfigur Holz
229 HOME B&M Design GmbH Schmuck
10789
Berlin
Unikate im Schmuckdesignbereich hochwertige Korallen und Perlenschmuck
artpearls.de Schmuck Design Korallen Coral Perlen
230 DOCK 2 dekoration dock
12555
Berlin
Dies ist die offizielle Internetpräsenz der Firma DOCK 2 dekoration Inh. Anja Eichhorn
dock-2.de Dock 2 DOCK2 Dock2 Dock2
231 Die Kunstburg Antikes kunstburg
12051
Berlin
Antikes und schönes in Berlin Neukölln ... Die Kunstburg - Antikes in Berlin Neukölln Copyright
die-kunstburg.de Kunstburg Berlin Neukölln Neukoelln Antik
232 Schmuckkurse in Berlin Schmuckkurse
12437
Berlin

hobby-schmuck-kurse.de Schmuckkurse Berlin Schmuckkurse Schmuck Kurse
233 Carat International Ihr Carat International KG Goldbarren
10117
Berlin
Carat International KG Ihr Spezialist für Feingold Barren aus Berlin hilft Ihnen Ihr Geld sicher zu investieren. ... International KG Offices Berlin Germany The European Union Warsaw Poland The European Union Conakry Rep
gold-international.de Goldbarren Gold Au Goldkauf Goldverkauf
234 _ Handyschmuck _ ChinChin diva
10178
Berlin
Handyschmuck ist der letzte Schrei in Japan. Dieser Modeschmuck wird am Handy befestigt. diva berlin hat eine exklusive ChinChin Handyschmuck Kollektion entworfen.
diva-berlin.de Diva Berlin Divaberlin ChinChin Jana Schoellner
235 Mexberries
12437
Berlin
... Schmuck-Fotografie Blog Hallo Welt! . Dezember Susan Allgemein comment Willkommen zur deutschen
mexberries.de
236 Willkommen bei Ihrem TraditionsGoldschmied Berlin
12107
Berlin
... Berlin - Mariendorf Mariendorfer Damm Berlin / + Seit über
juwelier-eichert.de Berlin Germany Deutschland Tempelhof Buckow
237 Home
12555
Berlin
Malen Zeichnen coeart ... Birgit Burdack - Heimerzieherausbildung mit Lehrbefähigung in Berlin-Köpenick -
coeart.de
238 | Eigenart | Atelier
10437
Berlin
... wird von mir entworfen und in Handarbeit gefertigt. Gern berate ich Sie individuell und erstelle Schmuck ganz
eigenart-schmuckgestaltung.de
239 Beschenkmich.de und jeder make a startup GmbH beschenkmich.de
10178
Berlin
Entdecken und verschenken bei beschenkmich.de: Elektronik Foto DVD Musik Bücher Games Spielzeug Sportartikel Drogerie mehr ... Geschenkgutscheine Parfüm und Kosmetik  Schmuck und Schuhe Amazon Widgets Amazon Widgets JETZT eine eigene
beschenkmich.de Beschenkmich.de Bücher Elektronik DVD Games
240 GLUCOMAX Alles für Glucomax GmbH diabetes
10827
Berlin
GLUCOMAX Alles für Diabetiker ... Über uns Wissenswertes Kontakt Anfahrt Schöneberg Anfahrt Tempelhof Kontaktformular Links Aktuelles My Schmuck
glucomax.de Diabetes Diabetis Diabetiker Diabetikerbedarf Schulungen
241 Fumanchuh
10245
Berlin
Fumanchuh ... Klamotten und Accessoires wie Strümpfe Strumpfhosen Gürtelschnallen und Schmuck kann man hier erstehen
fumanchuh.de
242 Zlotoschmuck.de R. Streciwilk
13409
Berlin
... Zloto Schmuck - R. Streciwilk infozlotoschmuck Startseite Über uns Veredelung
zlotoschmuck.de
243 Kunert Home
10707
Berlin
... Home Fossilien Schmuck Naturmineralien Trommelsteine Esotherik Geschenkartikel Kontakt
steine-kunert.de
244 AusteriaBrasserie
14199
Berlin
... Brasserieküche auf jeden Fall aber für Gastlichkeit in der schmucken Schmargendorfer Villa. Bei schönem Wetter
austernexpress.de
245 Ludwig menzel
10365
berlin
... ludwig menzel silberschmied gerät schmuck experiment ausstellungen kontakt impressum aktuell
ludwig-menzel.de
246 Namasté Geschenke aus
14059
Berlin
... Filz Glas Kleidung Körper Geist und Seele Papier Schmuck Wohnaccessoires Aktuelles Was war
namaste-berlin.de
247 Die Welt echter Edelsteine c/o NEWE Real Estate & Energy GmbH Edelsteinschmuck
13601
Berlin
Edelsteinschmuck in allen Variationen günstig online bestellen. Ringe Anhänger Ohrringe und vieles mehr finden Sie bei Zaubersternwelt.de ... zaubersternwelt Ringe Schmuck Edelsteinlexikon Ringe Schmuck Ohrschmuck Armbänder Ketten Anhänger
zaubersternwelt.de Edelsteinschmuck Goldschmuck Silberschmuck Mondlichttopas Rubin
248 Bauhausshop bauhaus-archiv gmbh design
10785
berlin
designshop für wohnen büro tisch+küche uhren spiele plakate original bauhaus modell im bauhausarchiv berlin ... schmuck Warenkorb artikel summe Ihr Konto Kasse Anmelden liefer- und versandkosten unsere agb
bauhaus-shop.de Design Shop Design Designklassiker Bauhaus Klassiker
249 Startseite barachalakolumbiens Webseite!
13086
Berlin
... verkaufen wir Schmuck aus Naturmaterialien sowie Panamahüte und Tagebücher. Jedes unserer Produkte
barachala-kolumbien.de
250 Goldankauf Juwelier Saro
12161
Berlin
Juwelier Saro Ihr GoldankaufExperte in Berlin steht für Goldankauf mit fairen und transparenten Preisen und kundenfreundlichen Goldankauf Angeboten. ... Goldankauf seit Main menu Startseite Gold Ankauf Goldpreis Schmuck Ihre Filiale Kontakt
bestgoldankauf.de
251 Schnäppchen | Sonderangebote | Sonderangebote
10719
Berlin
Ihr Portal für Schnäppchen Sonderangebote Gratis Angebote Rabatte Gutscheine kostenlose Warenproben Preisvergleich reduzierte Ware
welt-der-angebote.de Sonderangebote Gratis Angebote Kostenlos Schnäppchen
252 Snugata Home öko
10247
Berlin
Snugata Kinderkleidung für 010 Jährige. natürlich öko logisch
snugata.de öko Kleidung Biobaumwolle Ökomode Katze
253 Lustgärten und Gartengräber Mughal
14195
Berlin
Bis zum 28. Januar 2007 zeigt das Museum für Indische Kunst in Berlin Dahlem die Sonderausstellung 'Lustgärten und Gartengräber Höfische Kunst zu Zeit der MoghulHerrschaft.' 170 Meisterwerke aus drei
moghul-garten.de Mughal Garden Mughal Painting Mughal Paintings In Berlin Mughal
254 Über die Galerie : Froschhammer & Rosenvogel GbR
10117
Berlin
... Froschhammer Rosenvogel Galerie für Schmuck News News Schmuck Nicole Bauer Christine Brodersen
froschhammer-rosenvogel.de
255 Home | LUXUS4YOU LUXUS4YOU GmbH
10719
Berlin
... weitere Luxusuhren SCHMUCK Armbänder Armreifen Audemars Piguet BulletsPeace Broschen Nadeln Cartier
luxus4you-online.de
256 Goldschmied Daniel Goldschmuck Breuning
12163
Berlin
Goldschmied Daniel Schloßstr. 99 12163 Berlin Steglitz Breuning Trauringe Fischer bicolor Gelb Weißgold Paltin Aussengravuren Gerstner Legierung ... Sie auch herzlich in unsere Filiale in Berlin-Steglitz ein. Trauringe Lassen Sie sich von den schönsten
goldschmied-daniel.de Breuning Trauringe Fischer Bicolor Gelb
257 Willkommen bei SELECTED LABELS® Selected
10715
Berlin
Selected Labels bietet ein attraktives Angebot von Reiseaccessoires wie Reisekoffer der Marke Hauptstadtkoffer über Projektionsleinwände von Ultraluxx. Wir bieten zudem eine Auswahl an Textilien und Sonderposten zu einem fairen Preis ... Warenkorb Anmelden Blog Kategorien Damen Kleider Tops Accessoires Gürtel Schals Schmuck
selected-labels.de Selected Labels SelectedLabels Selectedlabels SelectedLabels Selectedlabels Fashionportal Deine
258 Uhrenklinik Berlin Anschrift: Uhrenklinik GbR Uhrenklinik
14057
Berlin
Berliner Uhrenklinik Fachwerkstatt für Uhrenreparaturen und Schmuckreparaturen. Mit viel Erfahrung reparieren wir Armbanduhren Wanduhren Standuhren und Tischuhren vieler Fabrikate. Bei Großuhrenreparaturen nutzen Sie bei Bedarf unseren Hol ... wir verkaufen Uhren Boccia Pulsar und Seiko Regent wir reparieren Uhren wir verkaufen Schmuck
berliner-uhrenklinikweb.de Uhrenklinik Berliner Uhrenklinik Uhrenreparaturen Uhrmacher
259 EORA Hörschmuck Home Bernafon Hörgeräte GmbH
12277
Berlin
... Sie sind hier ? Home EORA Hörschmuck Navigation Home Schmuck-Kollektion Design Technik
hoerschmuck.de
260 Angesagte Taschen Accessoires 7trends-Enamora GmbH fashion
10409
Berlin
7trends Der Online Shop für angesagte Taschen und trendige Accessoires. Traumhafte Handtaschen schöne Schmuckstücke und passend abgestimmte Tücher Schals für einen umwerfenden Auftritt zu jeder Gelegenheit. Jetzt ... Gürtel Geldbörsen Fritzi aus Preußen Taschendieb Wien Hüftgold Berlin Cowboysbag Legend Schmuck Lua
7trends.de Fashion Bekleidung Mode Shop Outfit
261 Uhrenklinik Berlin Uhrenklinik
14057
Berlin
Berliner Uhrenklinik Fachwerkstatt für Uhrenreparaturen und Schmuckreparaturen. Mit viel Erfahrung reparieren wir Armbanduhren Wanduhren Standuhren und Tischuhren vieler Fabrikate. Bei Großuhrenreparaturen nutzen Sie bei Bedarf unseren Hol ... wir verkaufen Uhren Boccia Pulsar und Seiko Regent wir reparieren Uhren wir verkaufen Schmuck
uhrenklinik-berlin.de Uhrenklinik Berliner Uhrenklinik Uhrenreparaturen Uhrmacher
262 Taostore
12357
Berlin
... Ihr Konto Warenkorb Kasse Startseite » Katalog Kategorien Jade Schmuck Malas Klangschalen
taostore.de
263 EORA Hörschmuck Home Bernafon Hörgeräte GmbH
12277
Berlin
... Sie sind hier ? Home EORA Hörschmuck Navigation Home Schmuck-Kollektion Design Technik
xn--hrschmuck-07a.de
264 Holzschmuck online kaufen
10317
Berlin
Kaufen Sie qualitativ hochwertigen Holzschmuck in klassischem Design online! Ohrringe aus Holz Holzkette Holzarmband wir haben sie alle. ... Start Ladies Ketten Colliers Armbänder Ohrringe Haarschmuck Girls Schmuck Sale Kontakt Start
jewelwood.de
265 ABC Complett Ladeneinrichtungs GmbH ABC ComplettLadeneinrichtungs GmbH Ladeneinrichtung
12159
Berlin
Ladenbau Berlin Ladenbau und Ladeneinrichtung Berlin. Mit 25 Jahren Erfahrung Ihr kompetenter Partner bei Umbau Ausbau und Planung Ihrer individuellen Geschäftsräume. ABC Complett GmbH. ... Datenschutzerklärung ABC ComplettLadeneinrichtungs GmbH Perelsplatz Berlin + - +
apothekenbau-berlin.de Ladeneinrichtung Berlin Ladeneinrichtung Berlin Ladenbau
266 Goldschmiedin in Berlin Entwürfe Design
10407
Berlin
Goldschmiedin Design Einzelanfertigungen ... KOLLEKTION VITA HOCHZEIT LEISTUNGEN IMPRESSUM KONTAKT copyright weissgold berlin Â
weissgold-berlin.de Design Entwürfe Nach Handskizzen Oder 3 D CAD Zeichnungen
267 AusteriaBrasserie
14199
Berlin
... Brasserieküche auf jeden Fall aber für Gastlichkeit in der schmucken Schmargendorfer Villa. Bei schönem Wetter
austeria-brasserie.de
268 Ellisue berlin Jewelry
10435
Berlin
... Herzlich Willkommen! ellisue Berlin kombiniert Altes und Neues Schlichtes und Ausgefallenes zu zeitgemäßem
ellisue-berlin.de
269 Juwelier MEDSTEIN | Goldschmied
10827
Berlin
... PER POST WERKSTATT SCHMUCKREPARATUREN UHRENREPARATUREN SCHMUCK MIT GRAVUR EDELSTEINE FASSEN TRAURINGE
medstein.de
270 Meine Edition: Startseite meineedition.de RM Buch und Medien Vertrieb GmbH
10178
Berlin
... Uhren Schmuck Accessoires Schmuck Sammeln Seltenes Seltenes Der Warenkorb ist leer
meineedition.de
271 Home | manualeberlin
12557
Berlin
... -BERLIN ist die Designerin Kristina Grohrock aus Berlin die mit viel Begeisterung und Freude immer
manuale-berlin.de
272 Superschlüpfer Underwear Superschlüpfer
10245
Berlin
... Springe zum Hauptinhalt » Kategorie Navigation Shop Berlin Über Superschlüpfer Lage Presse
superschluepfer.de Superschlüpfer Unterwäsche Herrenwäsche Damenwäsche Markenwäsche
273 Ferienwohnungen auf Usedom
10961
Berlin
... im schmucken Seebad Zempin Das Seebad Zempin liegt an der schmalsten Stelle der wunderschönen Insel Usedom
schmitz-usedom.de
274 Softbuster:
10625
Berlin
Official Softbuster Artist Page: Psychedelic Trance Psytrance Goatrance free mp3 downloads ... Schmuck LED Wanduhren Geschenkideen LED Party Zubehör
softbuster.de
275 Superschlüpfer Underwear Superschlüpfer
10245
Berlin
... Springe zum Hauptinhalt » Kategorie Navigation Shop Berlin Über Superschlüpfer Lage Presse
xn--superschlpfer-4ob.de Superschlüpfer Unterwäsche Herrenwäsche Damenwäsche Markenwäsche
276 Martinas Garderobe Webdesign
12105
Berlin
... ) Stiefel Accessoires Taschen Gürtel Schals Handschuhe Mützen Hüte Schmuck (
martinas-garderobe.de Webdesign Konstantin Peterson
277 Zahnarztpraxis Dr. Robert Schulz Implantat
13629
Berlin
... ZAHNARZTPRAXIS DR. ROBERT SCHULZ Startseite Anfahrt Kontakt Ihr Zahnarzt in Berlin
zahnarzt-siemensstadt.de Implantat Parodontose Prothese Vollnarkose Zahnarzt
278 Cudux Eleganz die
10318
Berlin
... Ohrringe Pflege Ringe Schmuck Uhren Startseite Eleganz die schmückt Düfte Damen Eau de Toilette Kerzen MÃ
cudux.de
279 Goldschmuck verkaufen bei Gold altgold
14052
Berlin
Seröser und kompetenter Ankauf von Goldschmuck Silberbesteck und Zahngold in Berlin ... verkaufen Goldpreise Goldbarren Silberverkauf Gold Ankauf Berlin Gold verkaufen Berlin Schmuck Ankauf
gold-ankauf-berlin.de Altgold Verkaufen Berlin Edelmetallankauf Silber Verkaufen
280 Jugend berät Verbraucher Ratgeber
13156
Berlin
Shopping Tipps und Ratgeber berät Verbraucher Vielseitig ... Jugend ? berät Verbraucher vielseitig Shopping Tipps und Ratgeber für jung und alt Mode Schmuck
jugend-bvv.de Ratgeber Tipps Shopping Shoppingtipps Shoppingnews
281 Brigade glücklich Kostüme/Kostümverleih
10437
Berlin
... --> Home Mode Schmuck Accessoires Kostüme Geschenke Dekoration Events News Kontakt Rundrum
brigadegluecklich.de
282 Hatay Juwelier Seit Hatay
10967
Berlin
Hatay Juwelier Berlin Kreuzberg Neukölln Schöneberg ... Schöneberg Goldankauf in Berlin Schmuck Design Trauringe Cera Trauringe Cilor Trauringe Fides Trauringe Tarz
hatay.de Hatay Juwelier Türkischer Juwelier Türk Kuyumcu
283 Styleserver.de Eißmann & Köhler GbR #IndexMetaKeyword
10115
Berlin
#IndexMetaDescriptionStandard# ... Canvas Taschen Accessoires Schals Mützen Handschuhe Geldbörsen Designer Sale Schmuck Schals Halsketten
styleserver.de #IndexMetaKeywordsStandard#
284 LEO SPIK Auktionen
10707
Berlin
... - DOSEN - MOBILIAR MINIATUREN - SCHMUCK - GLAS - KUNSTGEWERBE ASIATICA - ORIENTTEPPICHE - TEXTILIEN
leo-spik-auktionen.de
285 Onlineshop24.de
12163
Berlin
... onlineshop.de feedback Startseite Kategorien Shopping-Kategorien onlineshop.de bietet
onlineshop24.de
286 GutscheinGeier.de
12163
Berlin
... Mobilfunk Festnetz Internet Mode Schmuck Schuhe Sonstiges Sport Tierbedarf Suchen Los Aktuelle
gutscheingeier.de
287 Tierfilmer.de Informationen rund MSP Concept GmbH & Co. KG tierefilmen
10719
Berlin
Informationen rund um tierefilmen fotografieren filmkamera ... tierfilmer Fotografieren Alle aktuellen Meldungen "Schmuck versichern
tierfilmer.de Tierefilmen Fotografieren Filmkamera
288 Xxxxx zierstiche xxxxx zierstiche
10245
Berlin
Zierstiche Textildesign entwirft und fertigt Kleidung Taschen Accessoirs und Stofftiere in individuellen Kleinauflagen oder als Unikate ... suparina Supaklasse Schmuck Perlerei Perlen Schmuck Berliner Design Misses Marbles Berliner Design
zierstiche.de Zierstiche Textildesign Kleidung Taschen Kuscheltiere
289 BazAra Indische Möbel
12047
Berlin
... Auf Schmuck und Textilien gibt es einen Rabatt von %. Willkommen bei ! hat sich auf indische
bazara-berlin.de
290 Firlefanz | Modeschmuck
10823
Berlin
... von Dior hat mittlerweile Sammlerwert. Kategorien Schmuck Schlagwörter breites Armband Christian Dior
firlefanz-berlin.de
291 Über luxima luxima
10711
Berlin
... Über luxima Mode Schmuck Kunst Kommissionsware Galerie Regalvermietung Kontakt Über luxima Mode
luxima.de
292 KostümZauberei der Adlershofer Kostümverleih
12489
Berlin
... ? Schirm Perücken ? Kronen Schmuck ? Uhren ? Brillen Schuhe ? Taschen ? Handschuhe Liebe zum Detail Räume
kostuemzauberei.de Kostümverleih Kostümfundus Kostümdesign Filmkostüm Historische
293 Katja Rose
10439
Berlin
... und Kritik... Katja Rose Malerei Keramik Schmuck
kunst-rose.de
294 Carl Schuhmann JuwelenschmiedeJuwelier
10627
BERLIN
... Goldschmiede die Ihnen jeden Wunsch präzise und umgehend erfüllen kann. uhren schmuck rent-a-juwel atelier
juwelier-carl-schuhmann.de
295 Friedhofsgärtnerei Heidefriedhof: Lutz Rademacher Gärtnerei
12107
Berlin
Herzlich Willkommen auf den Internetseiten der Friedhofsgärtnerei Rademacher aus Berlin ... Reißeckstraße Berlin Telefon Tele Öffnungszeiten Mo - Fr
friedhofsgaertnerei-heidefriedhof.de Gärtnerei Berlin Friedhof Heidefriedhof Friedhofsgärtner Ruhegemeinschaft Floristik Blumen Strä
296 Indischer Basar Räucherstäbchen Räucherstäbchen
13403
Berlin
Indischer Basar Räucherstäbchen Geschenkartikel Textilien Modeschmuck uvm. ... Holzware Musik Spiele Räucherware Schmuck Tücher Wellness Wohnaccessoires Boxen Kisten Kleinmöbel
indischerbasar.de Räucherstäbchen Geschenkartikel Textilien Modeschmuck Messingstatuen
297 Ringkissen
13591
Berlin
Ringkissen im Ringkissenshop von HopedreamDesign Deko und Hochzeits Accessoires extravagante Ringkissen und Tischdekoration ... Brauthandschuhe Brauthandschuh Ring Kopfschmuck Schmuck Haarnadeln Haarnadel Haarclips Haarclip Wäsche
hopedream-design.de
298 Galerie Streckfuß
12161
Berlin
... M E N U Startseite Das Mammut Galerie Schmuck Objekte Miniaturschnitzereien Auftragsarbeiten
galerie-streckfuss.de
299 Friedhofsgärtnerei Heidefriedhof: Lutz Rademacher Gärtnerei
12107
Berlin
Herzlich Willkommen auf den Internetseiten der Friedhofsgärtnerei Rademacher aus Berlin ... Reißeckstraße Berlin Telefon Tele Öffnungszeiten Mo - Fr
gaertnerei-rademacher.de Gärtnerei Berlin Friedhof Heidefriedhof Friedhofsgärtner Ruhegemeinschaft Floristik Blumen Strä
300 RunaXX RunaXX
12526
Berlin
RunaXX Wikinger Wikingerklamotten schwarze Szene Wikingwear Vikingwear Berserker Odin Thor Asgard Asen Walhalla Valhalla Ragnarök Odinsmus ... Kategorien T-Shirts Pullover Kappus Jacken Schmuck Newsletter Anmeldung -Adresse Bestseller
runaxx.de RunaXX Wikinger Wikingerklamotten Schwarze Szene
301 Trend Nägel Karow Nagelstudio
13125
Berlin
Trend Nägel Karow Berlin Pankow Weißensee Nagelstudio Wimpernstudio ... Ihrem freundlichen Nagelstudio und Wimpernstudio in Berlin-Pankow/Weißensee. Wir bieten Ihnen in entspannter
trend-naegel.de Nagelstudio Berlin Nord Berlin Pankow
302 Home Atelier Sarah
10719
Berlin
... Home Kollektion Kostüme Trainingsbekleidung Tanzzubehör Schmuck Kindertanzmode Bequeme Mode Hand
sarah-berlin.de
303 Ab ins Kind Kegel
10317
Berlin
Holzspielzeug Kurse Ballons mit Helium in Lichtenberg Berlin unsere Kurse: PEKiP Babymassage musikalische Früherziehung B1 Musikschule:Musikunterricht Klavierunterricht Gitarrenunterricht Gesangsunterricht Instrumentenzirkel Musikgarten der Laden: Individuelles a la Dawanda Pumphose ... Kinderbücher Schmuck Rund ums Baby Kurse Kurse für junge Familien mit Babys und Kindern
abinskindundkegel.de
304 Trend Nägel Karow Nagelstudio
13125
Berlin
Trend Nägel Karow Berlin Pankow Weißensee Nagelstudio Wimpernstudio ... und Wimpernstudio in Berlin-Pankow/Weißensee. Wir bieten Ihnen in entspannter Atmosphäre Nagel- und Wimpernstudio
trendnaegel-karow.de Nagelstudio Berlin Nord Berlin Pankow
305 Für Wohlbefinden und innere Versand
12347
Berlin
Point for Wellnes ist Ihr OnlineShop für Wohlbefinden und innere Harmonie. ... Sie Artikel rund um die Bereiche Wellness Naturkosmetik Fachbücher Gesundheit Wohnen Schmuck Feng Shui
point-for-wellness.de Versand Magie Pendel Räuchern Engel
306 Wald Berlin WALD Fashion GmbH
10119
Berlin
Die Begeisterung für Mode und Lifestyle teilen das Model Joyce Binneboese und die Stylistin Dana Roski mit Ihrem Kunden im kleinen Store WALD Berli... ... Home » Wald Berlin Newsletter X Versandkostenfrei ab EUR call + New Arrivals
wald-berlin.de
307 Jens Richard Berlin JENS RICHARD GmbH geschenk
10707
Berlin
Witzige und originelle Geschenke. Online Versand für TrendProdukte LifestyleArtikel und Accessoires. Geschenkideen für alle Anlässe günstig online kaufen. ... Forge de Laguiole Venini Nason Moretti Schiavon Georg Jensen Hering Berlin Robbe Berking
jensrichard.de Geschenk Geschenke Geschenkideen Geschenkeshop Trendprodukte
308 BranchennachweisOnline Branchen
12279
Berlin
Branchenverzeichnis Online Deutschland ... Anschrift lautet Werbeagentur Bach Waldsassener Berlin ~ Auftragserteilung per
branchennachweis-online.de Branchen Branchenverzeichnis Deutschland Deutschlandweit Alle
309 ChakraAnhänger Madaya ChakraAnhänger
14109
Berlin
Übersicht ChakraAnhänger ... Musikstilrichtungen Schmuck Tragekategorien Anhänger Engel-Anhänger Keltische Anhänger Kreuz-Anhänger Elfenklangkugelm
madaya.de ChakraAnhänger WurzelChakra SexualChakra SolarplexusChakra HalsChakra
310 Aplomo
14129
Berlin
... ; Kinderarmband; Kinderarmbänder; Kinder; Kinderschmuck; Schmuck für Kinder; Kindergeschenke; Geschenke für
aplomo.de
311 Weihnachtsmarkt auf dem Winterfeldtplatz Berlin
10783
Berlin
Der traditionelle Weihnachtsmarkt auf dem Winterfeldtplatz ist einzigartig und an den Adventssonntagen geöffnet. ... Traditioneller Weihnachtsmarkt in Berlin Startseite Händler Info Galerie Kontakt
weihnachtsmarkt-winterfeldtplatz.de Berlin Weihnachtsmarkt Winterfeldtplatz Winter Kinder
312 Cornelißen naTierliche Geschenke Geschenke
13509
Berlin
Cornelißen naTierliche Geschenke. Großhandel für Geschenkartikel Tierfiguren und vieles mehr ... an Geschenkartikeln Tierfiguren Plüsch Schmuck Trendartikeln und vielem mehr mitnehmen. Lassen
cornelissen-geschenke.de Geschenke Geschenkartikel Tierfiguren Plueschartikel Trendartikel
313 Boulevard Berlin | Das BoulevardBerlin
12163
Berlin
BoulevardBerlin das Shoppingcenter in der Schloßstraße in Berlin Steglitz. Das größte Einkaufscenter in Berlins Süden. ... START SHOPPING Übersicht Fashion Schmuck Accessoires Schuhe Lederwaren Gesundheit Beauty
boulevardberlin.de BoulevardBerlin Schloßstraße Shoppingcenter Einkaufscenter Einkaufen
314 Start Kreativ Tage Deco Concept GmbH Hobbybedarf
14109
Berlin
Kreativ Tage Berlin 15. 17. November 2013. Händler der gesamten Kreativbranche erwarten Sie an zwei Messetagen mit ihren Produkten und neuesten Trends auf über 8.000 qm in den ... Sie die Enter-Taste) . Start Besucherinfo Ausstellerinfo STATION Berlin Wettbewerb Ausstellerverzeichnis Kurse
kreativ-tage-berlin.de Hobbybedarf Messe Berlin Basteln Malen Nähen Sticken Stricken Häkeln
315 Willkommen bei Lunamaro Berlin
10961
Berlin
Das Geschäft Lunamaro in der Berliner Bergmannstraße verkauft exklusive indische Wohnaccessoires orientalische Möbel sowie Steinfiguren aus Bali. ... Sie einen Überblick über unsere Produkte! Weiter Kontakt Kontaktieren Sie uns! Lunamaro in Berlin Weiter Herzlich
lunamaro-berlin.de Berlin Orientalische Möbel Lunamaro Bergmannstraße
316 Home brautstyling hochzeitsstyling in brautmakeup
10247
Berlin
Das exklusive Hochzeitsstyling von glam appeal Style bringt Ihre Schönheit voll zur Geltung. Beratung Inspiration und Service vom Profi. ... Partner agb Ihr exklusives Brautstyling in Berlin ? Brandenburg Umgebung! Als ausgebildete Hair Make
glam-appeal-style.de Brautmakeup Brautfrisur Nagelmodellage Brautstyling Hochzeitsstyling
317 ORONDA Fair Trade Goldschmiede Fair
10829
Berlin
Fair Trade Goldschmiede ORONDA Berlin. Ihre Schmuckträume aus FairTrade Gold Silber und Edelsteinen! ... Umarbeitung online Shop Fair Trade Goldschmiede ORONDA Berlin Ihre Schmuckträume aus Fair-Trade Gold Silber
oronda.de Fair Trade Goldschmiede ORONDA Berlin
318 Kleid Schuh Berlin Kleid
10557
Berlin
Willkommen bei Kleid Schuh Berlin. Kleider machen Frauen glücklich. Teilen Sie mit uns unsere Leidenschaft für wunderschöne Kleider und Schuhe abseits vom Mainstream und mit viel Liebe und Begeisterung ...  Kleid Schuh Berlin - Kleider machen Frauen glücklich - ana alcazar blaumax
fashion-world-online.de Kleid Schuh Berlin Lasare Made In
319 Silberfair fairtrade
10247
Berlin
fairtrade Silberschmuck ... Datenschutz Fairer Handel AGB Warenkorb südsinn Schmuck fairtrade Homepage Ketten/ArmbÃ
silberfair.de Fairtrade Silberschmuck
320 Tage eines Mediengestalters
12351
Berlin
Blog über Webdesign Grafik und alles was dazu gehört ... » faszinata Schmuck Gewinnspiel + Glossybox Filed Under Allgemein Sonstiges Nov. Haa wie geil
weltimperator.de
321 Startseite | Galerie WORKSHOP
10623
Berlin
... Objekte Keramik Gefäße Schalen Objekte Schmuck Glasschmuck Keramikschmuck Edelsteinschmuck Papierschmuck
wohnen-und-kunst.de
322 Cornelißen naTierliche Geschenke Geschenke
13509
Berlin
Cornelißen naTierliche Geschenke. Großhandel für Geschenkartikel Tierfiguren und vieles mehr ... auf eine Reise durch unser breit gefächertes Sortiment an Geschenkartikeln Tierfiguren Plüsch Schmuck
natierliche-geschenke.de Geschenke Geschenkartikel Tierfiguren Plueschartikel Trendartikel
323 Luisenforum Potsdam Die BERLINHAUS Verwaltung GmbH Shopping
10969
Berlin
In der Brandenburger Straße entsteht direkt am Brandenburger Tor das Luisenforum Potsdam. ... der schmucken Preußen- und Schlösserstadt entsteht unweit des Brandenburger Tors eine moderne mehrgeschossige
luisenforum-potsdam.de Shopping Potsdam Luisenforum Brandenburg Gewerbe Mieten Altstadt Galerie Gastronomie
324 Silber Kette Trauringe
12053
Berlin
... Silber Trauringe Partnerringe Eheringe m. Zirkonia inkl. MwSt zzgl. Versand Schmuck erleben! Herzlich
aurumjewelry.de
325 Profilwerbung.de: Startseite CTI New Media GmbH
10179
Berlin
... Ihr Branchen- und Firmenportal für den Norden Berlins Suche RSS Feed Folge uns Über Profil
arndt-werbezentrum.de
326 Möbel Tischlerei Berlin Möbel
10559
Berlin
Möbel Tischlerei Berlin Möbelbau Innenausbau Einbauschränke Einbaumöbel Tresen Küchen Regalwände Treppen Restaurierung ... -berlin mode-schmuck-design logopaedie-berlin-mitte der-architekt-berlin ostsee-ferienwohnung-zinnowitz
tischlerei-esslinger.de Möbel Tischlerei Möbeltischlerei Berlin Möbelbau
327 Leihhaus in der City Christiane Lohmann e.K. Leihhaus
10629
Berlin
Das Leihhaus in Berlin. Wir kreditieren sehr hoch Gold und Brilliantschmuck Luxusuhren Goldmünzen und Goldbarren Kunst Briefmarken und zahlen Ihnen das Bargeld sofort aus. ... - Ihr freundliches Leihhaus in Berlin Tradition in Berlin Charlottenburg Das Leihhaus City in Berlin existiert seit
leihhauscity.de Leihhaus Pfandleihhaus Berlin Lohmann
328 Lars Hetmanek | Storytelling Lars Hetmanek GmbH
10439
Berlin
... Schmuck Essentiel Louise Soleil des Sommers Soleil des Winters La Lune Prinzessin von Babylon
lars-hetmanek.de
329 Leihhaus in der City Christiane Lohmann e.K. Leihhaus
10629
Berlin
Das Leihhaus in Berlin. Wir kreditieren sehr hoch Gold und Brilliantschmuck Luxusuhren Goldmünzen und Goldbarren Kunst Briefmarken und zahlen Ihnen das Bargeld sofort aus. ... - Ihr freundliches Leihhaus in Berlin Tradition in Berlin Charlottenburg Das Leihhaus City in Berlin existiert seit
leihhaus-city.de Leihhaus Pfandleihhaus Berlin Lohmann
330 Home
12347
Berlin
... und noch nie dagewesenen Schmuck in Form von Anhängern Haarspangen Ohrringen und Armreifen. Lassen
magican.de
331 Juwelier Exclusiv in BerlinNeukölln
12051
Berlin
... in Berlin-Steglitz Exklusiver Schmuck und ein fairer Goldankauf bei dem Sie sofort bar ausgezahlt
juwelier-exclusiv.de
332 Micromagix immer eine geschenk
10409
Berlin
Witzige handgemachte und originelle Geschenke. Online Versand für TrendProdukte LifestyleArtikel und Accessoires. Geschenkideen für alle Anlässe günstig online kaufen. ... Home Accessoire Schmuck Möbel Bilder Geschenke Schreibwaren Artikelsuche
micromagix.de Geschenk Handgemacht Geschenke Geschenkideen Geschenkeshop
333 Startseite
13439
Berlin
... Herrenuhren Schmuck Goldankauf Kontakt Webshop Joop Tissot Maurice Bruno Willkommen Esprit Laden
goldmine-berlin.de
334 Queenly Queenly
10963
Berlin
Queenly Tierbedarf für Welpen kleine Hunde Katzen und Hamster. ... -Look Accessoires Tücher Schleifen Schmuck Pflege Shampoo Fellglanz Bürsten Lotion Parfum Anti
queenly.de Queenly Tierbedarf Welpen Hunde Katzen
335 Onlingo das Qualitätsportal für CTI New Media GmbH
13465
Berlin
Mit onlingo erhalten Sie eine Übersicht von hochwertigen Anbietern Dienstleistern Handwerken und sonstigen Unternehmen in und rund im Berlin. ... Wohlbefinden Essen Trinken Mode Schmuck Hobby Freizeit Dienstleistungen aller Art Suchen Finden Bitte
onlingo.de
336 Emailleschmuck Silberschmuck u. Emailleschmuck
10247
Berlin
Äußere Schönheit wirkt nach innen innere nach außen ... Bild Bild Bild Bild Bild ... Schmuck rundet sie ab. Bild Bild Bild Bild Bild
andraschmuck.de Emailleschmuck Silberschmuck Halsketten Fingerringe Anstecker
337 EORA Hörschmuck Home Bernafon Hörgeräte GmbH
12277
Berlin
... Sie sind hier ? Home EORA Hörschmuck Navigation Home Schmuck-Kollektion Design Technik
eora-hoerschmuck.de
338 Leihhaus in der City Christiane Lohmann e.K. Leihhaus
10629
Berlin
Das Leihhaus in Berlin. Wir kreditieren sehr hoch Gold und Brilliantschmuck Luxusuhren Goldmünzen und Goldbarren Kunst Briefmarken und zahlen Ihnen das Bargeld sofort aus. ... - Ihr freundliches Leihhaus in Berlin Tradition in Berlin Charlottenburg Das Leihhaus City in Berlin existiert seit
leihhaus-city-berlin.de Leihhaus Pfandleihhaus Berlin Lohmann
339 LiebTHEUER shop
12555
Berlin
Shop powered by PrestaShop ... aus schwarzem Kautschuk. Statement-Schmuck der einfach über den Arm gezogen wird und sich jedem Handgelenk
liebundtheuer.de Shop Prestashop
340 Juwelier Exclusiv in BerlinNeukölln
12051
Berlin
... in Berlin-Steglitz Exklusiver Schmuck und ein fairer Goldankauf bei dem Sie sofort bar ausgezahlt
juwelier-joko.de
341 Onlineshop Link Verzeichnis | onlineshop
13089
Berlin
Onlineshop kostenlos anmelden im Shopverzeichnis ohne Backlink Webverzeichnis für gute Onlineshops ... ) Uhren Schmuck Weitere Onlineshops Werbung Marketing Onlineshop finden
onlineshop-links.de Onlineshop Verzeichnis Deutschland Shopverzeichnis Onlineshop Kostenlos Anmelden
342 Profilwerbung.de: Startseite CTI New Media GmbH
10179
Berlin
... Ihr Branchen- und Firmenportal für den Norden Berlins Suche RSS Feed Folge uns Über Profil
profil-werbung.de
343 Mode Beauty online
10405
Berlin
Mode Beauty Lifestyle und Wohntrends auf STRIKE magazin entdecken und bestellen. STRIKE inspiriert mit gesunder Ernährung und Rezepte plus Reise und Insidertipps. ... Accessoires Schuhe Schmuck Styling Tipps Keypieces Mode Trends online kaufen Mode Accessoires Schuhe
strike-magazin.de Online Kaufen Kaufempfehlung Mode Styling
344 Home Start 2BL!NK GmbH
10587
Berlin
... integrieren. Innovativ und unkompliziert in vielen Accessoires wie z.B. an Anhängern Armbändern Schmuck
2blink.de
345 AERRabatt.de Reisen AERTiCKET AG Reisen
10967
Berlin
aerRabatt Reisen Linienflüge und Billigflüge für Lastminute einfach selbst online buchen und bis zu 50% sparen ohne Pep Antrag ... Spielzeug Sport Freizeit Uhren Schmuck Babyausstattung Bekleidung Schuhe Handtaschen Schlüsselwörter
aer-rabatt.de Reisen Rabatt Reise Shop Shopping
346 Berliner Kabarett Klimperkasten Kabarett
12101
Berlin
Das musikalischliterarische Kabarett Berlins erzählt von seiner Gründung gibt Serviceinformationen und beschreibt die aktuellen Programme. ... Partner Berliner Brett'l Linkmania Webkatalog Schmuck Online Casting Agentur Kabarett Berliner
cabaretberlin.de Kabarett Berlin Klimperkasten Theater Cabaret
347 Complett Räumung |
10783
Berlin
... Nachlass Berlin NachlässeNachlassverwertung Berlin - Über uns - Leistungen - Kontakt - Anfahrt
c-berlin.de
348 :: Sabine Henschel
10365
Berlin
... und Schmuck habe ich überwiegend in Büroberufen gearbeitet. Folgerichtig erlernte ich einen zweiten Beruf
creatart.de
349 Charms und Anhänger Shop charms
12099
Berlin
RiesenAuswahl an Charms und Anhängern zu tollen Preisen mit Tipps zum Einkauf! ... ) Unsere Schmuck-Shops Charms und Anhänger Diamant-Schmuck Armbänder und Armreifen Broschen und Anstecker
charmskaufen.de Charms Und Anhänger Shop Charms Und Anhänger Shop Online
350 Home Handel
12305
Berlin
HomepageTitel Berlin ... Kambergstr. a Berlin Telefon Mobil dorotexweb ? Willkommen
dorotex.de Handel Großhandel Second Hand Kinderbekleidung
351 Berliner Kabarett Klimperkasten Kabarett
12101
Berlin
Das musikalischliterarische Kabarett Berlins erzählt von seiner Gründung gibt Serviceinformationen und beschreibt die aktuellen Programme. ... Partner Berliner Brett'l Linkmania Webkatalog Schmuck Online Casting Agentur Kabarett Berliner
berlin-kabarett.de Kabarett Berlin Klimperkasten Theater Cabaret
352 :: Sabine Henschel
10365
Berlin
... und Schmuck habe ich überwiegend in Büroberufen gearbeitet. Folgerichtig erlernte ich einen zweiten Beruf
kreatart.de
353 Erfinderseite.de Informationen rund MSP Concept GmbH & Co. KG erfindungen
10719
Berlin
Informationen rund um erfindungen patente patentanwalt patentamt ... auch bei Autos Möbeln oder Schmuck existieren kreative Köpfe die den Geschmack ihrer Zeit prägen
erfinderseite.de Erfindungen Patente Patentanwalt Patentamt
354 Berliner Kabarett Klimperkasten Kabarett
12101
Berlin
Das musikalischliterarische Kabarett Berlins erzählt von seiner Gründung gibt Serviceinformationen und beschreibt die aktuellen Programme. ... Partner Berliner Brett'l Linkmania Webkatalog Schmuck Online Casting Agentur Kabarett Berliner
kabarettberlin.de Kabarett Berlin Klimperkasten Theater Cabaret
355 HOME KaaLee Store
10247
Berlin
... Geschenkartikel. In der hauseigenen Manufaktur wird modischer Schmuck mit Leder hergestellt. Vorsicht Suchtgefahr
kaalee.de
356 KlickSuche Webverzeichnis
13349
Berlin
Das Webverzeichnis zum suchen finden und gefunden werden! ... ) Partnerschaft Liebe PC-Games Konsolen Private Seiten Schmuck Uhren sonstiges Steuern
klick-suche.de Webverzeichnis Linkverzeichnis Webkatalog Branchen Suchmaschine
357 Linde Burkhardt Start Linde
10629
Berlin
Linde Burkhardt ... Projekte Schmuck Arnolfo di Cambio Vicenzo Oste Ausstellungen
lfburkhardt.de Linde Burkhardt Kermaik Teppiche Gestaltung
358 Flying Cow leder
12045
Berlin
Hier findet ihr eine große Auswahl an Tabaktaschen Tabakbeutel aus hochwertigem echtem Leder in exklusiver Handarbeit für euch gefertigt. ... accessoires schmuck schuhschmuck handarbeit echt leder berlin karabinerhaken abendtasche trageriemen tasche
flying-cow.de Leder Echt Tabaktasche Tabakbeutel Drehertasche Tasche Portemonnaie Portmonee Handy
359 Fotografin Sandra Gärtner Fotograf
12165
Berlin
... oder Schmuck. Sie sehen Ihren Vorstellungen sind keine Grenzen gesetzt! Ich biete Ihnen Aufnahmen
fotografin-dresden.de Fotograf Fotografin Sandra Gärtner Passbilder
360 Der Juwelier in BerlinTempelhof
12099
Berlin
... Der Juwelier in Berlin Tempelhof Zum Inhalt wechseln Direkt zur Hauptnavigation und Anmeldung Nav
joel-juwelen.de
361 Fusseltronic Electronic Development Geschenke
10965
Berlin
Entwicklung und Fertigung von elektronischen Geräten und Programmen ... Zuletzt geändert am .. Fussel-tronic ... VERSATILE LIKE BERLIN Startseite · Produkte
fussel-tronic.de Geschenke PocketPC Zubehör ElektronikEntwicklung PocketPC Programme
362 FeuervogelManufaktur Ihre individuelle
13086
Berlin
... Geschenkewelt Klassisches Sortiment Lavendel Welt Meeres Welt Mineralien Schmuck Mineralien Steine Orangen Welt
feuervogel-manufaktur.de
363 Muna Boutique Unser
10555
Berlin
... Unser Fachgeschäft Abendkleider Brautkleider Schuhe Schmuck Beratung Ihr Weg zu uns Kontakt
munaboutique.de
364 Gropius Passagen
12351
Berlin
... Schuhe Accessoires Uhren Brillen Schmuck Unser Standort Unternehmen Centermanagement Mallvermietung
gropius-passagen.de
365 Berliner Kabarett Klimperkasten Kabarett
12101
Berlin
Das musikalischliterarische Kabarett Berlins erzählt von seiner Gründung gibt Serviceinformationen und beschreibt die aktuellen Programme. ... Partner Berliner Brett'l Linkmania Webkatalog Schmuck Online Casting Agentur Kabarett Berliner
kabarett-klimperkasten.de Kabarett Berlin Klimperkasten Theater Cabaret
366 Weihnachten mit Toffifee Mit
13403
Berlin
Mit Toffifee wird Weihnachten noch weihnachtlicher! Zeigt uns eure Weihnachtsmomente mit Toffifee und sicher euch 1 von 4 Toffifee Flatrates für ein Jahr oder einen Weihnachtssocken mit 5 Toffifee Packungen. ... wird und lasst uns gemeinsam den Toffifee Weihnachtsbaum schmücken! Jetzt mitmachen Wochen ? Wochenchallenges
toffifee-gewinnspiel.de Mit Toffifee Wird Weihnachten Noch Weihnachtlicher! Zeigt Uns Eure
367 Berliner Kabarett Klimperkasten Kabarett
12101
Berlin
Das musikalischliterarische Kabarett Berlins erzählt von seiner Gründung gibt Serviceinformationen und beschreibt die aktuellen Programme. ... Partner Berliner Brett'l Linkmania Webkatalog Schmuck Online Casting Agentur Kabarett Berliner
webkabarett.de Kabarett Berlin Klimperkasten Theater Cabaret
368 Yolunda Hamamtuch
10997
Berlin
Entdecken Sie bei uns: Hamamtuch Strandtuch Saunatuch Saunahandtuch Strandlaken und Pestemal. Jetzt bequem online einkaufen. ... Hamamtücher traditionell hergestellte Alepposeife Tagesdecken aus Baumwolle filigranen Schmuck
yolunda.de Hamamtuch Strandtuch Saunatuch Saunahandtuch Strandlaken
369 Britta Knüppel
10557
Berlin
... Eshly Deli Box kvast - Nylons Schmuck Lookbooks Video Arbeiten Shows Shops Über mich AGB
brittaknueppel.de
370 Fotografin Sandra Gärtner Fotograf
12165
Berlin
... oder Schmuck. Sie sehen Ihren Vorstellungen sind keine Grenzen gesetzt! Ich biete Ihnen Aufnahmen
foodfotografin.de Fotograf Fotografin Sandra Gärtner Passbilder
371 Friseur der Zunft Friseur
14057
Berlin
Schnell kompetent persönlich: hier finden Sie alle Leistungen und Services unsere Preise und vieles mehr von Friseur der Zunft Ihrem Friseursalon für Berlin ... für Schönheit Ausstrahlung und Sexappeal. Sie sind Kleidung und Schmuck zu gleich. Wir haben es uns zur Aufgabe
friseur-der-zunft.de Friseur Frisur Schneiden Berlin Charlottenburg
372 Linde Burkhardt Start Linde
10629
Berlin
Linde Burkhardt ... Projekte Schmuck Arnolfo di Cambio Vicenzo Oste Ausstellungen
linde-burkhardt.de Linde Burkhardt Kermaik Teppiche Gestaltung
373 Goldankauf Wolf in Spandau: Goldankauf
13597
Berlin
Goldankauf in Berlin Spandau: Goldankauf Wolf. Ankauf vom Altgold Zahngold Bruchgold Tel: 03089645485 ... an. Dazu gehört Schmuck Altgold Zahngold Bruchgold Münzen und Barren. Die Bezahlung erfolgt bar
goldankauf-spandau.de Goldankauf In BerlinSpandau Goldankauf Spandau Altgold Ankauf
374 Verbundsuche Die besten Der Mittelstandsverbund ? ZGV e.V.
10117
Berlin
... /Heimtextilien PSB/Verpackung Parfümerie/Kosmetik Reinigung/Entsorgung/Hygiene Schmuck/Juweliere Schuhe/Textil
verbundsuche.de
375 Ihr schneller kostenloser
10247
Berlin
Ihr schneller kostenloser Preisvergleich ... .. Für Neu- und Bestandskunden. % Rabatt auf Schmuck von Engelsrufer Jetzt sofort bei lossparen
meinepreise24.de
376 BE STYLED BERLIN BE
14167
Berlin
BE STYLED BERLIN ... Schmuck Sport Homewear Basics Made in France BE STYLED BERLIN Sale MADE IN FRANCE BE STYLED BERLIN SALE
be-styled-berlin.de BE STYLED BERLIN
377 Bellamaria Exklusive Kosmetik Arena RKD GmbH
10707
Berlin
... Home Living Bettwäsche und Bettlaken Uhren Schmuck Damenuhren Herrenuhren (
bellamaria.de
378 Kontaktlinsen Shop kontaktlinsen
12099
Berlin
TopAuswahl Kontaktlinsen und Kontaktlinsenpflege von vielen Marken zu g?nstigen Preisen mit Tipps zum Einkauf! ... Windjacken Schmuck Shops Charms und Anhänger Diamant-Schmuck Armbänder und Armreifen Broschen und Anstecker
kontaktlinsen-auswahl.de Kontaktlinsen Shop Kontaktlinsen Shop Online Kaufen Günstig Online Kaufen
379 Kinderfahrrad Shop kinderfahrrad
12099
Berlin
TopAuswahl an Fahrr?dern f?r Kinder von vielen Marken zu g?nstigen Preisen mit Tipps zum Einkauf! ... Sonnenbrillen und Sportbrillen Regen Shops Gummistiefel Regenmäntel Regenschirme Windjacken Schmuck Shops Charms
kinderfahrradkaufen.de Kinderfahrrad Shop Kinderfahrrad Shop Online Kaufen Günstig Online Kaufen
380 FreeFotosBerlin Berlin Fotos foto
10557
Berlin
freefotosberlin.de ist ein kostenloses Angebot von lizenzfreien Fotos. Alle Fotos können gratis herunter geladen werden und sind lizenzfrei zu verwenden. ... free-fotos-berlin informationszentrum-psychotherapie-berlin mode-schmuck-design logopaedie-berlin-mitte
free-fotos-berlin.de Foto Fotos Berlin Kostenlos Kostenfrei
381 Damenmode aus Berlin
10437
Berlin
Herzlich ... Herzlich willkommen in der Werkstatt von Renate Reimann mitten im Berliner Stadtbezirk Prenzlauer Berg
renatereimann.de
382 Klapprad Shop klapprad
12099
Berlin
TopAuswahl an Klappr?dern von vielen Marken zu g?nstigen Preisen mit Tipps zum Einkauf! ... Sonnenbrillen und Sportbrillen Regen Shops Gummistiefel Regenmäntel Regenschirme Windjacken Schmuck Shops Charms
klappradkaufen.de Klapprad Shop Klapprad Shop Online Kaufen Günstig Online Kaufen
383 Bettelarmband Anhänger Bedeutung
13127
Berlin
Woher kommen und was bedeuten Bettelarmband Anhänger? Lernen Sie hier das Geheimnis dieser Anhänger kennen und erfahren Sie alles über Bettelarmbänder ... =amp;amp;amp;#;MarketPlace=DEamp;amp;amp;#;ID=V%FDE%Fgraciahandor-%F
bettelarmband-anhaenger.de
384 Home Sie
13509
Berlin
Sie suchen einen vintage laden in Berlin dann sind Sie bei uns genau richtig. Wir freuen uns auf Ihren Besuch im Stiefelkombinat Berlin. ... Dein individuelles Lichtkonzept Schmuck Tassen Wenn die Tasse zum Schmuck wird Ein KUSS für dein Zimmer Erlebe
textilkombinat-berlin.de Sie Suchen Einen Vintage Laden In Berlin Dann
385 Trekkingrad Shop trekkingrad
12099
Berlin
TopAuswahl an Trekkingr?dern von vielen Marken zu g?nstigen Preisen mit Tipps zum Einkauf! ... und Sportbrillen Regen Shops Gummistiefel Regenmäntel Regenschirme Windjacken Schmuck Shops Charms und Anhänger
trekkingradkaufen.de Trekkingrad Shop Trekkingrad Shop Online Kaufen Günstig Online Kaufen
386 Tro2Go Home Poccy - Point of Contact UG (haftungsbeschränkt) Branchenverzeichn
10247
Berlin
Branchenverzeichnis Tro2Go
tro2go.de Branchenverzeichnis Tro2Go Akzente Kaffee Tee Pralinen Delikatessen Feinkost Lebensmittel Gesc
387 Eiskunstlauf Shop Iceprincess
10367
Berlin
... Jungen Schmuck Accessoires Haarschmuck Schlüsselanhänger Schmuck Handschuhe Shirts Tops Kürkleider
eiskunstlauf-online.de
388 Mit 400 Produkten : Effektive
12489
Berlin
Fachhandel Effektive Mikroorganismen.Hier finden Sie eine Auswahl mit ca. 400 Produkten rund um die Effektiven Mikroorganismen ... Suchen Fachhandel für Effektive Mikroorganismen in Berlin Go Startseite Ihr Warenkorb keine Produkte Neue
em-kaufhaus.de Effektive Mikroorganismen EM 1 Effekt. MOa
389 Kristallfluss Sell It Smart GmbH #IndexMetaKeyword
10437
Berlin
Bitte hier Kategorietext hinterlegen... ... ) Warenkorb Warenkorb Artikel ? Schmuck + AccecoiresSchmuck + Accecoires Schmuck + Accecoires Dansk
kristallfluss.de #IndexMetaKeywordsStandard#
390 Fiolini.de Lifestyle
12247
Berlin
Deko Online Shop von Fiolini Design Accessoires kaufen Dekorationsartikel online bestellen Home Accessoires und moderne Dekoideen im Onlineshop. ... Singvögel Kollektion Holzfiguren Pinetti Taschen Schlüsselanhänger Schmuckrollen Giobagnara Spiele Schmuck
fiolini.de Lifestyle Deko Wohndeko Lederaccessoires Online
391 Bauchtanzkostüme Online Dein Bauchtanzkostüme
12165
Berlin
Orient Inside Bauchtanzkostüme und Bauchtanzkleidung Dein Bauchtanzladen aus Berlin für orientalische Kostüme Kinderbauchtanzkostüme ... Qualität IN BERLIN PERSÖNLICH VOR ORT Mein Benutzerkonto Mein Warenkorb Zur Kasse Anmelden Finde
orient-inside.de Bauchtanzkostüme Bauchtanzshop Bauchtanzkleidung Bauchtanz Online
392 Antiquitäten Flohmarkt: Antikes Sammeln Regina Pröhm & Michael Schrottmeyer GbR
10318
Berlin
Sammeln Flohmarkt: Antiquitäten antike Möbel Ansichtskarten Briefmarken Bücher Schallplatten Second Hand kaufen verkaufen. Antik Shop Verzeichnis. Berliner Flohmarkt. ... ] Maschinen Telefon Sonstiges Technik Computer Film Uhren Schmuck Antike Uhren [
oldthing.de
393 MGM Berlin teak
10715
Berlin
MGMBerlin : Groß und Einzelhandel mit Bronzen (Messing versilbert oder patiniert) Wohnaccessoires Stein und Holzfiguren Spiegel Fahnen und Tempelschirmen sowie von Möbeln in eigener Produktion ... Kleinmo?bel Accessoires Betten Wiegen Sitzmo?bel Tische Vitrinenobjekte Ethno Schmuck Alles anzeigen Ethno
mgm-berlin.de Teak Recycled Wood Bronze Figures Natural Stone Buddha Statues
394 Erkennungsmarken Home
10117
Berlin
... auf Dog Tags wirken! Hundemarken als persönliches Geschenk Beinahe jeder Mensch mag Schmuck. Natürlich
erkennungsmarken.de
395 DIYmode diy
12049
Berlin
Schöne und einfache DIY Anleitungen die schnell gelingen. ... erreicht ist die Frage wo ich meine Stoffe herbekomme. Viele Stoffe kaufe ich in Berlin auf dem Stoffmarkt
diymode.de Diy Mode Diy Mode Ideen
396 WOLKES CUPCAKES Online Shop Wolkes
10707
Berlin
Der 1. deutsche Cupcake Online Shop! Bestellen Sie Ihre Cupcakes ganz einfach online. Wählen Sie aus WOLKES CUPCAKES oder stellen Sie sich Ihren eigenen Cupcake mit MEIN CUPCAKE zusammen. Anfragen ... Baby Cupcakes GIFTS Schmuck ?MEIN CUPCAKE? CATERING ANFRAGEN FAQ Qualitätsanspruch Versand Facebook
wolkes-cupcakes-onlineshop.de Wolkes Cupcakes Anna Kait Annakait
397 XLBekleidung Übergröße XLBekleidung
13156
Berlin
Bei XLBekleidung findet man Mode und Tipps für Übergrößen große Größen und XLBekleidung in Herren und Damen Mode ... was für die Frau der Schmuck ist. Die klassische... Spezial Matratzen für Übergewichtige was muss beachtet
xl-bekleidung.de XLBekleidung Übergröße Große Größen
398 Startseite » Hochzeitsseiten MV
14165
Berlin
... die Standesbeamtin. Die Messeaussteller zeigen Braumoden Ringe und Schmuck Accessoires Catering Hochzeitstorten
hochzeitsseiten-mv.de
399 Schuhe Mode jetzt Zalando SE Schuhe
10243
Berlin
Mode amp; Schuhe jederzeit mobil bei ZalandoMobile 24h online shoppen! Riesen Auswahl amp; versandkostenfrei! ... Taschen Koffer Schmuck Tücher und Schals Mützen Hüte Caps Handschuhe Gürtel Geldbörsen Etuis Uhren
m.zalando.de Schuhe Damenschuhe Herrenschuhe Mode Kleidung
400 Potpourri Design und Manufakur Potpourri
10317
Berlin
Potpourri Design und Manufakur ... Start Geschenkideen Tee Schokolade Kerzen Schmuck Floristik Lampen Kleidung - Fashion Events
potpourri-berlin.de Potpourri Design Und Manufakur Berlin Lichtenberg Damen Fashion
401 Sotantar Yoga Shop yoga
10437
Berlin
Im Online Yoga Shop und im Laden in Berlin finden sie ihre Yogamatte Yoga Kleidung Meditationskissen in grosser Auswahl Yogabedarf und MantraCDs. Superschneller Versand. ... spirituellem Schmuck und Malas Yantras verschiedenen Ölen feinen Räucherstäbchen schönen Stäbchenhalter
yogashopberlin.de Yoga Yogahose Yogamatte Meditation Meditationskissen
402 ZZB Zahnmedizinisches Zentrum Optimum-Dental GmbH
12305
Berlin
Alles unter einem Dach ? über 25 Jahre Erfahrung in Berlin ? spezialisierte Zahnärzte Oralchirurgie professionelle Prophylaxe deutsches Meisterlabor. ... Zahnaufhellungszentrum Leistungen Zahn-Reinigung Zahn-Schmuck Bleaching Meisterlabor Optimum-Dental Leistungen
zzb.de
403 Günstige Website Homepage
10963
Berlin
... ? Live Demo Möbel Interieur ? Live Demo Wellness Beauty ? Live Demo Schmuck
mcwebsite.de
404 Brautschau XXL Brautmoden Brautkleider
10711
Berlin
Brautschau XXL Berlins erstes Braut und Abendmodenfachgeschäft mit Spezialisierung auf große Größen. Wir bieten Ihnen Brautkleider XXL und Abendmode in großen Größen. ... mit Spezialisierung auf große Größen. In unseren Brautateliers in Berlin und in Frankfurt am Main bieten
brautschau-xxl.de Brautkleider XXL Hochzeitskleider XXL Brautmoden XXL
405 Diamanten online Shop | diamanten
10719
Berlin
Wir bieten eine große Auswahl an Diamanten online ?#20; Bestellen Sie heute den Diamant Ihrer Wahl #20;? www.diamantenbreede.de ... Krappen Solitärring Krappen /wp-content/uploads///diamantring-breede.png Schmuck Ohrringe Anhänger
diamanten-breede.de Diamanten Diamant Diamant Online Dimanten Shop
406 Www.24colours.de | Onlineshop für 24colours GmbH Trends
10437
Berlin
24colours ? A BERLIN FASHION STORY. Im 24colours OnlineShop finden Frauen alle ModeTrends zu fairen Preisen. Gratis Versand ab 30? Bestellwert. CutOut Sandalen Latzhosen und Cropped Shirts im ... GO! Gratis Versandab ? Bestellwert sowie kostenloser Rückversand in DE! Blog Service Stores
24colours.de Trends Schuhe CutOut Neu Sale
407 Gutscheine Schnäppchen Gutscheine
13051
Berlin
Finde täglich neue Gutscheine Rabatte und Schnäppchen. Finde hier den Gutscheincode deiner Wahl und spare Geld beim OnlineShopping. ... Reisen Urlaub Sonstiges Spiele Sport Tickets Tierbedarf Uhren Schmuck Shops A-Z A B C D E F G H I J K
alinko.de Gutscheine Gutscheincodes Angebote Sales Rabatt
408 Home AlleeCenter Berlin
13055
Berlin
... Gesundheit Hobby Jeans Freizeit Kosmetik Lebensmittel Leder/Taschen Media Mode Optik Reisen Schmuck
allee-center-berlin.de
409 Rund um Berlin! Rezepte Berlin
13591
Berlin
Das ist meine Seite. Tolle Rezepte aus vergangenen Zeiten. News Infos und Tips für Berlin. Mit Gästebuch. Jetzt neu...mit Reise und Hotelbuchung. ... Rund um Berlin! Rezepte News Veranstaltungen... Partner Seiten cuge.org powered by HpSu
andyco.de Berlin BerlinRezepte BerlinHotel Polizeiticker Stau BerlinNews Veranstaltungen Hotel Urlaub
410 Home Antike Möbel antike
12459
Berlin
Willkomen bei AntikeMöbel und Antiquitäten. Umfangreiche Auswahl an hochwertigen Antiquitäten und antiken Möbeln ... und Antiquitäten Berlin Home Verkauf Ankauf Galerie Lexikon Aktuelles Kontakt Neue Verkaufsobjekte Großer
antike-moebel-berlin.de Antike Möbel Antiquitäten Barockmöbel Barock Möbel
411 Armbänder und Armreifen Shop armbänder
12099
Berlin
RiesenAuswahl an Armbändern und Armreifen zu tollen Preisen mit Tipps zum Einkauf! ... berlin icon brand jette josh just cavalli langani laviida le gramme (
armbandkaufen.de Armbänder Und Armreifen Shop Armbänder Und Armreifen Shop Online
412 Heldenmarkt Forum Futura UG (haftungsbeschränkt)
10405
Berlin
... Aussteller kennen HUMMELWOLF Schmuck und Accessoires Christof Feichtinger Café de Guatemala Brandenburg
heldenmarkt.de
413 Rund um Berlin! Rezepte Meine
13591
Berlin
Das ist meine Seite. Tolle Rezepte aus vergangenen Zeiten. News Infos und Tips für Berlin. Mit Chat Gästebuch und Forum. ... Rund um Berlin! Rezepte News Veranstaltungen... Partner Seiten Kontakt Mein Banner
berlin-news24.de Meine Seite Berlin BerlinChat BerlinFun BerlinRezepte Bonsai Kakteen BerlinHotel
414 Kindertagespflege in Berlin
13353
Berlin
... und dann zu einem Igelchen verbasteln Sonnenschutzkappe zum Basteln Raupen und Schmetterlinge schmücken jedes Fenster
berliner-kindertagespflege.de
415 Rund um Berlin! Rezepte Meine
13591
Berlin
Das ist meine Seite. Tolle Rezepte aus vergangenen Zeiten. News Infos und Tips für Berlin. Mit Chat Gästebuch und Forum. ... Rund um Berlin! Rezepte News Veranstaltungen... Partner Seiten Kontakt Mein Banner
berlinnews24.de Meine Seite Berlin BerlinChat BerlinFun BerlinRezepte Bonsai Kakteen BerlinHotel
416 Home Linden Center ECE Projektmanagement G.m.b.H. & Co. KG
13051
Berlin
... Gesundheit Haushalt Hobby Kosmetik Lebensmittel Leder/Taschen Media Mode Optik Parfümerie Reisen Schmuck
linden-center-berlin.de
417 Malermeister Norbert Preuß in Maler
13467
Berlin
Malermeister Norbert Preuß zuverlässiger Malermeister aus Berlin Reinickendorf der Meister arbeitet selbst mit ... Norbert Preuß Ihr zuverlässiger Malermeister aus Berlin Reinickendorf Malermeister Norbert Preuß
malermeister-preuss.de Maler Tapezierer Lackierer Meisterbetrieb Malerarbeiten
418 Juwelenauktion Prucha Juwelenauktion Prucha OHG Bewertung
10789
Berlin
Bewertung und Versteigerung von hochwertigem Gold und Brillantschmuck. ... . Oktober fand die erste Juwelenauktion der Firma Theodor Prucha in Berlin statt. Fünf Jahrzehnte
prucha-auktion.de Bewertung Versteigerung Goldschmuck Brillantschmuck
419 Kindertagespflege in Berlin
13353
Berlin
... und dann zu einem Igelchen verbasteln Sonnenschutzkappe zum Basteln Raupen und Schmetterlinge schmücken jedes Fenster
kindergrosstagespflege.de
420 Parkos Online BerlinMailand
12017
Berlin
... Parkos-Online ..-.. Messe "Grüne Woche" Berlin Messegelände - "Golden
parkos.de
421 Vergleich günstige Hausratversicherung finanzen.de Maklerservice GmbH
10997
Berlin
... ist eine sinnvoll. Eine gute Hausratversicherung
hausratversicherungvergleich.de
422 Fischerhosen Tagesdecken
10437
Berlin
Schönes aus aller Welt gibt es im Guru Shop kleiderschrank sideboard esstisch kommode u.v.m. Nehmen Sie sich etwas Zeit um in unserem Onlineangebot zu stöbern. ... - www.Taschen-Shop.org - www.Dekolampen - www.Silber-Schmuck-Shop - www.Ethno-Klamotten
fischerhosen.de Tagesdecken Asien Möbel Kolonialstilmöbel Räucherstäbchen
423 Gold Frames Berlin | Brillenmodell
12165
Berlin
Gold Frames Berlin möchte alle Kunden die sich in der nächsten Zeit in Berlin aufhalten zu einem Besuch in unseren neu eröffneten Brillensalon ein... ... Gold Frames Berlin Unsere Brillenmodelle Making Of Katalog bestellen Home Kontakt Deutsch
goldframesberlin.de Brillenmodell Berlin Einem Unserer Aktuellen
424 Willkommen | Global Project Global Project Partners e.V.
10117
Berlin
... ist ? nubische Körbe Keramiken aus Oberägypten Schmuck aus Assyut Tücher aus dem Sinai. Geschaffen
global-project-partners.de
425 GRENANDER ? RESTAURANT ?
10789
Berlin
... schmücken noch heute bekannte Berliner Plätze. Sein bekanntestes und außergewöhnlichstes Werk
grenander.de
426 Finanzminister | Deutschland finanzminister
13465
Berlin
Finanzminister der Bundesrepublik Deutschland Minister der Finanzen der DDR Reichsminister der Finanzen der Weimarer Republik Reichsminister der Finanzen des Dritten Reiches und Staatssekretäre des ... bis . November Rolf Dahlgrün . Dezember bis . Oktober Kurt Schmücker
finanzminister.de Finanzminister Deutschland
427 Startseite Nagelstudio Berlin Startseite
12489
Berlin
Ihr Nagelstudio u. Airbrush Schulung in Berlin. In gemütlicher Atmosphäre kreiere ich vom classic french bis zum aufwändige NailArt Designs. ... Nailart Airbrush Seminare Nagelstudio Berlin Startseite Galerie Das Studio Seminar Preisliste
nail-galerie.de Startseite Nagelstudio Berlin Airbrush Schulung Nailart
428 ShopUniversum [Home] Ein Service der SHIC GmbH
13347
Berlin
... Freizeit TV Elektronik Tierwelt Uhren Schmuck Herzlich Willkommen auf Shop-Universum Ihrem Internet
shop-universum.de
429 Suchmaschinenoptimierung und Website Optimierung
12526
Berlin
... Suchmaschinenoptimierung . Aktuelle Projekte Hacienda-de-Bougainvilla auf Ibiza Diese Kundenseite sollte auf einem Old
seo-domain-service.de
430 Kindertagespflege in Berlin
13353
Berlin
... und dann zu einem Igelchen verbasteln Sonnenschutzkappe zum Basteln Raupen und Schmetterlinge schmücken jedes Fenster
kindertagesgrosspflege.de
431 Rote Lippen Gottberg/Toussaint GbR Naturkosmetik
10999
Berlin
Fachgeschäft für Naturkosmetik mit kosmetischen Behandlungen nach Dr. Hauschka und M.Gebhardt. ... Naturkosmetik und Behandlungen Oranienstr. Berlin - -
rotelippen-naturkosmetik.de Naturkosmetik Berlin Kreuzberg Dr.Hauschka Lavera
432 Thaikissen Tagesdecken
10437
Berlin
Schönes aus aller Welt gibt es im Guru Shop kleiderschrank sideboard esstisch kommode u.v.m. Nehmen Sie sich etwas Zeit um in unserem Onlineangebot zu stöbern. ... -Shop - www.Möbelknöpfe.org - www.Wandlampen.org - www.Silber-Schmuck-Shop - www.Handstulpen.org
thaikissen.de Tagesdecken Asien Möbel Kolonialstilmöbel Räucherstäbchen
433 Surya Naturkosmetik Heilpraxis Berlin
10439
Berlin
... Willkommen bei Surya Naturkosmetik und Heilpraxis Berlin Surya Naturkosmetik und Heilpraxis Berlin
surya-naturkosmetik.de
434 Stylist24 Onlineshop | Young Seed & Foster GmbH
10969
Berlin
Günstige stylische Damen und Herrenmode trendige Accessoires u.v.m.: ? 100 Tage Rückgaberecht ? Kauf auf Rechnung ? täglich neue Styles Arrivals! ... Jacken Freizeitjacke Blazer Mäntel Westen Alle Jacken Accessoires Hüte Mützen Handschuhe Schmuck
stylist24.de
435 Kindertagespflege in Berlin
13353
Berlin
... und dann zu einem Igelchen verbasteln Sonnenschutzkappe zum Basteln Raupen und Schmetterlinge schmücken jedes Fenster
tagesgrosspflegestelle.de
436 Transportkraft Umzug Eine Eine Unternehmung der ArbeitsgruppeBerlin ITERATIA UG (haftungsbeschränkt)
10551
Berlin
... werden. Ob Musikinstrumente antike Möbel Kunstgegenstände Maschinen hochwertige Geräte oder Schmuck wir haben die ERGO
transportkraft.de
437 Das tun wir für
13465
Berlin
Neues WegweiserPortal zum schnelleren Finden der Shops fuer Spezialitäten aller Art.Hier finden Sie erstmalig alle spezialitaetenshops u.infoseiten geordnet n. Kategorien fuer gourmet u. lifestyle.International regional landestypisch z. b.italienische u. ... Gesundheitstipps Gold Münzen Schmuck Spezialreiseangebote Geschenke Erlebnisgeschenke Sparen Sie dabei
spezialitaeten-portal.de
438 Transportkraft Umzug Eine Eine Unternehmung der ArbeitsgruppeBerlin ITERATIA UG (haftungsbeschränkt)
10551
Berlin
... werden. Ob Musikinstrumente antike Möbel Kunstgegenstände Maschinen hochwertige Geräte oder Schmuck wir haben die ERGO
umzugsnotruf.de
439 Vintage Mode Retro vintage
12435
Berlin
... . Angesagte Mode vergangener Jahrzehnte - aus Berlin. Was du auch suchst - ob originale Vintage-Mode
vintageberlin.de Vintage Mode Kaufen Secondhand Kleidung Secondhand Mode Fashion Retro
440 Wohnideen Shop Historisches
10405
Berlin
Der Wohnideen Shop beinhaltet zahlreiche nostalgische Artikel für die Wohnung das Haus und den Garten. Mit Liebe zum Detail gefertigt verleihen die Möbel und Wohnaccessoires Ihrem ... wie zur Gründerzeit Ladenschilder Schmücken Sie Ihr Haus individuell Briefkästen Nostalgische Briefkästen
wohnideen-shop.de Historisches Renovieren Nostalgie Einrichtung Nostalgie Garten Möbel Eisenfenster
441 Angebotsübersicht Wohnung
14055
Berlin
Wohnung Immobilie Haus Kauf oder Miete die Angebotsübersicht listet alle Objektangebote in einer sortierbaren und filterbaren Übersicht auf. ... Details Herunterladen Vormerken A O E Kauf » Schmucke Singlewohnung Wohnung Kauf Berlin
pappenberg-immobilien.de Wohnung Immobilie Haus Kauf Miete
442 Hochzeitshaus Berlin Hochzeit
10178
Berlin
... HOME Hochzeitshaus Hochzeitspakete Bilder Videos Love Tour Berlin Kontakt BRAUTMODEN
hochzeitshaus-berlin.de
443 Eva Nordal Künstlerin
10117
Berlin
Entwurf eines Heiteren Realismus. Eva Nordal ist einfach ihrem Temperament gefolgt das ein sehr fröhliches und positives ist und so sind ihre Figuren Zeugen einer ... und eleganter Couture sie tragen Schmuck sie sind nicht nur lebensecht bemalt sondern geschminkt
evanordal.de
444 Braez Collection: BAM BERLIN Braez
10787
Berlin
Braez Collection: BAM BERLIN Fashion und Lifestyle aus aller Welt. Exclusive Angebote an Mode und Accessoires für jeden Anlass. ... Sie auch die Faszination unserer Angebote für Schmuck Seifen und Bodyprodukte. Nicht zu vergessen eine kleine
braezandmore.de Braez Collection
445 WILLKOMMEN little cocoon
10437
Berlin
... zu und ich melde mich! Kontakt NEU Die erste Familien- Väter-SpielZeit in Berlin! Hier findest Du Informationen
littlecocoon.de
446 Homepage nais berlin nais berlin UG (haftungsbeschränkt) Wir
10247
Berlin
Wir haben was gegen NichtszumAnziehen und ImmerdasGleiche. ... Onesies Swimwear Accessoires Kategorien Schmuck Mützen Caps Socken Uhren Sonnenbrillen Flaschenöffner
nais-berlin.de Wir Haben Was Gegen NichtszumAnziehen Und ImmerdasGleiche.
447 Goldankauf in Reinickendorf: Goldschmied Goldankauf
13507
Berlin
Goldankauf in Berlin Reinickendorf: Goldankauf Wolf. Ankauf vom Altgold Zahngold Bruchgold Tel: 03089645485 ... an. Dazu gehört Schmuck Altgold Zahngold Bruchgold Münzen und Barren. Die Bezahlung erfolgt bar
goldankauf-reinickendorf.de Goldankauf In BerlinReinickendorf Goldankauf Reinickendorf Altgold Ankauf
448 Goldankauf in Britz: Goldschmied Goldankauf
12359
Berlin
Goldankauf in Berlin Britz: Goldankauf Wolf. Ankauf vom Altgold Zahngold Bruchgold Tel: 03089645485 ... an. Dazu gehört Schmuck Altgold Zahngold Bruchgold Münzen und Barren. Die Bezahlung erfolgt bar
goldankauf-britz.de Goldankauf In BerlinBritz Goldankauf Britz Altgold Ankauf
449 Start Kreativ Tage Deco Concept GmbH Hobbybedarf
14109
Berlin
Kreativ Tage Berlin 23. 25. Oktober 2015. Es erwarten Sie Händler der gesamten Kreativbranche an drei Messetagen mit ihren Produkten und neuesten Trends in der STATION Berlin. ... Sie die Enter-Taste) . Start Besucher Aussteller STATION Berlin DaWanda Kurse Newsletter Kontakt Onlineticket
kreativ-tage.de Hobbybedarf Messe Berlin Basteln Malen Nähen Sticken Stricken Häkeln
450 MySchmuckID Home page Michael Wildenhain & Franziska Rothenberg GbR
13156
Berlin
... PERSONALISIERTE SCHMUCKSTÜCKE Personalisierter Schmuck von mySchmuckID für mehr Sicherheit
myschmuckid.de
451 Ihr Spezialist für Haarverlängerung Haarverlängerung
10623
Berlin
Malaika Hair ist Ihr Spezialist für Haarverlängerung und Extensions in Berlin. Volles Langes und voluminöses Haar. Bei uns sind sie genau richtig. ... Schmuck u.v.m Auf diese Weise können wir Ihnen genau die Frisur zaubern die Sie sich schon immer
malaikahair.de Haarverlängerung Berlin Hair Extensions Berlin Haarverlängerung Haarverdichtung Haarstyling Haa
452 Make a Break | Make a Break Berlin UG (haftungsbeschränkt)
10247
Berlin
Authentisches Room Escape Game in Berlin. Reiße die Berliner Mauer nieder rette Berlin vor Zombies schnappe den Drogenboss! Ein Team ein Raum eine Mission. ... Hauptstadt. Unsere Räumlichkeiten im Szenenbezirk Friedrichshain schmücken Graffitis von Berliner Street Art
make-a-break.de
453 Start | Science Match Verlag Der Tagesspiegel GmbH
10963
Berlin
"Science Match" ist ein neues Veranstaltungsformat das Wissenschaft und Wirtschaft über ihre Zukunftsfragen vernetzt und direkten Austausch in ... ins "Kosmos" nach Berlin-Friedrichshain kamen. mehr Contact Project Management Sebastian Schmücke Phone + (
science-match.tagesspiegel.de
454 Shyrdaks handgemachte kirgisische
12051
Berlin
Hier können Sie alles über die hochwertigen kirgisischen Filzteppiche erfahren diese bestellen oder Ihren individuellen Shyrdak anfertigen lassen. Here you may find all about Shyrdaks the kyrgyz feltrugs. ... Sie sich etwas ganz Besonderes und schmücken Sie Ihre Wohnung mit einem in aufwendiger Handarbeit hergestellten
shyrdak-jurte.de
455 Der löwenstarke Preisvergleich finanzen.de Vermittlungsgesellschaft für Verbraucherverträge AG Preislöwe
10997
Berlin
Preislöwe.de ist ein Preisvergleich für löwenstarkes und zudem sicheres OnlineShopping. Alle angeschlossenen Shops sind geprüft und sicher. ... Arzneimittel Mode Accessoires Foto Camcorder Schmuck Uhren Spiele Konsolen Büro- Schulbedarf Sport
xn--preislwe-s4a.de Preislöwe Preisvergleich Preise Vergleichen Extrem Billig
456 Mefose
10117
Berlin
... die man tragen kann Schmuck . Juni Wertvoll ist das Unikat Früher hat man sich mit Goldschmuck behangen
mefose.de


Bewertung:

Die Öffnungszeiten können zu Feiertagen Pfingsten / Pfingstmontag, Fronleichnam, Tag der Deutschen Einheit, Reformationstag und Allerheiligen abweichen.
Ergebnisse der Bewertung:
142 Bewertungen ergeben 3 StadtBranche Punkte

Neuer Eintrag 

Schmuck ist ein Ziergegenstand oder eine Maßnahme zur Verschönerung. Der Begriff hat eine weitere und eine engere Bedeutung: Schmuck in 15366 Neuenhagen bei Berlin Öffnungszeit und Erfahrungen.
Tipps & Tricks für Arbeit & Leben: