optional Stadt:
Berlin

Schmuck in Berlin Goldwaage Edelmetallhandel › Kreisfreie Stadt Berlin

Schmuck Berlin

Kreisfreie Stadt Berlin
Google Anzeige:
1 SCHMUCKE Galerie-Werkstatt für zeitgenössischen Schmuck und Galerie Schmuck
10625
Berlin
schmucke.net Schmucke Arbeiten Berlin Galerie Werkstatt Künstler Individualität News
2 Halleluja Styles Schmuck
10559
Berlin
Hochwertiger Christlicher Schmuck - Ob für die eigene Hochzeit als Brautschmuck - Finde das perfekte Geschenk für..
halleluja-styles.de Z Y
3 Global Investment - Schließfachvermietung in Berlin Investment
10711
Berlin
Bankschließfach mieten sicher & mit Versicherung Die Zeiten sind nicht mehr so sicher, wie vor vielen Jahren noch...
safes-berlin.de/ Global Investment Sicherheit Schutz Preisliste Berlin Aufbewahrung Geld
4 Avonprodukte Kosmetik Schmuck
10365
Berlin
Ich bin Avonberaterin in Berlin. NEU! Ihr könnt jetzt online bei mir bestellen, mich aber natürlich auch persönlich..
avon.de/store/silke
5 Schmuckankauf Berlin Lichterfelde Juwelier Haeger Juwelier
12207
Berlin
Möchten Sie Ihr Altgold verkaufen? Sind Sie im Besitz von altem Schmuck, Zahngold oder Industriegold? Dann überlegen..
juwelier-haeger.de/berlin Schmuck Gold Geschenke Diamanten Berlin Rolex Modi Vertrauen
6 Schmuckankauf Berlin Juwelier Haeger Juwelier
10711
Berlin
Sie möchten Platinschmuck veräußern? Sie wollen einen Ring verkaufen? Ihr alter Silberschmuck entspricht nicht mehr Ihrem Geschmack?..
juwelier-haeger.de/berlin Schmuck Gold Geschenke Diamanten Berlin Markenschmuck Freundschaftsringe Schmückendes
7 Antiquitäten Schmuck und Altgold Ankauf Berlin Antiquitäten
12207
Berlin
Antique Galerie: Hier können Sie Antiquitäten, Altgold, Schmuck und Diamanten in Berlin Lichterfelde verkaufen. Der Schmuckankauf der..
antiquegalerie.de/standorte/antiquitaeten-berlin-lichterfelde Antiquitäten Kurfürstendamm Berlin Händler Verkauf Ankauf Info@antiquegaleriede Finden
8 Antiquitäten Schmuck und Altgold Ankauf Berlin Antiquitäten
10711
Berlin
Antique Galerie: Hier können Sie Antiquitäten, Altgold, Schmuck und Diamanten in Berlin am Kurfürstendamm verkaufen. Der Schmuckankauf..
antiquegalerie.de/standorte/antiquitaeten-berlin Z Y
Google Anzeige:

Kostenlos: 42 Tipps & Tricks für Arbeitswelt & Leben:
Erhalten Sie Ihr Buch "Tipps und Tricks für Arbeitswelt und Leben"
kostenlos per E-Mail als .pdf Datei:

9 Goldankauf Berlin Goldankauf Haeger GmbH Goldankauf
10711
Berlin
Der Goldankauf in Berlin: In vielen Haushalten schlummern Werte, die ihren Besitzern gar nicht bekannt sind. Möglich..
goldankauf-haeger.de/berlin Berlin Ankauf Goldmünzen Goldankauf Kaufen Verkaufen Anfahrt Goldbarren
10 Mode Onlineshop für Damen Herren und Textilien Onlineshop
13595
Berlin
Sie suchen Mode die nicht teuer ist? Dann freuen wir uns, Ihnen unsere Artikel zu präsentieren.Wir führen..
easy-klamotten.de Dessous Anmelden Set Warenkorb Eur Schmuck Schuhe Weihnachtsmütze
11 ute köhnen schmuck - galerie und Goldschmiede
10115
Berlin
Goldschmiede, Werkstatt für Anfertigungen, Umarbeitungen und Reparaturen von Schmuck. Alle Edelmetalle und Edelsteine. Die Galerie zeigt Arbeiten von..
ute-koehnen.de Schmuck Galerie Werkstatt Berlin Khnen Köhnen Ute Silber
12 ULRIKE POELK SCHMUCK ulrike
10999
Berlin
Ulrike Poelk | Schmuck | Produkt
ulrikepoelk.de Ulrike Poelk Schmuck

Kostenloses Buch Tipps & Tricks für Arbeitswelt & Leben:
Erhalten Sie Ihr Buch "Tipps und Tricks für Arbeitswelt und Leben"
kostenlos per E-Mail als .pdf Datei:


13 Laurea Schmuck Laurea
13353
Berlin
Laurea Schmuck bietet edelsten Schmuck moderne Trauringe und Luxusuhren bzw. Markenuhren.
laurea-schmuck.de Laurea Schmuck Altgold Berlin
14 Moutell: Marion Moutell Malerei Marion
10777
Berlin
Malerei und Schmuck
marion-moutell.de Marion Moutell Moutell
15 Göttlicher Schmuck Startseite Juwelier
16321
Bernau bei Berlin
Göttlicher Schmuck Inh. Eliane Göttlich Jedes Stück ein Unikat Handgefertigte Schmuckstücke aus NespressoKapseln
goettlicher-schmuck.de Juwelier Schmuckhändler Unikate
16 Perlengöttin Perlenketten und Perlengöttin
14165
Berlin
Perlenketten und Schmuck. Kreatives arbeiten und Workshops.
perlengoettin.de Perlengöttin Perlen Schmuck
17 Salome Schmuck Modeschmuck Schmuck
10629
Berlin
Edlen Schmuck in einzigartigen Designs online kaufen bei Salome Schmuck ? ? ? ? ?
salome-schmuck.de Schmuck Modeschmuck Online
18 Designeruhr.de Informationen rund MSP Concept GmbH & Co. KG uhren
10719
Berlin
Informationen rund um uhren armbanduhren wanduhren schmuck
designeruhr.de Uhren Armbanduhren Wanduhren Schmuck
19 Digitaluhr.de Informationen rund MSP Concept GmbH & Co. KG uhren
10719
Berlin
Informationen rund um uhren armbanduhren wanduhren schmuck
digitaluhr.de Uhren Armbanduhren Wanduhren Schmuck
20 Www.rosenvogel.de *** Schmuck Schmuckdesign
13187
Berlin
Rosenvogel Schmuck und Accessoires. ...Kleinserien Einzelstücke und Auftragsarbeiten
rosenvogel.de Schmuckdesign Schmuck Accessoire
21 StarBijou Uhren und Schmuck schmuck
10625
Berlin
Trollbeads Schmuck Daniel Wellington Uhren GÜNSTIG ? SICHER kaufen ? Gratis Versand in DE
star-bijou.de Schmuck Uhren Armband
22 Uhren Schmuck uhren
12489
Berlin
'Seit 1996 besteht das Geschäft Uhren und Schmuck von Birgitt Schimmelpfennig in Berlin Adlershof. Mit
birgitt-schimmelpfennig.de Uhren Reparatur Berlin Schmuck
23 Schmuckhaendler.de Informationen rund MSP Concept GmbH & Co. KG Schmuck
10719
Berlin
Informationen rund um Schmuck ringe uhren ketten ohrringe
schmuckhaendler.de Schmuck Ringe Uhren Ketten Ohrringe
24 Grandma's Paradise Schmuck Grandma´s
10717
Berlin
Grandma's Paradise Schmuck aus Briefmarken. SchmuckStücke zum Anfassen Probieren und Kaufen. SchmuckStücke aus
grandmas-paradise.de Grandma´s Paradise Grandmasparadise Schmuck Schmuck
25 SchmuckFun Ihr online SchmuckFun
12353
Berlin
Schmuck Fun steht im Angebot für Silberschmuck Ohrringe und Ohrstecker. Goldschmuck Ringe und Anhänger
schmuck-fun.de SchmuckFun Schmuck Goldschmuck
26 Bettelarmband Online Shop – Schmuck
12357
Berlin
Bettelarmband Schmuck Online Shop für Charms Schmuck. Bettelarmbänder und BettelarmbandAnhänger bzw. Charms Anhänger aus
bettelarmband-schmuck.de Schmuck Schmuck Shop
27 Chamilia Armband Schmuck zum Chamilia
10623
Berlin
Alles über Chamilia Armband und Armbänder Chamilia Charms und Shops wo man den Schmuck
armband-chamilia.de Chamilia Schmuck Armband
28 Goldschmiede Stratmann GmbH Schmuck
13465
Berlin
Goldschmiede Stratmann GmbH Ihr Goldschmied für Schmuck und Edelsteine aller Art Goldschmiede Berlin
stratmanngold.de Schmuck Uhren Schmuck Handel Schmuck
29 CorAArt Skulpturen und MammutElfenbein
13156
Berlin
Skulpturen und UnikatSchmuck aus Naturmaterialien (MammutElfenbein Knochen Geweih und Taguanuss) sowie Restauration von
cora-art.de MammutElfenbein Skulpturen Schmuck
30 Schmuckmanufaktur Berlin Goldschmiedin Schmuckmanufaktur
10781
Berlin
Schmuckmanufaktur Berlin Goldschmiedin Schmuck Trendart
schmuckmanufaktur-berlin.de Schmuckmanufaktur Berlin Goldschmiedin
31 Domain juweliereberlin.de steht zum Impressum Harold Dienstleistungs GmbH Juwelier
10115
Berlin
Juwelier Juweliere Gold Silber Schmuck Uhren Diamanten Trauringe Berlin
juweliere-berlin.de Juwelier Juweliere Gold Silber Schmuck
32 Goldankauf Schmuck Profi Kostenlose
12107
Berlin
Gold Bruchgold Goldschmuck Zahngold Silber Platin Schmuck Luxusuhren
schmuck-profi.de Kostenlose Bewertung Ankauf
33 SCHMUCK UND KUNST SCHERK Berlin
12207
Berlin
In meiner GoldschmiedeWerkstatt in Berlin stelle ich UnikatSchmuck aus edlen Materialien her der von
gabriele-scherk.de Berlin Schmuck Ring
34 1. KFZ Pfandleihhaus Berlin Inh. AAAA. & M. Schadow OHG KFZ
12247
Berlin
1. KFZ Pfandleihhaus in Berlin für Autos Motorräder. Leihhaus für Schmuck Wertsachen
1-kfz-pfandleihhaus.de KFZ Leihhaus Pfandkredit
35 Schatzprofi Ankauf u. schatzprofi
12105
Berlin
Wir kaufen Ihre alten Pelze Altgold Schmuck Diamanten Münzen Tafelsilber
schatzprofi.de Schatzprofi Schatz Profi Ankauf Bewertung
36 PREMIUM UPCYLING ? exklusive nobrands GmbH nobrands
13403
Berlin
Grösster deutschsprachiger Einkaufshelfer rund um Nachhaltigkeit und Originalität: Mode Taschen Schuhe Schmuck
nobrands.de Nobrands Brands Ratgeber
37 Dunkelwelt Gothicshop Gothic Gothic
10247
Berlin
Dunkelwelt Gothicshop Laden und Onlineshop für Gothic Kleidung Accessoires und Schmuck von Queen
dunkelwelt-laden.de Gothic Kleidung Schmuck Acessoires Onlineshop
38 Sentiment Schmuck Home unikatschmuck
10245
Berlin
Wie man sich schmückt so fühlt man denn Schmuck ist vor allem Gefühlssache.
sentiment-schmuck.de Unikatschmuck
39 :: SILBERSTEIN :: Schmuck Silber
10435
Berlin
Schmuck + Kunst für kreative Leute. Edelsteine Natursteine Perlen Silber und Gold
silberstein-berlin.de Silber Gold Steine
40 Willkommen bei der Goldschmiedin Schmuck
10629
Berlin
Unikate Schmuck Objekte von Gisela SeibertPhilippen Berlin
seibertphilippen.de Schmuck Goldschmuck Ringe
41 Schmuck zu günstigen Preisen artvera GmbH & Co. KG
10627
Berlin
Jacolia.de: OnlineSchmuckshop für Damen versandkostenfrei und einfach Schmuck aus aller Welt bestellen. 60 Tage
jacolia.de
42 Perlenfarm Berlin Schmuck Perlen
10707
Berlin
Perlen Schmuck individuelle Beratung Service Nähe Ku'damm Berlin [10707 Berlin]
perlenfarm-berlin.de Perlen Schmuck Service
43 Motorclothes Berlin GmbH | Motorclothes Berlin GmbH berlin
10719
Berlin
Im Onlineshop der Motorclothes Berlin GmbH finden Sie Motorradbekleidung Kleidung Schmuck Uhren
motorclothes-berlin.de Berlin Mode Fashion
44 Schmuckschmiede Berlin Völker Goldschmiede
10625
Berlin
Die Schmuckschmiede Völker ist eine Goldschmiede und fertigt individuellen DesignerSchmuck in Berlin
schmuckschmiede-berlin.de Goldschmiede Designerschmuck Schmuck
45 SCUDERI · Schmuck Ringe Schmuck
10405
Berlin
Die Schmuckwerkstatt SCUDERI liegt im Herzen des Prenzlauer Berg. Die Schmuckdesignerinnen Bettina Siegmund und Daniela
scuderi-schmuck.de Schmuck Scuderi Berlin
46 SCENARIO GmbH Berlin SCENARIO Bobert und Schindler GmbH Accessoires
10623
Berlin
SCENARIO GmbH Berlin Accessoires Schmuck Geschenke Papeterie Ausgewählte Postkarten
scenario-gmbh.de Accessoires Schmuck Uhren
47 Blackyard Schmuck aus Doris Christ & Manfred Lübbas GbR
13585
Berlin
blackyard stellt HerrenSchmuck aus Leder Edelstahl und Silber her. Zu den Produkten gehören Lederanrbänder
black-yard.de
48 Opalschmuck Onlineshop für Schmuck Opalschmuck
12526
Berlin
Opalschmuck Onlineshop bietet wunderschöne Schmuckstücke Ringe Ohrringe Kettenanhänger mit exklusiven Opalen
opalschmuck.de Opalschmuck Online Kaufen Opal
49 LasportsTattoo Startseite Tättowierer
13349
Berlin
lasportsTattoo aus Berlin findet mit Ihnen das ideale Tattoo für Sie und bringt es
lasports-tattoo.de Tättowierer Tätowierungen Tattoo
50 Schmuck Uhren online VALMANO GmbH
10999
Berlin
Garantierte Lieferung bis Weihnachten bei Bestellung mit DHL Express bis zum 23.12.2014 um 12 Uhr!
valmano.de
51 Goldschmiede HELGA RITSCHER & ALEXANDER SANDMEIER OHG Goldschmiede
14165
Berlin
Helga Ritscher Alexander Sandmeier Historischer Schmuck von der Antike bis zum 21.Jh.
ritscher-sandmeier.de Goldschmiede Kunsthandel Historischer
52 Gold Shaker Ankauf ImmoCom 2001 GmbH Goldankauf
12309
Berlin
Goldshaker kauft Ihr Gold Ihren Schmuck Ihre Uhren Ihre Antiquitäten Ihre
112gold.de Goldankauf Schmuckankauf Uhrenankauf
53 SchmuckPalast Inhaber: Thomas Schmuck
10318
Berlin
Wir bieten Ihnen eine sorgfältige Auswahl einzigartiger Schmuckstücke zu unschlagbar günstigen Preisen wie beim
galerie-stolt.de Schmuck Diamant Brillant
54 Uhren und Schmuck |
14169
Berlin
Uhren Schmuck und Service ? von Gravur bis Reparatur in Berlin SteglitzZehlendorf gibt es
uhren-weniger.de
55 BellaCarina Grosshandel Silberschmuck Silberschmuck
13585
Berlin
Großhandel für Silberschmuck Silberketten Esoterik Shiva Auge Kristall Schmuck
bella-carina-grosshandel.de Silberschmuck Schmuck Silberketten Esoterik Shiva
56 Trollbeads und Lapponia Schmuck
13507
Berlin - Tegel
Trollbeads und Lapponia sowie TeNo Schmuck finden Sie hier günstig und versandkostenfrei im Onlineshop
trollbeads-laden.de
57 Center Juwelen Juwelier Juwelier
12559
Berlin
Juwelier Berlin und Goldankauf Berlin | Juwelier in Berlin Köpenick: Uhren Schmuck Trauringe
juwelier-in-berlin.de Juwelier Berlin Goldankauf Berlin
58 KlickSuche Webverzeichnis
13349
Berlin
Das Webverzeichnis zum suchen finden und gefunden werden!
klick-suche.de Webverzeichnis Linkverzeichnis Webkatalog
59 Personal Shopping Schwellenwerk Personal
13349
Berlin
Personal Shopping Schrankcheck Stilberatung Mit Katja Lebrecht findest du Spaß am eigenen
schwellenwerk.de Personal Shopping Mode
60 Vanheit handgearbeiteter Schmuck
10997
Berlin
Handgearbeiteter Schmuck und Objekte aus Glas
vanheit.de
61 Günstig Mode Schmuck Lesara GmbH
10435
Berlin
Damenmode Kinder Herrenbekleidung Schuhe Schmuck Sport Wohnen Lifestyle
lesara.de
62 Juwelier Bernd Reiher Berlin Juwlier
13051
Berlin
Website des Juweliers Bernd Reiher aus Berlin. Trauringe Uhren Schmuck Goldankauf und
juwelier-reiher.de Juwlier Hochzeitsringe Trauringe
63 Aktuelles Keywords
10243
BERLIN
Schmuck FROLLEIN ELSTER
frollein-elster.de Keywords Schmuck Modeschmuck Geschenke
64 Raspe SchmuckDesign Raspe/Wäcke Schmuckdesign GbR Raspe
10823
Berlin
Seit 1987 fertigt Christa Raspe Modeschmuckkollektionen in eigener Herstellung an. Alle Kollektionen entstehen in handgearbeiteten
raspe-schmuck-swarovski.de Raspe SchmuckDesign SchmuckDesign
65 Diesodas dein Fohmarkt Flohmarkt
13347
Berlin
Der Flohmarkt für Berlin u Umgebung das kostenlose AnzeigenPortal zahlreiche neue Anzeigen warten auf
dies-o-das.de Flohmarkt Neu. Und Gebrauchtwaren Kleinanzeigen
66 100.000 Jobs und Stellenangebote c/o Konzack und Konzack GbR
13347
Berlin
? Hier finden Sie erfolgreich passende Jobs in einer Jobsuche aus ? 100.000 Stellenangeboten ?
deutschlandstellen24.de
67 Antiquitäten am Breslauer Platz Antik
12105
Berlin
Bei uns finden Sie antike Möbel Weichholzmöbel Schränke Tische Stühle
antikmoebel-wollmann.de Antik Antik Antike Antiker Antiquitäten
68 Startseite HOTANI ImportGrosshandel Hotani
13403
Berlin
Hotani ImportGroßhandel Ihr Importeur aus Berlin für Räucherware Tücher Schmuck Speckstein
hotani.de Hotani ImportGroßhandel Hotani ImportGrosshandel
69 Trauringe Berlin Ohrringe Anhänger trauringe
10435
Berlin
Trauringe Ohrringe Manschettenknöpfe Edelsteine Altgoldankauf Goldschmiede Berlin Prenzlauer Berg
heidenreich-schmuck.de Trauringe Berlin Verlobungsringe Goldankauf Goldankaufberlin
70 Markenprodukte zu günstigen Preisen createyourtemplate GmbH & Co. KG Schmuck
10247
Berlin
Preiswert24 ? Uhren Schmuck und Accessoires günstig kaufen ? schneller kostenloser Versand innerhalb
preiswert24.de Schmuck Uhren Uhr
71 Orakelfreunde Shop und Erlebnisseite: Schmuck
10559
Berlin
Bei Orakelfreunde.de kann man Tarotkartenlegen und magische Produkte bestellen: Amulette Talismane Rituale
orakelfreunde.de Schmuck Orakelkarten Liebesamulett Zauberbeutel Talisman
72 Home Juwelier Amber Goldankauf
12163
Berlin Steglitz
Goldankauf Juwelier Amber Berlin. Ihr Berliner Juwelier Fachgeschäft mit über 35 Jahren Erfahrung in
amber-juwelier.de Goldankauf Amber Juwelier
73 Kamya Kamya GmbH
10435
Berlin
Schmuck aus Berlin
kamya-design.de
74 Home Schmuck
10317
Berlin
Handgefertigter Schmuck aus Gold Silber Edelholz Kokosnuss. Auf Wunsch kompatibel zu Charlotte. Unikatschmuck
yvonneschmuck.de Schmuck Ringe Armschmuck
75 Papierschmuck Kibuku.de Papier
10961
Berlin
Schmuck aus PapierhandgemachtWillkommen im KibukuShop
kibuku.de Papier Kunstschmuck Handgemacht Japanpapier Ausgefallener
76 Liya Love you Nazar Berlin UG (haftungsbeschränkt) LIYA
14050
Berlin
Inspirierender Schmuck individuell und handgefertigt
liya-love.de LIYA Love Liya Love
77 BoA Beauty Of Afrika
12045
Berlin
Alles zum Thema Afrika Westafrika afrikanische Kunst Antiquitäten Handwerk Schmuck
beautyofafrica.de Afrika Interieur Dekoration
78 Gerxx GmbH Gerxx GmbH chmuck
10247
Berlin
Schmuck selber online günstig kaufen
gerxx.de Chmuck Selber Online Günstig Kaufen
79 Silke spitzer silkespitzers
10969
Berlin
zeitgenössischer Schmuck Schmuck Holz Bündelringe
silkespitzer.de
80 ARTBOXES ARTBOXES
10999
Berlin
ARTBOXES bietet Luxus für Individualistinnen Individualisten. Mobile Galerien. Themen Schmuck. Ketten der besonderen Art.
artboxes.de ARTBOXES Luxus Boxen
81 Goldankauf Juwelier Amber Berlin Goldankauf
12163
Berlin
Goldankauf Juwelier Amber Berlin. Ihr Fachgeschäft mit über 35 Jahren Erfahrung in der Juweliers
ambercollection.de Goldankauf Amber Juwelier
82 David Aubrey Schmuck | David
10115
Berlin
David Aubrey.de Offizieller Onlineshop der Marke David Aubrey für Deutschland Österreich und Schweiz.
david-aubrey.de David Aubrey Schmuck Halsketten Ketten
83 Daniela Halm individuelle Schmuck
10559
Berlin
Schmuck von Daniela Halm Ketten Armbänder Ohrringe Engel Arbeiten mit
individuelle-kunst.de Schmuck Schmuck Ketten
84 Grebe Schmuck Trauringe Trauringe
10969
Berlin
Trauringe á la Carte individuelle Trauringe und Verlobungsringe nach Ihren Wünschen sind typisch für die
grebe-schmuck.de Trauringe Berlin Trauringe In
85 Start Henry Fuchs henry
12487
Berlin
Henry Fuchs Uhrmachermeister
henry-fuchs.de Henry Fuchs Uhren
86 Edler Antikschmuck www.antikschmuckkaufen.de Antikschmuck
10585
Berlin
Antikschmuck Ringe Broschen Ketten Ohrringe Jugendstil Biedermeier ArtDeco
antik-schmuck-berlin.de Antikschmuck Ringe Broschen
87 Home ? Goldschmiede Schmuckbotschaften
10781
Berlin
Goldschmiede Schmuckbotschaften aus Berlin entwirft individuellen Schmuck!
schmuck-gewecke.de
88 Elmira Berlin Elmira
10245
Berlin
Elmira Berlin ist Shop für Handgefertigten Schmuck.
elmira-berlin.de Elmira Berlin Anstecker
89 Amely Spaeth Goldschmiedemeisterin Berlin Julia Ziehn & Amely Späth GbR schmuck
10245
Berlin
Amely Spaeth Goldschmiedemeisterin aus Berlin Goldschmiede Berlin Trauringe Unikate Schmuck
amelyspaeth.de Schmuck Goldschmiede Trauringe Eheringe Verlobungsringe
90 Kristallwerk.de Schmuck aus swarovski
12555
Berlin
Kristallwerk ist ein Onlineshop für Schmucksachen aller Art
kristallwerk.de Swarovski Elements Ketten Mit
91 TIME STORE Lifestyle uhr
12619
Berlin
Time Store aus Berlin Uhren und namhafte Marken
timestore-berlin.de Uhr Armband Zeiger
92 Schadow Automobile Berlin Autos Inh. AAAA. & M. Schadow OHG KFZ
12247
Berlin
1. KFZ Pfandleihhaus in Berlin für Autos Motorräder. Leihhaus für Schmuck Wertsachen
schadow-automobile.de KFZ Leihhaus Pfandkredit
93 Juwelier Ersay Herzlich JuwelierErsay
10789
Berlin
Mit Ihrem Juwelier Ersay in Berlin und Leipzig haben Sie einen leidenschaftlichen Juwelier und Partner
juwelier-ersay.de JuwelierErsay Schmuck Leipzig
94 Schmuck Berlin | simplyu keyword1
14089
Berlin
website description
schmuckberlin.de Keyword1 Keywords2
95 TrendMafia Der Designermarkt Trendmafia
10247
Berlin
Aufstrebende Designer Modeschöpfer und Grafiker laden ein um ihre selbst entworfenen und selbst
trendmafia.de Trendmafia Designermarkt Designmarkt
96 Diehansens Torsten
12526
Berlin
Torsten Hansen Autismus Malerei Fotografie Orchideen Kakteen winterharte
diehansens.de Torsten Hansen Autismus
97 Bandow24 der WebJuwelier Uhr
13405
Berlin
Entdecken Sie die neue ShoppingDimension der Goldschmiede Bandow. Entdecken Sie Bandow24! Der WebGoldschmied/Juwelier der Superlative
bandow24.de Uhr Uhren Elysee
98 Home atelierberlin Swarowski
14167
Berlin
Willkommen bei atelierberlin Jeder ist kreativ genug um seinen individuellen Schmuck herzustellen.Hier finden sie jap.Miyukis
atelierberlin.de Swarowski Kristalle Rivolis Doppelkegel
99 ? Designerschmuck und Accessoires melovely GmbH & Co. KG Schmuck
13086
Berlin
melovely.de vereint außergewöhnlichen Designerschmuck wie Ketten Ringe Armschmuck sowie Taschen und
melovely.de Schmuck Damenschmuck Herrenschmuck
100 Bazaar Berlin Startseite Messe Berlin GmbH Bazaar
14055
Berlin
Der Bazaar Berlin ehemals Import Shop Berlin ist eine internationale Verkaufsausstellung für exotische Geschenke
bazaar-berlin.de Bazaar Berlin Import Shop
101 Www.schmuckmanufakturkoenigsblau.de
10715
Berlin
Onlineshop für Polarisschmuck Polarisketten Polarisarmbänder und kreativen Modeschmuck. Veranstaltung von kreativen Kindernachmittagen in
schmuckmanufaktur-koenigsblau.de
102 Goldankauf Berlin Pfandleihhaus Daniel Leihhaus Berlin GmbH goldankauf
10627
Berlin
Wir kaufen Ihr Gold Silber Edelsteine Münzen Schmuck Zahngold
gold-berlin.de Goldankauf Berlin Pfandleihhaus Berlin
103 SupaRina: Home schmuck
10247
Berlin
SupaRina bietet Euch WitzigSkurilSchmückendes für Ohr und Hals. Von Kitsch über Gothic bis hin zu
suparina.de Schmuck Berlin Ohrringe Ketten Ringe
104 Www.dasbernsteinzimmer.de Herzlich willkommen! opal
10407
Berlin
Finden Sie schönenSchmuck Opal Larimar Achat Smaragd Saphir Rubin Koralle Ring Ringe Silberringe Steinschmuck
baltic-amber.de Opal Larimar Achat
105 Monika Glöss Design Monika
10999
Berlin
Homepage von Monika Glöss
monika-gloess.de Monika Glöss Schmuck
106 LeChatVIVI BERLIN Design Armbänder Schmucklabel
12157
Berlin
LeChatVIVI BERLIN Schmuck aus Berlin. LeChatVIVI BERLIN steht für individuell hergestellte Armbänder und Ketten
lechatvivi.de Schmucklabel Design Berlin
107 Außergewöhnliche Geschenkideen und personalisierte
10117
Berlin
Finden Sie ausgefallene Geschenkideen und personalisierte Geschenke sowie Inspiration für alle schönen Dinge wie
notonthehighstreet.de
108 LeChatVIVI BERLIN Design Armbänder Schmucklabel
12157
Berlin
LeChatVIVI BERLIN Schmuck aus Berlin. LeChatVIVI BERLIN steht für individuell hergestellte Armbänder und Ketten
vivianekoch.de Schmucklabel Design Berlin
109 Home uhren
10961
Berlin
Juweliere Uhrmacher
argento-berlin.de Uhren Schmuck Juwelier
110 KIRKARA: Atelier Atelier
12053
Berlin
AtelierAtelier KirKara Berlin Galerie Kirsten Karacan
kirkara.de Atelier Kirkara Berlin
111 WHAT´s NEW LeChatVIVI Schmucklabel
12157
Berlin
LeChatVIVI BERLIN® Armbänder und Schmuck für Frauen und Männer Bekannt aus Presse und Fernsehen
lechatvivi-berlin.de Schmucklabel LeChatVIVI Berlin
112 Unikate Einzelstücke und Schmuck
12163
Berlin
Modeschmuck Unikate Einzelstücke und mehr gibt es hier ! Zertifiziert kostenfreie Lieferung
mein-schmuckzauber.de Schmuck Online Günstig Modeschmuck Online
113 Goldankauf Berlin und Brandenburg Goldankauf
12163
Berlin
Sie wollen Ihr Gold in Berlin und Brandenburg verkaufen wir bieten eine faire Partnerschaft.
berlin-altgoldankauf.de Goldankauf Berlin Gold Verkauf
114 Uhren günstig kaufen bei
10829
Berlin
Chronographen Uhren für Damen Uhren für Herren sowie Vielzahl an Markenuhren und Schmuck
watchhouse.de
115 Center Juwelen Juwelier Juwelier
12524
Berlin
Center Juwelen in der TautPassage Berlin TreptowKöpenick. Center Juwelier seit 1999.
centerjuwelen.de Juwelier Treptow Köpenick
116 Juwelier Barok ist Ihr Juwelier
12163
Berlin
Mitten im Boulevard Berlin finden Sie Ihr für Goldschmuck und Uhren Juwelier Barok. Wir
juweliersteglitz.de Juwelier Barok Juwelier Steglitz
117 Trauringe anders individuelle trauringe
10437
Berlin
trauringe anders bietet außergewöhnliche Trauringe schlicht einfach und dennoch anders! Gestaltet von DiplomDesignern
trauringe-anders.de Trauringe Anders Außergewöhnliche Trauringe
118 Hochzeit Luxus Geschenk 9p strategy GmbH Hochzeit
10629
Berlin
Hochzeitsgeschenk das GLAMLOC Liebesschloss ist ein LuxusGeschenk zur Hochzeit
hochzeit-geschenk-glamloc.de Hochzeit Geschenk Liebesschloss Schmuck LiebesschlossBrücke
119 Leihhaus Goebel Pfandkfredit Barkredit Berlin
13353
Berlin
Das Pfandhaus Goebel wurde 1900 gegründet. Zwei mal in Berlin Wedding und Moabit.Das Leihhaus
pfandhaus-moabit.de Berlin Leihhaus Pfandhaus Mitte Wedding
120 Designermode accessoires | fischer mode berlin GmbH Fischer
10435
Berlin
fischer mode bietet Ihnen tragbare und ausgefalle Designermode und passende Accessoires von Schal über
fischer-mode.de Fischer Mode Berlin
121 Manufakturgalerie Manufakturgalerie
10178
Berlin
Die Manufakturgalerie
manufakturgalerie.de Manufakturgalerie Meissener Porzellan
122 O3BERLIN Shopping
10435
Berlin
Unique Berlin Shop. More than 100 Designers on 100 sqm. Fashion jewelry and accessories
o3-berlin.de Shopping Berlin Clothing
123 PrincessMari Märchenhaftes Design PrincessMari
12557
Berlin
Entdecken Sie die wundervollen Designs von PrincessMari.
princessmari.de PrincessMari Berlin Modeschmuck
124 Point for Wellness Bücher
12347
Berlin
Point for Wellness Ihr geprüfter Online Shop von Rakuten ? Trusted Shop zertifiziert
pointforwellness.de Bücher CDs DVDs
125 Markemaja foto
10967
berlin
markemaja fotografie fotodesign visuelle gestaltung
markemaja.de Foto Photo Fotografie
126 Juwelier EuroGoldBerlin Trauringe
12051
Berlin
Markenuhren Schmuck Trauringe Freundschaftsringe und Kinderschmuck zu Toppreisen online und im Ladengeschäft.
euro-gold-berlin.de Trauringe Berlin Eheringe Berlin
127 Start vonberlin Schmuck
10437
Berlin
Marion Heilig Joachim Dombrowski Friederike Maltz Angewandte Kunst und modern crafts
von-berlin.de
128 ANMUTH Grafikdesign und Konzeption Grafik
10318
Berlin
Anmuth Grafikdesign und Konzeption Antje Würdemann Berlin. Gestaltung von individuellen Kommunikationslösungen in
anmuth.de Grafik Grafik Berlin
129 MOne Fashion Berlin Accessoires
10623
Berlin
Damenbekleidung Damenschuhe Accessoires Taschen Schmuck
m-one-fashion.de Accessoires Armbänder Bermuda
130 Gold Piercing Shop  Gold Piercing Goldpiercings
13051
Berlin
In der Kategorie Echt Gold Piercing kannst Du die verschiedensten Piercings aus GelbGold und WeissGold
gold-piercing-shop.de Goldpiercings Echt Gold Piercing
131 Beste Deals für Luxus
12099
Berlin
luxus premium günstig schnäppechen treffer uhren luxusware männer hugo boss beste qualität discount angebote reduziert
homeofdeals.de
132 Silberankauf zu besten Preisen Kostenlose
12107
Berlin
Wir kaufen an: Silberschmuck Silberbestecke Tafelsilber Silbermünzen Industriesilber medizinisches Silber.
abc-silber.de Kostenlose Bewertung Ankauf
133 TITANEN PIERCINGATELIER BERLIN ULLRICH & JENNE GbR piercing
10777
BERLIN
PURE BODY PIERCING. Zu unserem Angebot gehören alle erdenklichen Arten von Piercings: ob klassisches Intimpiercing
titanen-piercing.de Piercing Berlin Studio
134 Darkstore Gothicshop der Darkstore
10245
Berlin
Der Gothic Online Shop aus Berlin. Klamotten Schuhe Schmuck Taschen Gürtel
darkstore.de Darkstore Gothic Onlineshop Berlin Kontaktlinsen
135 World's Luxury Guide | Magazin
10888
Berlin
Der World's Luxury Guide ist der Luxusund Lifestyle Guide von Welt Online und die zentrale
dieweltbesten.de Magazin Travel Essen
136 EsoterikWellnessshop Keltischer Schmuck Buddha esoterikwellnesss
12203
Berlin
In unserem Esoterik Wellness Wellnessshop bieten wir Produkte an wie Naturkosmetik Goldkosmetik von ChiEnterprise Primavera
esoterik-wellnessshop.de Esoterikwellnessshop Esoterik Esoterikshop Wellness Wellnessshop
137 WallStreetGallery ein Ort Peter
10969
Berlin
Die WallStreetGallery ist ein Ort des Wandelns und Verwandelns also eine BildhauerGalerie und spannt
wall-street-gallery.de Peter Unsicker Claudia Croon WallStreetGallery
138 Brautschuhe und Brautmode große Brautschuhe
13409
Berlin
Brautschuhe und Brautaccessoires sowie über 200 BrautschuhModelle zur Auswahl. Besuchen Sie uns in unserem Geschäft
brautmoden-direkt.de Brautschuhe Berlin Brautmode
139 Markenschmuck | meineschmuckzeit.de Ihr NOMINATION
12351
Berlin
meineschmuckzeit.de Ihr Spezialist für Marken und Sammelschmuck. Aktuelle Kollektionen von Nomination Trollbeads
meineschmuckzeit.de NOMINATION FESTINA BREUNING
140 Kikila Zauberhaftes für Wohnen
12209
Berlin
Ausgefallen Schönes für Mutter und Kind: liebevoll gestaltete Möbel Geschirr Spielzeug Textilien
kikila.de Wohnen Tisch Küche Baby
141 Ihr Piercingstudio und Tattoostudio Tattoo
13051
Berlin
Ihr erfahrener Piercer und Tätowierer in Berlin. Sie wollen ein neues Tattoo oder Piercing?
bossi-berlin.de Tattoo Tatoo Tato
142 TöppelDesign Edelstahlschmuck und Schmuck
12587
Berlin
Töppel Design Edelstahlschmuck Titanschmuck der besonderen Art
clock-store.de Schmuck Berlin Goldankauf Berlin
143 Startseite: Alles von AZ Amazon
13589
Berlin
Finden Sie hier alles von A(nzüge) bis Z(eitschriften). STORE10.DE Genau mein Ding!
store10.de Amazon Footactive Auto
144 Startseite Perlen
10119
Berlin
Perlenschmuck Ketten Armbänder Halsbänder Ringe alles in Handarbeit gefertigte Einzelstücke
nutsandpearls.de Perlen Schmuck Ketten
145 Morseketten individuelle Perlenketten Morsecode
10247
Berlin
Gestalten Sie Ihre individuellen MorsecodeKetten mit verschlüsselter Botschaft. Handgefertigte KeramikPerlen jede Kette ein Unikat!
morseketten.de Morsecode Kette Schmuck
146 Leihhaus BB / Pfandhaus Pfandhaus
12099
Berlin
Pfandhaus Berlin Leihaus Tempelhof Berlin Geld gegen Pfand Bargeld ohne Schufaauskunft und ohne Gehaltsabrechnung in
bb-leihhaus.de Pfandhaus Leihaus Tempelhof Leihhäuser
147 Ankauf Berlin Technik PC
10243
Berlin
Technischer An Verkauf (SecondHand) in Berlin Ankauf Ankauf Berlin Handys
anundverkauf-berlin.de PC PC System
148 Startseite | Bohm und Bohm und Bohm GmbH Packseiden
13403
Berlin
Bohm und Bohm GmbH Antonienstraße 57 13403 Berlin Großhandel für Tragetaschen Flachbeutel und Bodenbeutel
bohmundbohm.de Packseiden Papiertaschen Schmucketuis
149 Agentur Beverly Berlin
12047
Berlin
Beverly Berlin außergewöhnlicher Schmuck von N2 Les Nereides Rock around my neck Schiepek
beverly-berlin.de
150 Woodvisions Edle Füllfederhalter schreibgeräte
10367
Berlin
Edle Geschenke aus edlen Hölzern. Hier finden Sie Unikate aus feinsten Maserhölzern. Schreibgeräte Schalen
woodvisions.de Schreibgeräte Füller Füllfederhalter Kugelschreiber
151 Agentur DE BOER PR SOPHIE
10119
Berlin
Seit mehr als 15 Jahren ist die Agenturinhaberin Vanessa de Boer in den Bereichen PR/Management/Vertrieb
agentur-deboer.de SOPHIE By SOPHIE Ist Ein
152 Island Tribe Berlin
10437
Berlin
Willkommen bei Island Tribe Berlin street wear amp; organic piercings. Bei uns bekommen Sie
island-tribe.de
153 Die Kraft des Feuersteins Mineralien
10789
Berlin
Feuerstein Jaspis Rügen Ostsee Schmuck aus Feuerstein geschliffener Feuerstein
jasper-flint.de Mineralien Feuersteine Hühnergötter
154 Home Boutique Monique Tunika
12555
Berlin
Herzlich Willkommen bei Boutique Monique ! Getreu dem Motto Klasse statt Masse finden Sie
monique-design.de Tunika Boho Vintage
155 Pfandleihhaus Lohmann Berlin seit Christian Lohmann e.K. Goldankauf
10559
Berlin
Pfandleihhaus Lohmann in Berlin Charlottenburg und in Berlin Mitte. Goldankauf und Pfandkredite schnell
leihhaus-lohmann-berlin.de Goldankauf Gold Ankauf
156 Susanna Kuschek Kuschek
10437
Berlin
Susanna Kuschek Berlin ist Schmuckdesignerin und Goldschmiedin: Ringe Ketten Armbänder
duette-lunette.de
157 Www.unikaton.de Strato AG
10587
Berlin
Unikaton Töpfermanufaktur In der Töpfermanufaktur Unikaton entstehen vielfältigste Keramikprodukte in interessanten Materialkombinationen. Angewendet werden
unikaton.de
158 INDIO Market indianisches Kunsthandwerk mexikanisches
10409
Berlin
Indianische Azteken und Maya Handwerkskunst aus Mexiko und Guatemala. Handgefertigte Produkte aus Mittelamerika. Lateinamerikanischmexikanisches Kunsthandwerk.
indiomarket.de Mexikanisches Kunsthandwerk Mexikanische Handwerkskunst
159 FriebeArt SchmuckUnikate und DrechselKunst FriebeArt
13125
Berlin
Entwurf und Fertigung von Schmuckunikaten Brautschmuck und Accessoires. Entwurf und Fertigung von Objekten der
friebe-art.de FriebeArt FriebeArt Friebe
160 Home wohnaccessoires
12157
Berlin
Accessoires
katzbleu.de Wohnaccessoires Geschenke Fanartikel
161 PremiumWaren Webverzeichnis für Qualitativ Premium
12555
Berlin
PremiumWaren.de Suchen Sie qualitativ hochwertige Produkte dann besuchen Sie unser Portal.
premium-waren.de Premium Waren Premium Katalog
162 Juwelier Warbinek Uhren
13507
Berlin
Ihr Juwelier im Norden Berlins. Wir bieten Uhren und Schmuckmodelle saemtlicher Hersteller
warbinek.de Uhren Schmuck Bestecke
163 Hobbystuebchen basteln
10243
Berlin
alles rund ums basteln materialien tipps und tricks
xn--hobby-stbchen-3ob.de Basteln Malen Hobby
164 Mailaden Verein zur Förderung keramischen Gestaltens - Mailaden e.V. Mailaden
10827
Berlin
Mailaden Wir sind eine Keramikwerkstattgemeinschaft in BerlinSchöneberg mit einem vielfältigen Angebot in unserem Laden.
mailaden-keramik.de Mailaden Keramik Berlin Schöneberg Werkstattgemeinschaft
165 Onlineshop für Damen und Kauf
10435
Berlin
Online Shoppen bei uns soll Freude bereiten und dabei glücklich machen! Schuhe und Mode gibts
kaufdichgluecklich-shop.de Kauf Dich Glücklich Wood
166 Esomena | Esoterik Shop esomena
10825
Berlin
Esomena EsoterikShop
esomena.de Esomena Esoterik Blume Des Lebens
167 Antiklager24.de Antik
13583
Berlin
Antiklager24.de Antiquitäten in Berlin und Brandenburg
antiklager24.de Antik Lager Antiquariat Antikes Gold
168 Berlinbombay berlinbombay
14193
berlin
berlinbombay store showroom textilien accessoires Indienshop in Berlin Grunewald Maa
berlin-bombay.de Berlinbombay Indienshop Berlin
169 Juwelier am Mehringdamm juwelier
10961
Berlin
Goldankauf Schmuckankauf Juwelier MoneyService
juwame.de Juwelier Mehringdamm Berlin
170 Juwelier Bonze | Startseite Wedding
13409
Berlin
Juwelier Bonze Residenzstr. 137 in 13409 Berlin Tel. 030 47907767
juwelier-bonze.de Wedding Verlobungsringe Verlobung
171 Kumasi Shop Home Afrikanische
10437
Berlin
Berlin bietet Gegenstände aus Kunst und Kunsthandwerk Afrikas insbesondere Ghanas an.
kumasi-shop.de Afrikanische Kunst In Berlin
172 Photorainbow Fotografie Stadt fotografie
13189
Berlin
Fotografie Momente in Bildern festhalten Fotos aus Fauna und Flora von Tieren
photo-rainbow.de Fotografie Foto Tiere
173 Stefanie Holtz Schmuckdesign Anfertigungen Stefanie
10829
Berlin
Stefanie Holtz Schmuckdesign Anfertigungen Unikate
stefanie-holtz.de Stefanie Holtz Schmuckdesign Anfertigungen Unikate
174 Ulrike stabe blüteneich Ulrike
14089
Berlin
Ulrike Stabe blütenreich bluetenreich Blumen Blumenladen Blumen Pflanzen Vasen
bluetenreich-berlin.de Ulrike Stabe Blumenladen
175 Welcome to Per4 Piercing
10249
Berlin
Per4 Ihr Piercing Tattoo Jewellery ? Medical Equipment ? Permanent Make Up
piercingrestposten.de Piercing Tattoo Grosshandel Studiobedarf Medical
176 Der KeltenShop  Runen Kelten runen
10367
Berlin
Keltisches und germanisches aus Holz. Hier finden Sie Runen Runenanhänger Schalen und Dosen
kelten-shop.de Runen Kelten Germanen
177 ✩ Berlin SunShine und Detlef
12687
Berlin
Sunshine und Tattoo Studio Alles rund um den Bereich Wellness Solarium Tattoo
sunshine-tattoo-studio.de Detlef Niegisch
178 SCHALLER BEWEGO Gold
13465
Berlin
Goldschmiede Hans Schaller BeWeGo Schmuckdesign Gutachten
bewego.de Gold Und Silberschmuck Sowie Informationen
179 Home kunstgalerie
12057
Berlin
VaniFaceS *** Gute *** Laune *** Emotionen*** kreiert von Silvana Czech
vani-living-art.de Kunstgalerie Antiquitaet Antiquität
180 Ulrike stabe blüteneich Ulrike
14089
Berlin
Ulrike Stabe blütenreich bluetenreich Blumen Blumenladen Blumen Pflanzen Vasen
xn--bltenreich-beb.de Ulrike Stabe Blumenladen
181 Superskull – der Onlinestore Pletz & Behringer GbR Dia
10961
Berlin
Dia de los Muertos – große Auswahl an Kunsthandwerk TShirts sowie Skeletten aus
superskull.de Dia De Los Muertos
182 Reevoo Sein Revolutionärer Schmuckblog
13465
Berlin
Reevoo sein revolutionärer Uhrenblog
reevoo.de
183 Kunsthandel Fuchs Berlin – Kunsthandel
10117
Berlin - Mitte
Kunsthandel Fuchs ist in Berlin eine der ersten Adressen für Kunstgegenstände aus dem Jugendstil sowie
kunsthandel-fuchs.de Kunsthandel Fuchs Berlin
184 Afrikanische Kunst Berlin Afrikanische
10623
Berlin
Galerie Dogon Berlin bietet Afrikanische Kunst in Berlin sowie Tribal Art in Berlin
galeriedogon.de Afrikanische Kunst Berlin Tribal
185 Produktmanufaktur marcel wältring; metallgestaltung Wältring
10625
Berlin
Handgefertigte Kleinserien und Unikate vornehmlich aus Metall aber auch weiteren Materialien wie Holz
produkt-manufaktur.de Wältring Berlin Design
186 Ihr kompetenter Ansprechpartner für vegas
12043
Berlin
Ihr kompetenter Ansprechpartner für hochwertige Kosmetik Parfum und Silberschmuck von Vegas Cosmetics. Wir geben
vegaspartner.de Vegas Cosmetics Vegaspartner
187 Dekorationen aus Asien Kunsthandwerk
10965
Berlin
In unserem online shop finden sie eine große Auswahl an Dekorationen aus Asien.
albesia.de Kunsthandwerk Dekorationen Holzschnitzerei
188 HOME B&M Design GmbH Schmuck
10789
Berlin
Unikate im Schmuckdesignbereich hochwertige Korallen und Perlenschmuck
artpearls.de Schmuck Design Korallen
189 DOCK 2 dekoration dock
12555
Berlin
Dies ist die offizielle Internetpräsenz der Firma DOCK 2 dekoration Inh. Anja Eichhorn
dock-2.de Dock 2 DOCK2
190 Die Kunstburg Antikes kunstburg
12051
Berlin
Antikes und schönes in Berlin Neukölln
die-kunstburg.de Kunstburg Berlin Neukölln
191 Carat International Ihr Carat International KG Goldbarren
10117
Berlin
Carat International KG Ihr Spezialist für Feingold Barren aus Berlin hilft Ihnen Ihr
gold-international.de Goldbarren Gold Au
192 _ Handyschmuck _ ChinChin diva
10178
Berlin
Handyschmuck ist der letzte Schrei in Japan. Dieser Modeschmuck wird am Handy befestigt. diva berlin
diva-berlin.de Diva Berlin Divaberlin
193 Home
12555
Berlin
Malen Zeichnen coeart
coeart.de
194 Beschenkmich.de und jeder make a startup GmbH beschenkmich.de
10178
Berlin
Entdecken und verschenken bei beschenkmich.de: Elektronik Foto DVD Musik Bücher
beschenkmich.de Beschenkmich.de Bücher Elektronik
195 GLUCOMAX Alles für Glucomax GmbH diabetes
10827
Berlin
GLUCOMAX Alles für Diabetiker
glucomax.de Diabetes Diabetis Diabetiker
196 Fumanchuh
10245
Berlin
Fumanchuh
fumanchuh.de
197 Die Welt echter Edelsteine c/o NEWE Real Estate & Energy GmbH Edelsteinschmuck
13601
Berlin
Edelsteinschmuck in allen Variationen günstig online bestellen. Ringe Anhänger Ohrringe und vieles mehr
zaubersternwelt.de Edelsteinschmuck Goldschmuck Silberschmuck
198 Bauhausshop bauhaus-archiv gmbh design
10785
berlin
designshop für wohnen büro tisch+küche uhren spiele plakate original
bauhaus-shop.de Design Shop Design
199 Goldankauf Juwelier Saro
12161
Berlin
Juwelier Saro Ihr GoldankaufExperte in Berlin steht für Goldankauf mit fairen und transparenten
bestgoldankauf.de
200 Schnäppchen | Sonderangebote | Sonderangebote
10719
Berlin
Ihr Portal für Schnäppchen Sonderangebote Gratis Angebote Rabatte Gutscheine kostenlose
welt-der-angebote.de Sonderangebote Gratis Angebote
201 Snugata Home öko
10247
Berlin
Snugata Kinderkleidung für 010 Jährige. natürlich öko logisch
snugata.de öko Kleidung Biobaumwolle
202 Lustgärten und Gartengräber Mughal
14195
Berlin
Bis zum 28. Januar 2007 zeigt das Museum für Indische Kunst in Berlin Dahlem die
moghul-garten.de Mughal Garden Mughal Painting Mughal
203 Goldschmied Daniel Goldschmuck Breuning
12163
Berlin
Goldschmied Daniel Schloßstr. 99 12163 Berlin Steglitz Breuning Trauringe
goldschmied-daniel.de Breuning Trauringe Fischer
204 Willkommen bei SELECTED LABELS® Selected
10715
Berlin
Selected Labels bietet ein attraktives Angebot von Reiseaccessoires wie Reisekoffer der Marke Hauptstadtkoffer über Projektionsleinwände
selected-labels.de Selected Labels SelectedLabels Selectedlabels SelectedLabels
205 Uhrenklinik Berlin Anschrift: Uhrenklinik GbR Uhrenklinik
14057
Berlin
Berliner Uhrenklinik Fachwerkstatt für Uhrenreparaturen und Schmuckreparaturen. Mit viel Erfahrung reparieren wir Armbanduhren
berliner-uhrenklinikweb.de Uhrenklinik Berliner Uhrenklinik
206 Angesagte Taschen Accessoires 7trends-Enamora GmbH fashion
10409
Berlin
7trends Der Online Shop für angesagte Taschen und trendige Accessoires. Traumhafte Handtaschen schöne
7trends.de Fashion Bekleidung Mode
207 Uhrenklinik Berlin Uhrenklinik
14057
Berlin
Berliner Uhrenklinik Fachwerkstatt für Uhrenreparaturen und Schmuckreparaturen. Mit viel Erfahrung reparieren wir Armbanduhren
uhrenklinik-berlin.de Uhrenklinik Berliner Uhrenklinik
208 Holzschmuck online kaufen
10317
Berlin
Kaufen Sie qualitativ hochwertigen Holzschmuck in klassischem Design online! Ohrringe aus Holz Holzkette
jewelwood.de
209 ABC Complett Ladeneinrichtungs GmbH ABC ComplettLadeneinrichtungs GmbH Ladeneinrichtung
12159
Berlin
Ladenbau Berlin Ladenbau und Ladeneinrichtung Berlin. Mit 25 Jahren Erfahrung Ihr kompetenter Partner bei Umbau
apothekenbau-berlin.de Ladeneinrichtung Berlin Ladeneinrichtung
210 Goldschmiedin in Berlin Entwürfe Design
10407
Berlin
Goldschmiedin Design Einzelanfertigungen
weissgold-berlin.de Design Entwürfe Nach Handskizzen Oder
211 Softbuster:
10625
Berlin
Official Softbuster Artist Page: Psychedelic Trance Psytrance Goatrance free mp3 downloads
softbuster.de
212 Goldschmuck verkaufen bei Gold altgold
14052
Berlin
Seröser und kompetenter Ankauf von Goldschmuck Silberbesteck und Zahngold in Berlin
gold-ankauf-berlin.de Altgold Verkaufen Berlin Edelmetallankauf
213 Jugend berät Verbraucher Ratgeber
13156
Berlin
Shopping Tipps und Ratgeber berät Verbraucher Vielseitig
jugend-bvv.de Ratgeber Tipps Shopping
214 Hatay Juwelier Seit Hatay
10967
Berlin
Hatay Juwelier Berlin Kreuzberg Neukölln Schöneberg
hatay.de Hatay Juwelier Türkischer Juwelier
215 Styleserver.de Eißmann & Köhler GbR #IndexMetaKeyword
10115
Berlin
#IndexMetaDescriptionStandard#
styleserver.de #IndexMetaKeywordsStandard#
216 Tierfilmer.de Informationen rund MSP Concept GmbH & Co. KG tierefilmen
10719
Berlin
Informationen rund um tierefilmen fotografieren filmkamera
tierfilmer.de Tierefilmen Fotografieren Filmkamera
217 Xxxxx zierstiche xxxxx zierstiche
10245
Berlin
Zierstiche Textildesign entwirft und fertigt Kleidung Taschen Accessoirs und Stofftiere in individuellen Kleinauflagen
zierstiche.de Zierstiche Textildesign Kleidung
218 Friedhofsgärtnerei Heidefriedhof: Lutz Rademacher Gärtnerei
12107
Berlin
Herzlich Willkommen auf den Internetseiten der Friedhofsgärtnerei Rademacher aus Berlin
friedhofsgaertnerei-heidefriedhof.de Gärtnerei Berlin Friedhof Heidefriedhof Friedhofsgärtner
219 Indischer Basar Räucherstäbchen Räucherstäbchen
13403
Berlin
Indischer Basar Räucherstäbchen Geschenkartikel Textilien Modeschmuck uvm.
indischerbasar.de Räucherstäbchen Geschenkartikel Textilien
220 Ringkissen
13591
Berlin
Ringkissen im Ringkissenshop von HopedreamDesign Deko und Hochzeits Accessoires extravagante Ringkissen und
hopedream-design.de
221 Friedhofsgärtnerei Heidefriedhof: Lutz Rademacher Gärtnerei
12107
Berlin
Herzlich Willkommen auf den Internetseiten der Friedhofsgärtnerei Rademacher aus Berlin
gaertnerei-rademacher.de Gärtnerei Berlin Friedhof Heidefriedhof Friedhofsgärtner
222 RunaXX RunaXX
12526
Berlin
RunaXX Wikinger Wikingerklamotten schwarze Szene Wikingwear Vikingwear Berserker
runaxx.de RunaXX Wikinger Wikingerklamotten
223 Trend Nägel Karow Nagelstudio
13125
Berlin
Trend Nägel Karow Berlin Pankow Weißensee Nagelstudio Wimpernstudio
trend-naegel.de Nagelstudio Berlin Nord
224 Ab ins Kind Kegel
10317
Berlin
Holzspielzeug Kurse Ballons mit Helium in Lichtenberg Berlin unsere Kurse: PEKiP Babymassage musikalische Früherziehung
abinskindundkegel.de
225 Trend Nägel Karow Nagelstudio
13125
Berlin
Trend Nägel Karow Berlin Pankow Weißensee Nagelstudio Wimpernstudio
trendnaegel-karow.de Nagelstudio Berlin Nord
226 Für Wohlbefinden und innere Versand
12347
Berlin
Point for Wellnes ist Ihr OnlineShop für Wohlbefinden und innere Harmonie.
point-for-wellness.de Versand Magie Pendel
227 Wald Berlin WALD Fashion GmbH
10119
Berlin
Die Begeisterung für Mode und Lifestyle teilen das Model Joyce Binneboese und die Stylistin Dana
wald-berlin.de
228 Jens Richard Berlin JENS RICHARD GmbH geschenk
10707
Berlin
Witzige und originelle Geschenke. Online Versand für TrendProdukte LifestyleArtikel und Accessoires. Geschenkideen für alle
jensrichard.de Geschenk Geschenke Geschenkideen
229 BranchennachweisOnline Branchen
12279
Berlin
Branchenverzeichnis Online Deutschland
branchennachweis-online.de Branchen Branchenverzeichnis Deutschland
230 ChakraAnhänger Madaya ChakraAnhänger
14109
Berlin
Übersicht ChakraAnhänger
madaya.de ChakraAnhänger WurzelChakra SexualChakra
231 Weihnachtsmarkt auf dem Winterfeldtplatz Berlin
10783
Berlin
Der traditionelle Weihnachtsmarkt auf dem Winterfeldtplatz ist einzigartig und an den Adventssonntagen geöffnet.
weihnachtsmarkt-winterfeldtplatz.de Berlin Weihnachtsmarkt Winterfeldtplatz
232 Cornelißen naTierliche Geschenke Geschenke
13509
Berlin
Cornelißen naTierliche Geschenke. Großhandel für Geschenkartikel Tierfiguren und vieles mehr
cornelissen-geschenke.de Geschenke Geschenkartikel Tierfiguren
233 Boulevard Berlin | Das BoulevardBerlin
12163
Berlin
BoulevardBerlin das Shoppingcenter in der Schloßstraße in Berlin Steglitz. Das größte Einkaufscenter in Berlins Süden.
boulevardberlin.de BoulevardBerlin Schloßstraße Shoppingcenter
234 Start Kreativ Tage Deco Concept GmbH Hobbybedarf
14109
Berlin
Kreativ Tage Berlin 15. 17. November 2013. Händler der gesamten Kreativbranche erwarten Sie
kreativ-tage-berlin.de Hobbybedarf Messe Berlin Basteln Malen
235 Willkommen bei Lunamaro Berlin
10961
Berlin
Das Geschäft Lunamaro in der Berliner Bergmannstraße verkauft exklusive indische Wohnaccessoires orientalische Möbel sowie
lunamaro-berlin.de Berlin Orientalische Möbel
236 Home brautstyling hochzeitsstyling in brautmakeup
10247
Berlin
Das exklusive Hochzeitsstyling von glam appeal Style bringt Ihre Schönheit voll zur Geltung. Beratung
glam-appeal-style.de Brautmakeup Brautfrisur Nagelmodellage
237 ORONDA Fair Trade Goldschmiede Fair
10829
Berlin
Fair Trade Goldschmiede ORONDA Berlin. Ihre Schmuckträume aus FairTrade Gold Silber und Edelsteinen!
oronda.de Fair Trade Goldschmiede ORONDA Berlin
238 Kleid Schuh Berlin Kleid
10557
Berlin
Willkommen bei Kleid Schuh Berlin. Kleider machen Frauen glücklich. Teilen Sie mit uns unsere
fashion-world-online.de Kleid Schuh Berlin
239 Silberfair fairtrade
10247
Berlin
fairtrade Silberschmuck
silberfair.de Fairtrade Silberschmuck
240 Tage eines Mediengestalters
12351
Berlin
Blog über Webdesign Grafik und alles was dazu gehört
weltimperator.de
241 Cornelißen naTierliche Geschenke Geschenke
13509
Berlin
Cornelißen naTierliche Geschenke. Großhandel für Geschenkartikel Tierfiguren und vieles mehr
natierliche-geschenke.de Geschenke Geschenkartikel Tierfiguren
242 Luisenforum Potsdam Die BERLINHAUS Verwaltung GmbH Shopping
10969
Berlin
In der Brandenburger Straße entsteht direkt am Brandenburger Tor das Luisenforum Potsdam.
luisenforum-potsdam.de Shopping Potsdam Luisenforum Brandenburg Gewerbe
243 Möbel Tischlerei Berlin Möbel
10559
Berlin
Möbel Tischlerei Berlin Möbelbau Innenausbau Einbauschränke Einbaumöbel Tresen
tischlerei-esslinger.de Möbel Tischlerei Möbeltischlerei
244 Leihhaus in der City Christiane Lohmann e.K. Leihhaus
10629
Berlin
Das Leihhaus in Berlin. Wir kreditieren sehr hoch Gold und Brilliantschmuck Luxusuhren Goldmünzen
leihhauscity.de Leihhaus Pfandleihhaus Berlin
245 Micromagix immer eine geschenk
10409
Berlin
Witzige handgemachte und originelle Geschenke. Online Versand für TrendProdukte LifestyleArtikel und Accessoires. Geschenkideen
micromagix.de Geschenk Handgemacht Geschenke
246 Queenly Queenly
10963
Berlin
Queenly Tierbedarf für Welpen kleine Hunde Katzen und Hamster.
queenly.de Queenly Tierbedarf Welpen
247 Onlingo das Qualitätsportal für CTI New Media GmbH
13465
Berlin
Mit onlingo erhalten Sie eine Übersicht von hochwertigen Anbietern Dienstleistern Handwerken und sonstigen
onlingo.de
248 Emailleschmuck Silberschmuck u. Emailleschmuck
10247
Berlin
Äußere Schönheit wirkt nach innen innere nach außen
andraschmuck.de Emailleschmuck Silberschmuck Halsketten
249 Leihhaus in der City Christiane Lohmann e.K. Leihhaus
10629
Berlin
Das Leihhaus in Berlin. Wir kreditieren sehr hoch Gold und Brilliantschmuck Luxusuhren Goldmünzen
leihhaus-city-berlin.de Leihhaus Pfandleihhaus Berlin
250 LiebTHEUER shop
12555
Berlin
Shop powered by PrestaShop
liebundtheuer.de Shop Prestashop
251 Onlineshop Link Verzeichnis | onlineshop
13089
Berlin
Onlineshop kostenlos anmelden im Shopverzeichnis ohne Backlink Webverzeichnis für gute Onlineshops
onlineshop-links.de Onlineshop Verzeichnis Deutschland Shopverzeichnis
252 Mode Beauty online
10405
Berlin
Mode Beauty Lifestyle und Wohntrends auf STRIKE magazin entdecken und bestellen. STRIKE inspiriert
strike-magazin.de Online Kaufen Kaufempfehlung
253 AERRabatt.de Reisen AERTiCKET AG Reisen
10967
Berlin
aerRabatt Reisen Linienflüge und Billigflüge für Lastminute einfach selbst online buchen und bis zu
aer-rabatt.de Reisen Rabatt Reise
254 Berliner Kabarett Klimperkasten Kabarett
12101
Berlin
Das musikalischliterarische Kabarett Berlins erzählt von seiner Gründung gibt Serviceinformationen und beschreibt die aktuellen
cabaretberlin.de Kabarett Berlin Klimperkasten
255 Charms und Anhänger Shop charms
12099
Berlin
RiesenAuswahl an Charms und Anhängern zu tollen Preisen mit Tipps zum Einkauf!
charmskaufen.de Charms Und Anhänger Shop Charms
256 Home Handel
12305
Berlin
HomepageTitel Berlin
dorotex.de Handel Großhandel Second
257 Berliner Kabarett Klimperkasten Kabarett
12101
Berlin
Das musikalischliterarische Kabarett Berlins erzählt von seiner Gründung gibt Serviceinformationen und beschreibt die aktuellen
berlin-kabarett.de Kabarett Berlin Klimperkasten
258 Erfinderseite.de Informationen rund MSP Concept GmbH & Co. KG erfindungen
10719
Berlin
Informationen rund um erfindungen patente patentanwalt patentamt
erfinderseite.de Erfindungen Patente Patentanwalt Patentamt
259 Berliner Kabarett Klimperkasten Kabarett
12101
Berlin
Das musikalischliterarische Kabarett Berlins erzählt von seiner Gründung gibt Serviceinformationen und beschreibt die aktuellen
kabarettberlin.de Kabarett Berlin Klimperkasten
260 Linde Burkhardt Start Linde
10629
Berlin
Linde Burkhardt
lfburkhardt.de Linde Burkhardt Kermaik
261 Flying Cow leder
12045
Berlin
Hier findet ihr eine große Auswahl an Tabaktaschen Tabakbeutel aus hochwertigem echtem Leder in
flying-cow.de Leder Echt Tabaktasche Tabakbeutel Drehertasche
262 Fusseltronic Electronic Development Geschenke
10965
Berlin
Entwicklung und Fertigung von elektronischen Geräten und Programmen
fussel-tronic.de Geschenke PocketPC Zubehör
263 Berliner Kabarett Klimperkasten Kabarett
12101
Berlin
Das musikalischliterarische Kabarett Berlins erzählt von seiner Gründung gibt Serviceinformationen und beschreibt die aktuellen
kabarett-klimperkasten.de Kabarett Berlin Klimperkasten
264 Weihnachten mit Toffifee Mit
13403
Berlin
Mit Toffifee wird Weihnachten noch weihnachtlicher! Zeigt uns eure Weihnachtsmomente mit Toffifee und sicher euch
toffifee-gewinnspiel.de Mit Toffifee Wird Weihnachten Noch
265 Berliner Kabarett Klimperkasten Kabarett
12101
Berlin
Das musikalischliterarische Kabarett Berlins erzählt von seiner Gründung gibt Serviceinformationen und beschreibt die aktuellen
webkabarett.de Kabarett Berlin Klimperkasten
266 Yolunda Hamamtuch
10997
Berlin
Entdecken Sie bei uns: Hamamtuch Strandtuch Saunatuch Saunahandtuch Strandlaken und Pestemal.
yolunda.de Hamamtuch Strandtuch Saunatuch
267 Friseur der Zunft Friseur
14057
Berlin
Schnell kompetent persönlich: hier finden Sie alle Leistungen und Services unsere Preise
friseur-der-zunft.de Friseur Frisur Schneiden
268 Linde Burkhardt Start Linde
10629
Berlin
Linde Burkhardt
linde-burkhardt.de Linde Burkhardt Kermaik
269 Goldankauf Wolf in Spandau: Goldankauf
13597
Berlin
Goldankauf in Berlin Spandau: Goldankauf Wolf. Ankauf vom Altgold Zahngold Bruchgold
goldankauf-spandau.de Goldankauf In BerlinSpandau Goldankauf
270 Ihr schneller kostenloser
10247
Berlin
Ihr schneller kostenloser Preisvergleich
meinepreise24.de
271 BE STYLED BERLIN BE
14167
Berlin
BE STYLED BERLIN
be-styled-berlin.de BE STYLED BERLIN
272 Kontaktlinsen Shop kontaktlinsen
12099
Berlin
TopAuswahl Kontaktlinsen und Kontaktlinsenpflege von vielen Marken zu g?nstigen Preisen mit Tipps zum Einkauf!
kontaktlinsen-auswahl.de Kontaktlinsen Shop Kontaktlinsen Shop Online
273 Kinderfahrrad Shop kinderfahrrad
12099
Berlin
TopAuswahl an Fahrr?dern f?r Kinder von vielen Marken zu g?nstigen Preisen mit Tipps zum Einkauf!
kinderfahrradkaufen.de Kinderfahrrad Shop Kinderfahrrad Shop Online
274 FreeFotosBerlin Berlin Fotos foto
10557
Berlin
freefotosberlin.de ist ein kostenloses Angebot von lizenzfreien Fotos. Alle Fotos können gratis herunter geladen werden
free-fotos-berlin.de Foto Fotos Berlin
275 Damenmode aus Berlin
10437
Berlin
Herzlich
renatereimann.de
276 Klapprad Shop klapprad
12099
Berlin
TopAuswahl an Klappr?dern von vielen Marken zu g?nstigen Preisen mit Tipps zum Einkauf!
klappradkaufen.de Klapprad Shop Klapprad Shop Online
277 Bettelarmband Anhänger Bedeutung
13127
Berlin
Woher kommen und was bedeuten Bettelarmband Anhänger? Lernen Sie hier das Geheimnis dieser Anhänger kennen
bettelarmband-anhaenger.de
278 Home Sie
13509
Berlin
Sie suchen einen vintage laden in Berlin dann sind Sie bei uns genau richtig.
textilkombinat-berlin.de Sie Suchen Einen Vintage Laden
279 Trekkingrad Shop trekkingrad
12099
Berlin
TopAuswahl an Trekkingr?dern von vielen Marken zu g?nstigen Preisen mit Tipps zum Einkauf!
trekkingradkaufen.de Trekkingrad Shop Trekkingrad Shop Online
280 Tro2Go Home Poccy - Point of Contact UG (haftungsbeschränkt) Branchenverzeichn
10247
Berlin
Branchenverzeichnis Tro2Go
tro2go.de Branchenverzeichnis Tro2Go Akzente Kaffee Tee Pralinen
281 Mit 400 Produkten : Effektive
12489
Berlin
Fachhandel Effektive Mikroorganismen.Hier finden Sie eine Auswahl mit ca. 400 Produkten rund um die Effektiven
em-kaufhaus.de Effektive Mikroorganismen EM 1
282 Kristallfluss Sell It Smart GmbH #IndexMetaKeyword
10437
Berlin
Bitte hier Kategorietext hinterlegen...
kristallfluss.de #IndexMetaKeywordsStandard#
283 Fiolini.de Lifestyle
12247
Berlin
Deko Online Shop von Fiolini Design Accessoires kaufen Dekorationsartikel online bestellen Home
fiolini.de Lifestyle Deko Wohndeko
284 Bauchtanzkostüme Online Dein Bauchtanzkostüme
12165
Berlin
Orient Inside Bauchtanzkostüme und Bauchtanzkleidung Dein Bauchtanzladen aus Berlin für orientalische Kostüme Kinderbauchtanzkostüme
orient-inside.de Bauchtanzkostüme Bauchtanzshop Bauchtanzkleidung
285 Antiquitäten Flohmarkt: Antikes Sammeln Regina Pröhm & Michael Schrottmeyer GbR
10318
Berlin
Sammeln Flohmarkt: Antiquitäten antike Möbel Ansichtskarten Briefmarken Bücher Schallplatten
oldthing.de
286 MGM Berlin teak
10715
Berlin
MGMBerlin : Groß und Einzelhandel mit Bronzen (Messing versilbert oder patiniert) Wohnaccessoires
mgm-berlin.de Teak Recycled Wood Bronze Figures
287 DIYmode diy
12049
Berlin
Schöne und einfache DIY Anleitungen die schnell gelingen.
diymode.de Diy Mode Diy
288 WOLKES CUPCAKES Online Shop Wolkes
10707
Berlin
Der 1. deutsche Cupcake Online Shop! Bestellen Sie Ihre Cupcakes ganz einfach online. Wählen Sie
wolkes-cupcakes-onlineshop.de Wolkes Cupcakes Anna
289 XLBekleidung Übergröße XLBekleidung
13156
Berlin
Bei XLBekleidung findet man Mode und Tipps für Übergrößen große Größen und XLBekleidung in
xl-bekleidung.de XLBekleidung Übergröße Große
290 Schuhe Mode jetzt Zalando SE Schuhe
10243
Berlin
Mode amp; Schuhe jederzeit mobil bei ZalandoMobile 24h online shoppen! Riesen Auswahl amp; versandkostenfrei!
m.zalando.de Schuhe Damenschuhe Herrenschuhe
291 Potpourri Design und Manufakur Potpourri
10317
Berlin
Potpourri Design und Manufakur
potpourri-berlin.de Potpourri Design Und Manufakur
292 Sotantar Yoga Shop yoga
10437
Berlin
Im Online Yoga Shop und im Laden in Berlin finden sie ihre Yogamatte Yoga
yogashopberlin.de Yoga Yogahose Yogamatte
293 ZZB Zahnmedizinisches Zentrum Optimum-Dental GmbH
12305
Berlin
Alles unter einem Dach ? über 25 Jahre Erfahrung in Berlin ? spezialisierte Zahnärzte
zzb.de
294 Brautschau XXL Brautmoden Brautkleider
10711
Berlin
Brautschau XXL Berlins erstes Braut und Abendmodenfachgeschäft mit Spezialisierung auf große Größen. Wir bieten
brautschau-xxl.de Brautkleider XXL Hochzeitskleider XXL
295 Diamanten online Shop | diamanten
10719
Berlin
Wir bieten eine große Auswahl an Diamanten online ?#20; Bestellen Sie heute den Diamant Ihrer
diamanten-breede.de Diamanten Diamant Diamant
296 Www.24colours.de | Onlineshop für 24colours GmbH Trends
10437
Berlin
24colours ? A BERLIN FASHION STORY. Im 24colours OnlineShop finden Frauen alle ModeTrends zu fairen
24colours.de Trends Schuhe CutOut
297 Gutscheine Schnäppchen Gutscheine
13051
Berlin
Finde täglich neue Gutscheine Rabatte und Schnäppchen. Finde hier den Gutscheincode deiner Wahl und
alinko.de Gutscheine Gutscheincodes Angebote
298 Rund um Berlin! Rezepte Berlin
13591
Berlin
Das ist meine Seite. Tolle Rezepte aus vergangenen Zeiten. News Infos und Tips für
andyco.de Berlin BerlinRezepte BerlinHotel Polizeiticker Stau
299 Home Antike Möbel antike
12459
Berlin
Willkomen bei AntikeMöbel und Antiquitäten. Umfangreiche Auswahl an hochwertigen Antiquitäten und antiken Möbeln
antike-moebel-berlin.de Antike Möbel Antiquitäten
300 Armbänder und Armreifen Shop armbänder
12099
Berlin
RiesenAuswahl an Armbändern und Armreifen zu tollen Preisen mit Tipps zum Einkauf!
armbandkaufen.de Armbänder Und Armreifen Shop Armbänder
301 Rund um Berlin! Rezepte Meine
13591
Berlin
Das ist meine Seite. Tolle Rezepte aus vergangenen Zeiten. News Infos und Tips für
berlin-news24.de Meine Seite Berlin BerlinChat BerlinFun
302 Malermeister Norbert Preuß in Maler
13467
Berlin
Malermeister Norbert Preuß zuverlässiger Malermeister aus Berlin Reinickendorf der Meister arbeitet selbst mit
malermeister-preuss.de Maler Tapezierer Lackierer
303 Juwelenauktion Prucha Juwelenauktion Prucha OHG Bewertung
10789
Berlin
Bewertung und Versteigerung von hochwertigem Gold und Brillantschmuck.
prucha-auktion.de Bewertung Versteigerung
304 Fischerhosen Tagesdecken
10437
Berlin
Schönes aus aller Welt gibt es im Guru Shop kleiderschrank sideboard esstisch
fischerhosen.de Tagesdecken Asien Möbel
305 Gold Frames Berlin | Brillenmodell
12165
Berlin
Gold Frames Berlin möchte alle Kunden die sich in der nächsten Zeit in Berlin
goldframesberlin.de Brillenmodell Berlin Einem
306 Finanzminister | Deutschland finanzminister
13465
Berlin
Finanzminister der Bundesrepublik Deutschland Minister der Finanzen der DDR Reichsminister der
finanzminister.de Finanzminister Deutschland
307 Startseite Nagelstudio Berlin Startseite
12489
Berlin
Ihr Nagelstudio u. Airbrush Schulung in Berlin. In gemütlicher Atmosphäre kreiere ich vom classic french
nail-galerie.de Startseite Nagelstudio Berlin
308 Rote Lippen Gottberg/Toussaint GbR Naturkosmetik
10999
Berlin
Fachgeschäft für Naturkosmetik mit kosmetischen Behandlungen nach Dr. Hauschka und M.Gebhardt.
rotelippen-naturkosmetik.de Naturkosmetik Berlin Kreuzberg
309 Thaikissen Tagesdecken
10437
Berlin
Schönes aus aller Welt gibt es im Guru Shop kleiderschrank sideboard esstisch
thaikissen.de Tagesdecken Asien Möbel
310 Stylist24 Onlineshop | Young Seed & Foster GmbH
10969
Berlin
Günstige stylische Damen und Herrenmode trendige Accessoires u.v.m.: ? 100 Tage Rückgaberecht ?
stylist24.de
311 Das tun wir für
13465
Berlin
Neues WegweiserPortal zum schnelleren Finden der Shops fuer Spezialitäten aller Art.Hier finden Sie erstmalig alle
spezialitaeten-portal.de
312 Wohnideen Shop Historisches
10405
Berlin
Der Wohnideen Shop beinhaltet zahlreiche nostalgische Artikel für die Wohnung das Haus
wohnideen-shop.de Historisches Renovieren Nostalgie Einrichtung
313 Angebotsübersicht Wohnung
14055
Berlin
Wohnung Immobilie Haus Kauf oder Miete die Angebotsübersicht listet alle Objektangebote
pappenberg-immobilien.de Wohnung Immobilie Haus
314 Eva Nordal Künstlerin
10117
Berlin
Entwurf eines Heiteren Realismus. Eva Nordal ist einfach ihrem Temperament gefolgt das ein sehr
evanordal.de
315 Braez Collection: BAM BERLIN Braez
10787
Berlin
Braez Collection: BAM BERLIN Fashion und Lifestyle aus aller Welt. Exclusive Angebote an Mode
braezandmore.de Braez Collection
316 Homepage nais berlin nais berlin UG (haftungsbeschränkt) Wir
10247
Berlin
Wir haben was gegen NichtszumAnziehen und ImmerdasGleiche.
nais-berlin.de Wir Haben Was Gegen NichtszumAnziehen
317 Goldankauf in Reinickendorf: Goldschmied Goldankauf
13507
Berlin
Goldankauf in Berlin Reinickendorf: Goldankauf Wolf. Ankauf vom Altgold Zahngold Bruchgold
goldankauf-reinickendorf.de Goldankauf In BerlinReinickendorf Goldankauf
318 Goldankauf in Britz: Goldschmied Goldankauf
12359
Berlin
Goldankauf in Berlin Britz: Goldankauf Wolf. Ankauf vom Altgold Zahngold Bruchgold
goldankauf-britz.de Goldankauf In BerlinBritz Goldankauf
319 Start Kreativ Tage Deco Concept GmbH Hobbybedarf
14109
Berlin
Kreativ Tage Berlin 23. 25. Oktober 2015. Es erwarten Sie Händler der gesamten
kreativ-tage.de Hobbybedarf Messe Berlin Basteln Malen
320 Ihr Spezialist für Haarverlängerung Haarverlängerung
10623
Berlin
Malaika Hair ist Ihr Spezialist für Haarverlängerung und Extensions in Berlin. Volles Langes und
malaikahair.de Haarverlängerung Berlin Hair Extensions Berlin
321 Make a Break | Make a Break Berlin UG (haftungsbeschränkt)
10247
Berlin
Authentisches Room Escape Game in Berlin. Reiße die Berliner Mauer nieder rette Berlin vor
make-a-break.de
322 Start | Science Match Verlag Der Tagesspiegel GmbH
10963
Berlin
"Science Match" ist ein neues Veranstaltungsformat das Wissenschaft und Wirtschaft über ihre Zukunftsfragen vernetzt
science-match.tagesspiegel.de
323 Shyrdaks handgemachte kirgisische
12051
Berlin
Hier können Sie alles über die hochwertigen kirgisischen Filzteppiche erfahren diese bestellen oder Ihren
shyrdak-jurte.de
324 Der löwenstarke Preisvergleich finanzen.de Vermittlungsgesellschaft für Verbraucherverträge AG Preislöwe
10997
Berlin
Preislöwe.de ist ein Preisvergleich für löwenstarkes und zudem sicheres OnlineShopping. Alle angeschlossenen Shops sind geprüft
xn--preislwe-s4a.de Preislöwe Preisvergleich Preise
325 Anzeigenmarkt kostenlos | kostenlos anzeigenmarkt
13089
Berlin
Anzeigenmarkt für kostenlose Kleinanzeigen
anzeigenmarkt-kostenlos.de Anzeigenmarkt Kostenlose Kleinanzeigen
326 Lomi Lomi Nui Massage lomi
10437
Berlin
Lomi Lomi Massage Berlin Bianca Mietke bietet Traditionelle hawaiianische Massagen (Lomi Lomi Nui)
lomi-lomi-massage-berlin.de Lomi Lomi Berlin
327 Besprechen von Krankheiten besprechen
10437
Berlin
Auf Bespechen von Krankheiten Besprechungsrituale Krankheiten besprechen Berlin bietet die ReikiLehrerinBerlin Marion Mietke
perlenlady.de Besprechen Krankheiten Besprechungsritual
328 Informationszentrum Psychotherapie e.V. Berlin psychotherapie
10965
Berlin
IZP Informationszentrum Psychotherapie e.V. Berlin bietet Orientierungshilfe bei der Wahl einer geeigneten Therapieform. IZP
informationszentrum-psychotherapie-berlin.de Psychotherapie Berlin Beratung
329 Gummistiefel Shop gummistiefel
12099
Berlin
TopAuswahl an modischen Gummistiefeln zu g?nstigen Preisen mit Tipps zum Einkauf!
gummistiefelkaufen.de Gummistiefel Shop Gummistiefel Shop Online
330 Gemaeldemuseum.de Informationen rund MSP Concept GmbH & Co. KG gemälde
10719
Berlin
Informationen rund um gemälde malerei poster gemäldemuseum
gemaeldemuseum.de Gemälde Malerei Poster Gemäldemuseum
331 Gemaeldearchiv.de Informationen rund MSP Concept GmbH & Co. KG malerei
10719
Berlin
Informationen rund um malerei malerei postkarten gemälde
gemaeldearchiv.de Malerei Malerei Postkarten Gemälde
332 Informationszentrum Psychotherapie e.V. Berlin psychotherapie
10965
Berlin
IZP Informationszentrum Psychotherapie e.V. Berlin bietet Orientierungshilfe bei der Wahl einer geeigneten Therapieform. IZP
izp-berlin.de Psychotherapie Berlin Beratung
333 Selbstportrait.de Informationen rund MSP Concept GmbH & Co. KG Selbstportrait
10719
Berlin
Informationen rund um Selbstportrait foto malen zeichnen
selbstportrait.de Selbstportrait Foto Malen Zeichnen
334 Mode Accessoires bei Panther Holding GmbH
10119
Berlin
Purefashion ist das Vergleichsportal für Mode und Fashion. Vergleichen Sie kostenlos die Preise verschiedener OnlineShops
purefashion.de
335 Portraitfotograf.de Informationen rund MSP Concept GmbH & Co. KG foto
10719
Berlin
Informationen rund um foto personen fotograf
portraitfotograf.de Foto Personen Fotograf
336 Portraitfotografie.de Informationen rund MSP Concept GmbH & Co. KG personen
10719
Berlin
Informationen rund um personen fotograf foto
portraitfotografie.de Personen Fotograf Foto
337 Portraitfotos.de Informationen rund MSP Concept GmbH & Co. KG foto
10719
Berlin
Informationen rund um foto fotograf personen
portraitfotos.de Foto Fotograf Personen
338 Willkommen Designerlabel
10719
Berlin
Meta Description
styletrieb.de Designerlabel Trendlabel Klamotten Onlineshoppen Ebay
339 Trauringe1000 Eheringe und trauringe
13591
Berlin
In unserem Hause finden Sie hochwertige Trauringe und Partnerringe aus Gold. Wählen Sie zwischen Weißgold
trauringe1000.de Trauringe Online Günstige Eheringe
340 Schlankelinie.de Informationen rund MSP Concept GmbH & Co. KG diät
10719
Berlin
Informationen rund um diät abnehmen
schlankelinie.de Diät Abnehmen
341 Riedl Finanzberatung Berlin (DIHK) e.V. finanzberatung
10178
Berlin
Riedl Finanzberatung Berlin Wirtschaftsberatung Berlin bietet Ihnen eine individuelle Ist und Bedarfsanalyse
wirtschaftsberatung-riedl.de Finanzberatung Wirtschaftsberatung Berlin
342 DesignerFashion online Mode Seed & Foster GmbH
10711
Berlin
DesignerFashion online Mode Schuhe Accessoires DesignerFashion von Top Marken online bestellen
department47.de
343 Golden Tao Grüner golden
10709
Berlin
Grüner Tee der Spitzenklasse Golden Tao hochwertiger Grüner Tee von Kim da Silva
xn--goldentao-grner-tee-hbc.de Golden Tao Grüner Tee
344 Brigit Schrader Gruse Film
10717
Berlin
Kostümbildnerin für Film und Fernsehen stellt ihre Arbeit vor Kostümbild für: Film
brigitschrader.de Film Fernsehfilm Serie
345 Slacks Fashion Korsetts Korsett
13187
Berlin
Berliner Manufaktur für extravagante Korsetts und Abendgarderobe. Rund um das Korsett entwerfen und produzieren wir
slacks.de Korsett Korsage Mieder
346 Fahndung Deutschlands Fahndungsportal Fahndung
14167
Berlin
Deutschlands erstes Fahndungsportal dass bei einem Fahndungserfolg umgehend die Polizei informiert!
fahndung.de Fahndung Ausschreibung Belohnung
347 Willkommen bei kobold24 preiswert
10243
Berlin
shoppingportal mit vielen anbietern aller branchen
kobold24.de Preiswert Günstig Schnäppchen
348 Geschenke und Souvenirs | Freunde der Preußischen Schlösser und Gärten GmbH
14059
Berlin
Die Sammlungen der Museen der Welt die berühmtesten Schlösser und die herrlichsten Gärten bieten
museumsshop-im-schloss.de
349 Geschenkeklaus: entspannt nach Geschenkideen Niels Schnatz und Friedhelm Victor GbR
10247
Berlin
Jetzt einzigartige Geschenkideen entdecken. Für jeden Anlass schnell und intuitiv das perfekte Geschenk finden.
geschenkeklaus.de
350 Gold kaufen: Goldbarren Gold
10117
Berlin
Goldshop der Exchange AG: Hier können Sie sicher und zu aktuellen Preisen Gold und Silber
gold-exchange.de Gold Kaufen Goldpreis
351 East West Regina Slama Angebot
10719
Berlin
East West Regina Slama Berlin
reginaslama.de Angebot Kompetenz Beratung
352 Originelle Geschenke ausgewählte
10407
Berlin
Passende Geschenke und neue Geschenkideen für Partner Freunde und Familie. Wir helfen Dir das
kipawa.de
353 Www.uhrmacherinnung.de Was ist Über
12487
Berlin
Die Innung der Uhrmacher von Berlin Potsdam Frankfurt/Oder stellt sich vor. Alle Mitglieder
uhrmacher-innung.de Über Mich Hobby
354 Schminktisch schminktische
10243
Berlin
Schminktische rücken Ihre Schönheit ins rechte Licht. In unserem Shop können Sie Ihren Schminktisch günstig
schminktische.de Schminktische Schminktisch Schminken Tisch Schminkkommode
355 Onlineshop für Schweizer Uhren
14167
Berlin
Mittlerweile umfasst der EPIOO Onlineshop ein breites Angebot von verschiedenen Uhren der Marke SWISS MILITARY
epioo.de
356 Citybuy24 Portal für TIC24 GmbH Werbung
10369
Berlin
Citybuy24 Ein Werbe und Gutscheinportal!
citybuy24.de Werbung Gutschein Rabatt Angebote Gutscheine
357 Cityfun24 Portal für TIC24 GmbH Werbung
12357
Berlin
CITYfun24 Ein Werbe und Gutscheinportal!
cityfun24.de Werbung Solarium Sonnenstudio Gutschein Rabatt
358 Krippenfiguren Krippenzubehür Krippenfiguren
10245
Berlin
Krippenfiguren gut und günstig Krippenfiguren Krippenzubehür
krippenfiguren-liste.de Krippenfiguren Krippenzubehür Krippenfiguren
359 Lederlemming MirkoFunke
12353
Berlin
individuelle Lederwaren Lederbücher Taschen Gürtel Lederbeutel Rüstungen Rüstungsteile
lederlemming.de
360 Bambus Dreams Berlin Bambus Dreams GmbH Massivholzmöbel
10178
Berlin
Bambus Dreams ist Ihr Händler für Massivholzmöbel in Berlin. Handgefertigte Unikate. Zuverlässige Lieferung.
testsystem.bambus-dreams.de Massivholzmöbel
361 Uhren Lohmann Berlin | Leihhaus City Inh. Christiane Lohmann e.K. Luxusuhr
10629
Berlin
Uhren Lohmann Berlin Neuwertige Luxusuhren wie Rolex Breitling Cartier Lange
uhren-lohmann-berlin.de Luxusuhr Breitling Cartier
362 DailyPR | Presseportal für Presseportal
12524
Berlin
DailyPR bietet eine Plattform für Pressearbeit
daily-pr.de Presseportal Pressearbeit Onlinemarketing
363 Living Accessoires und Bertine GmbH Living
13053
BERLIN
Wunderschöne Taschen geschmackvolle Wohnaccessoires ausgefallene Geschenkideen Kosmetik Papeterie Back und
bertine.de Living Geschenke Wohnaccessoires
364 WeltladenZeichenDerZeit/Berlin Weltladen ZeichenDerZeit eG Weltladen
10405
Berlin
WeltladenZeichenDerZeit in Berlin. Ihr Fachgeschäft für Fairen Handel im Kollwitzkiez BerlinPrenzlauer Berg.
weltladen-zeichenderzeit.de Weltladen Berlin WeltladenZeichenDerZeit Zeichen Der
365 Aktuelles Mia Cartoleria
10829
Berlin
Wir entwerfen Küchenposter Fahrradposter Postkarten Grußkarten Kinderposter und BioFair Wear Shirts
miacartoleria.de
366 STAR FM ROCKSHOP ROCK WORLD GmbH Shop
10178
Berlin
Shop powered by PrestaShop
starfm-rockshop.de Shop Prestashop
367 Geschenkidee.de | Ihr Shop Geschenkidee D&A GmbH Geschenkidee
10117
Berlin
Ausgefallene Geschenkideen und originelle Geschenke. Für jeden das Passende. Große Auswahl an tollen Geschenken. Jetzt
geschenkidee.de Geschenkidee Geschenkideen Geschenke
368 Aktuelle Rabatte Schnäppchen Smart Shopping and Saving GmbH Rabatt
10315
Berlin
Auf Sonderangebote.de findest Du täglich die besten Online Rabatte Deals und regionalen Angebote. Jetzt
sonderangebote.de Rabatt Rabatte Deals
369 Schminke! Schminke! Der fashion
14165
Berlin
Schminke! Schminke! ist der Beauty Blog rund um das Thema Makeup HairStyles Wellness
schminkeschminke.de Fashion Aveda Bioderma Guerlain Kiko
370 Amarandel Met aus Sandra Weber & Kai Mühlberg GbR Met
10249
Berlin
Met Honigwein aus eigener Herstellung in Berlin 15 Sorten auch im Großhandel Trinkhörner
amarandel.de Met Honigwein Ungeschwefelt
371 Coins and Stamps
10409
Berlin
My Store
coins-and-stamps.de
372 BELLE REBELLE Schönheit BELLE REBELLE GmbH Online
10623
Berlin
KOSMOS DER SCHÖNHEIT Parfums aus Berlin. Trendlabels für exklusive Nischendüfte Kostbarkeiten Luxuskosmetik
bellerebelle.de Online Parfums Berlin Exklusive
373 Willkommen bei EURO KFZMeisterbetrieb Abschleppdienst
10999
Berlin
Zuverlässigkeit und Reparaturtempo entscheiden über die Werkstattauswahl Wir sind zuverlässig und schnell überzeugen Sie sich
eurokfz-meisterbetrieb.de Abschleppdienst Schlaglöchern Achsvermessung
374 FM Parfum Shop FM
12439
Berlin
FM Parfum FM Make Up by Federico Mahora im offiziellen FM Trading Group World
duft-stars.de FM Parfum Düfte
375 Herrenmode und Hochzeitsanzüge
10787
Berlin
MK Herrenmode steht für stilvolle Anzüge nicht nur für Hochzeiten. Top Service rund um
mktrauringe.de
376 Myshoppingbag Vintage
10179
Berlin
Alles rund um das Thema Shopping: Lieblingsprodukte Mode Fashion Accessoires Handtaschen
myshoppingbag.de Vintage Online Shop Ausgefallene
377 GFS Steuerfachschule | Wirtschaftsfachschule GFS Steuer- und Wirtschaftsfachschule GmbH kurse
10787
Berlin
Nehmen Sie erfolgreich teil an geförderten Kursen durchgeführt von der GFS Steuer und WirtschaftsfachschuleDie Steuerfachschule
gfs-wifa.de Kurse Gefördert Bildungsgutschein Arbeitsamt Umschulung
378 FASHIONBRIEF FASHIONBRIEF fashionbrief
10407
Berlin
News von Insidern für Insider von Trendsettern und Early Birds aus Style Fashion
fashionbrief.de Fashionbrief Fashion Brief
379 Startseite ShabbyStyle.de shabby
10965
Berlin
Online Shop für skandinavische Wohnaccessoires in einer gelungenen Kombination im modernen Landhaus Stil und Shabby
shabby-style.de Shabby Style Junk Style
380 Die besten Rabatte im Kreowsky & Kreowsky GbR
10965
Berlin
Hier finden Sie die besten Rabatte im Internet. WebRabatte Aktionsangebote und Sonderangebote mit bis
sell-out.de
381 Bewerbungsfotos Berlin Fotograf LUMENTIS GbR Bewerbungsfotos
10247
Berlin
Lumentis Bewerbungsfotos Ihr Profi für Bewerbungsfotos und Bewerbungsvideos in Berlin. Auf unserer Seite finden
bewerbungsfotos-lumentis-berlin.de Bewerbungsfotos Fotostudio Berlin
382 Rockabilly Hotrod Clothes clothing
10245
Berlin
Der Onlineshop für Rockabilly Hot Rod Clothes in Berlin. Rockabilly Klamotten und Accesoires
crazy-box-berlin.de Clothing Rockabilly Psychobilly
383 Wachsfiguren.de Informationen rund MSP Concept GmbH & Co. KG wachsfiguren
10719
Berlin
Informationen rund um wachsfiguren wachsfigurenkabinett wachs figuren
wachsfiguren.de Wachsfiguren Wachsfigurenkabinett Wachs Figuren
384 Wachsfigurenkabinett.de Informationen rund MSP Concept GmbH & Co. KG wachsfigurenkabin
10719
Berlin
Informationen rund um wachsfigurenkabinett figuren wachsfiguren wachs
wachsfigurenkabinett.de Wachsfigurenkabinett Figuren Wachsfiguren Wachs
385 BDD Direktvertrieb Bundesverband Direktvertrieb Bundesverband Direktvertrieb Deutschland e.V. Bundesverband
10719
Berlin
Der Direktvertrieb bietet ideale Karrierechancen: Mit einem Nebenjob als Handelsvertreterin oder Handelsvertreter. Machen Sie sich
direktvertrieb.de Bundesverband Direktvertrieb Deutschland E.V.
386 Mode Berlin Fashion Mode
10247
Berlin
3Elfen ist ein junges FashionLabel mit handgemachter Mode aus Berlin. Kleider Röcke Oberteile
3elfen.de Mode Berlin Fashion Online
387 Lohmann Münzen Barren Leihhaus City Inh. Christiane Lohmann e.K. Goldmünzen
10629
Berlin
Goldbarren Goldmünzen Silberbarren und Silbermünzen günstig und sicher kaufen.
leihhaus-lohmann-shop.de Goldmünzen Goldbarren Silbermünzen
388 Ahoj Souvenirmanufaktur. Souvenirs aus Berlin
12043
Berlin
Souvenirs Kunst und Marketing made in Berlin
souvenirmanufaktur.de Berlin Neukoelln Souvenirs Mitbringsel Geschenke
389 Stadtlist Kleinanzeigen Deutschland Kleinanzeigen
13599
Berlin
Stadtlist Kleinanzeigen. Der Kleinanzeigenmarkt Ihrer Region. Kleinanzeigen suchen finden und inserieren.
stadtlist-kleinanzeigen.de Kleinanzeigen Anzeigen Kleinanzeigen
390 Ebeloo.de Online Marktplatz Auktionen auktionen
12099
Berlin Deutschland
Kaufen und Verkaufen Ersteigern und Versteigern Annoncieren und Tauschen Sie Handys Computer
ebeloo.de Auktionen Ebeloo Ebeloo.de
391 Damenuhren Shop damenuhren
12099
Berlin
TopAuswahl an Damenuhren zu tollen Preisen mit Tipps zum Einkauf!
damenuhren-kaufen.de Damenuhren Shop Damenuhren Shop Online
392 Damenhosen und Leggings Shop damenhosen
12099
Berlin
TopAuswahl an Damenhosen und Leggings von vielen Marken zu g?nstigen Preisen mit Tipps zum Einkauf!
damenhosenkaufen.de Damenhosen Und Leggings Shop Damenhosen
393 Damenjacken Shop damenjacken
12099
Berlin
TopAuswahl an Damenjacken von vielen Marken zu g?nstigen Preisen mit Tipps zum Einkauf!
damenjackenkaufen.de Damenjacken Shop Damenjacken Shop Online
394 Boots Shop boots
12099
Berlin
TopAuswahl an Boots und Bikerboots und Snowboots von vielen Marken zu g?nstigen Preisen mit Tipps
bootskaufen.de Boots Shop Boots Shop Online
395 Blumen Design Berlin blumen
10629
Berlin
BlumenDesignBerlin CharlottenburgWilmersdorf
blumen-design-berlin.de Blumen Berlin Charlottenburg
396 Krawatten und Fliegen Shop krawatten
12099
Berlin
TopAuswahl an Krawatten und Fliegen von vielen Marken zu g?nstigen Preisen mit Tipps zum Einkauf!
krawattenkaufen.de Krawatten Und Fliegen Shop Krawatten
397 Duft und Parfum Shop duft
12099
Berlin
TopAuswahl an D?ften Parfums Aftershaves und Eau de Toilette von vielen Marken zu
duftkaufen.de Duft Und Parfum Shop Duft
398 MiriShop | der Onlineshop Keyword1
10707
Berlin
Meta Description
miri.de Keyword1 Keyword2 Keyword3
399 Hausschuhe Shop hausschuhe
12099
Berlin
TopAuswahl an Hausschuhen und Pantoffeln von vielen Marken zu g?nstigen Preisen mit Tipps zum Einkauf!
hausschuhe-kaufen.de Hausschuhe Shop Hausschuhe Shop Online
400 Fashion Addicts Mode ONN UG (haftungsbeschränkt)
12169
Berlin
Mode sind wir!
fashionaddicts.de
401 Sandalen Shop sandalen
12099
Berlin
TopAuswahl an Sandalen Clogs Zehentrennern strandsandalen und Badeschlappen von vielen Marken zu
sandalenkaufen.de Sandalen Shop Sandalen Shop Online
402 Kleider Shop kleider
12099
Berlin
TopAuswahl an Kleidern von vielen Marken zu g?nstigen Preisen mit Tipps zum Einkauf!
kleid-kaufen.de Kleider Shop Kleider Shop Online
403 Makersflair.de Marktplatz für DIY
10715
Berlin
Finde hier tolle Angebote bei denen du lernst Dinge selbst herzustellen oder biete deine
makersflair.de DIY DoItYourself Handmade
404 Einfach umweltbewusst und fair
10785
Berlin
Einkaufen mit gutem Gewissen ist ganz einfach. In unserem großen Marktplatz kann man über 50.000
wegreen.de
405 Röcke Shop röcke
12099
Berlin
TopAuswahl an modischen R?cken von vielen Marken zu g?nstigen Preisen mit Tipps zum Einkauf!
rockkaufen.de Röcke Shop Röcke Shop Online
406 Exklusive Raritäten in wöchentlichen
10115
Berlin
In den über 40 wöchentlichen Online Auktionen von Catawiki finden Sie besondere und einzigartige Objekte.
catawiki.de
407 Winterjacken Shop winterjacken
12099
Berlin
TopAuswahl an Winterjacken und Winterm?nteln zu g?nstigen Preisen mit Tipps zum Einkauf!
winterjackenkaufen.de Winterjacken Shop Winterjacken Shop Online
408 Logopädie Kinder logopädie
10115
Berlin
Logopädie Berlin Mitte Logopädie Sandra Steller bietet LogopädieTherapien für Kinder Jugendliche und Erwachsene
xn--logopdie-steller-znb.de Logopädie Berlin Mitte
409 Schnäppchen Deals Gutscheine Schnäppchen
10317
Berlin
Dein SchnäppchenPortal mit den besten Schnäppchen RabattAktionen kostenlosen Angeboten und den aktuellsten Gutscheinen
meinedealz.de Schnäppchen Rabatt Aktion
410 DIF | Dit is mirapodo ? operated by myToys.de GmbH
10783
Berlin
DAS Berliner Modeblog zu Fashiontrends und Modesünden Parties und Veranstaltern Designern und Kollektionen
dit-is-fashion.de
411 GeschenkeWegweiser Ihr Geschenkidee geschenke
10243
Berlin
Die Geschenkidee für jeden Anlass. Wir helfen bei der Suche nach Geschenken. Für besondere Anlässe
geschenke-wegweiser.de Geschenke Geschenkidee Weihnachtsgeschenke
412 WILLKOMMEN IM EUROPACENTER ? EUROPAHAUS Grundstücksgesellschaft mbH & Co KG
10587
Berlin
Einkaufszentrum Berlin: Direkt neben der KaiserWilhelmGedächtniskirche gelegen bietet Ihnen das Einkaufszentrum EuropaCenter ein Erlebnis
24ec.de
413 Anglerverein.de Informationen rund MSP Concept GmbH & Co. KG angeln
10719
Berlin
Informationen rund um angeln verein angler anglerbedarf angel anglerzubehör sportangeln sportfischen fangliste fischen karpfen angelausrüstung
anglerverein.de Angeln Verein Angler Anglerbedarf Angel
414 Anglerclub.de Informationen rund MSP Concept GmbH & Co. KG angeln
10719
Berlin
Informationen rund um angeln verein angler anglerbedarf angel anglerzubehör sportangeln sportfischen fangliste fischen karpfen angelausrüstung
anglerclub.de Angeln Verein Angler Anglerbedarf Angel
415 Badmintonverein.de Informationen rund MSP Concept GmbH & Co. KG badminton
10719
Berlin
Informationen rund um badminton badmintonverein verein
badmintonverein.de Badminton Badmintonverein Verein
416 Schnäppchen Preisvergleich adnanny.com GmbH Preisvergleich
10117
Berlin
Preisvergleich und Angebote bei Schnaeppchenjagd.de der innovativen Preissuchmaschine
schnaeppchenjagd.de Preisvergleich Preissuchmaschine Angebote
417 Wandtattoo Sprüche und traumhafte Sock, Amadou & Sock, N'Diaga GbR Wandtattoos
10553
Berlin
Keine Versandkosten in D. hearts; Anbringhilfe gratis hearts; Wandtattoos selbst gestalten o. aus über 1000
i-love-wandtattoo.de Wandtattoos Wandsticker Wandtattoo
418 Stuck Stuckateur Berlin Meister und Restaurator im Stuckateurhandwerk GmbH
13156
Berlin
Sebastian Rost Ihr Partner in allen Fragen zum Thema Stuck und Ausführung von Stuckarbeiten
sebastian-rost.de
419 Bibelseite.de Informationen rund MSP Concept GmbH & Co. KG bibel
10719
Berlin
Informationen rund um bibel gott jesus glaube
bibelseite.de Bibel Gott Jesus Glaube
420 WILLKOMMEN IM EUROPACENTER ? EUROPAHAUS Grundstücksgesellschaft mbH & Co KG
10587
Berlin
Einkaufszentrum Berlin: Direkt neben der KaiserWilhelmGedächtniskirche gelegen bietet Ihnen das Einkaufszentrum EuropaCenter ein Erlebnis
ecberlin.de
421 TheLabelFinder The best TLF LabelFinder GmbH
10115
Berlin
TheLabelFinder ist die größte internationale Fashion Suchmachine mit bereits mehr als 19000 Modemarken und
thelabelfinder.de
422 Magazin Seenland mecklenburgische
10553
Berlin
Magazin Seenland Die Reiseführer im Magazinformat für die Seenplatte in Brandenburg und Mecklenburg
magazin-seenland.de Mecklenburgische Seenplatte Seenland
423 WILLKOMMEN IM EUROPACENTER ? EUROPAHAUS Grundstücksgesellschaft mbH & Co KG
10587
Berlin
Einkaufszentrum Berlin: Direkt neben der KaiserWilhelmGedächtniskirche gelegen bietet Ihnen das Einkaufszentrum EuropaCenter ein Erlebnis
europacenterberlin.de
424 SEGUFIXSHOP und Patientenfixierung powered Medicare by Britta Gabriel GmbH segufix
13591
Berlin
Segufix Shop powered by Medicare Segufix kaufen Sie schnell und sicher über unseren
patientenfixierung.de Segufix Bandagen Fixierungen
425 Massschuhe.de Informationen rund MSP Concept GmbH & Co. KG schuster
10719
Berlin
Informationen rund um schuster masskleidung massschuhe masschuhe schuhe
mass-schuhe.de Schuster Masskleidung Massschuhe Masschuhe Schuhe
426 Massschuhe.de Informationen rund MSP Concept GmbH & Co. KG massschuhe
10719
Berlin
Informationen rund um massschuhe masschuhe schuhe schuster masskleidung
massschuhe.de Massschuhe Masschuhe Schuhe Schuster Masskleidung
427 Fechtverein.de Informationen rund MSP Concept GmbH & Co. KG verein
10719
Berlin
Informationen rund um verein degen fechten
fechtverein.de Verein Degen Fechten
428 Fechtclub.de Informationen rund MSP Concept GmbH & Co. KG fechten
10719
Berlin
Informationen rund um fechten verein degen
fechtclub.de Fechten Verein Degen
429 Forstwirt.de Informationen rund MSP Concept GmbH & Co. KG forstwirtschaft
10719
Berlin
Informationen rund um forstwirtschaft holz holzhandel holzverarbeitung
forstwirt.de Forstwirtschaft Holz Holzhandel Holzverarbeitung
430 Instrumentenbauer.de Informationen rund MSP Concept GmbH & Co. KG Musikinstrumente
10719
Berlin
Informationen rund um Musikinstrumente instrumentenbauer instrumente
instrumentenbauer.de Musikinstrumente Instrumentenbauer Instrumente
431 Aktuelle News und Termine IG Alt-Pankow e.V. Mitgleider
13187
Berlin
Interessengemeinschaft AltPankow Pankow und Umgebung
ig-alt-pankow.de Mitgleider Weihnachtsbeleuchtung Sponsor
432 Gutschein.de | Aktuelle Gutscheine Smart Shopping and Saving GmbH Gutschein
10315
Berlin
Neue Rabatt Gutscheine und Schnäppchen finden Sie kostenlos bei Gutschein.de. Mit uns sparen Sie sofort
gutschein.de Gutschein Gutscheine Rabatt
433 Exhibition EventSupport red`black berlin gmbh
10405
Berlin
Messe und EventService mit einem umfassenden Angebot vom Auf und Abbau Ihres Messestandes (Komplettservice)
redblackberlin.de
434 Religionsgemeinschaft.de Informationen rund MSP Concept GmbH & Co. KG Religion
10719
Berlin
Informationen rund um Religion gott bibel jesus
religionsgemeinschaft.de Religion Gott Bibel Jesus
435 FLAIR ? Fashion ahead media GmbH
10997
Berlin
FLAIR fashionhome. Das FLAIR Magazin zeigt monatlich Trends aus Mode Wohnen. Flair Online hat
flair-magazin.de
436 BEGINE Treffpunkt und Frauen
10783
Berlin
Interkulturelles Frauenkulturzentrum Künstlerinnenförderung Konzerte Ausstellungen Potsdamer Str. 139 BerlinSchöneberg
begine.de Frauen Lesben Frauencafé
437 Einkaufen in Lichtenberg: Der
10319
Berlin
Aktuelle Ausgabe unserer Kundenzeitung. Schlemmen ohne Reue. Süßes Fest für Genießer. Dekoratives für die Adventszeit.
tierparkcenter.de
438 Medienvirus get infected
12524
Berlin
Wir sind eine Berliner WebAgentur die sich auf WordPress WooCommerce Webdesign
medienvirus.de
439 AnziehSpielekostenlos.de Designe tower
10249
Berlin
Spiele herausragende und neue Anzieh Spiele komplett kostenlos!
anzieh-spiele-kostenlos.de Tower Defence Spiele Spielen
440 Ellen Luise Weise ? Bildende
10367
Berlin
Ellen Luise Weise Bildende Künstlerin in Berlin präsentiert ihre Ausstellungen in Berlin
ellen-luise-weise.de Bildende Kunst Kunst
441 Friseur Nagelstudio
12351
Berlin
Studio FeschTeam Beauty Center in Berlin Neukölln Rudow. Friseur Fußpflege Nagelstudio
fesch-team.de
442 Günstige Bilderrahmen kaufen auf elementum GmbH
10115
Berlin
Große Auswahl an Holzrahmen Metallrahmen und Digitalen Bilderrahmen zu günstigen Preisen für ihre individuellen
holzrahmen-metallrahmen.de
443 Abmahnschutzbrief: Online sicher handeln! Abmahnschutzbrief
14169
Berlin
Mit unserem Abmahnschutzbrief bestehend aus der Basisabsicherung und dem automatischen UpdateService. So sorgen wir
abmahnschutzbrief.de Abmahnschutzbrief Abmahnungen Abmahnschutz OnlineShop ECommerce
444 TRIK Ihr Spezialist TRIK Produktionsmanagement GmbH werbeartikel
14163
Berlin
Produktionsagentur für Werbeartikel Printproduktion und Merchandisingprodukte
trik.de Werbeartikel Werbemittel TRIK
445 So werden auch Sie
13156
Berlin
Sie wollen wissen wo die großen eBay Powerseller Ihre Waren kaufen dann sind Sie
powerseller-werden.de
446 Preisvergleich auf epreis.de Preisvergleich
13467
Berlin
Einfach schnell und bequem den günstigsten Preis finden. Im Preisvergleich von ePREIS vergleichen sie nicht
epreis.de Preisvergleich Produktvergleich Testbericht
447 Schönes aus aller Welt Tagesdecken
10437
Berlin
Schönes aus aller Welt gibt es im Guru Shop kleiderschrank sideboard esstisch
guru-shop.de Tagesdecken Asien Möbel
448 Fashion Kollaps Fashion
10437
Berlin
Willkommen im Modezirkus wo sich eine hässliche und sinnfreie Kollektion an die nächste reiht
fashion-kollaps.de Fashion Kollaps Mode
449 Schnäppchen im Angebot Schnäppchen
10409
Berlin
Schnäppchen Sale dein Preisvergleich im Internet
senor-sale.de Schnäppchen Im Angebot
450 Stylomo | Fashion | think:different GmbH Stylomo
10555
Berlin
Auf Stylomo findet ihr nicht nur die coolsten angesagtesten und schrägsten Klamotten und Marken
stylomo.de Stylomo Berlin Fashion
451 Spirituelle Musik und Wegbegleitung
10247
Berlin
Spiritualität die ins Leben führt. Wort Klang Bild aus der Kraft des
klanggebet-shop.de
452 AnneLiWest|Berlin
10119
Berlin
AnneLiWest|Berlin: BerlinBlog für schönes Design ausgefallene Ideen aufregende Interiors spannende Orte und
anneliwest.blogspot.de
453 Modeopfer110 größtes Mode mode
10243
Berlin
Modeopfer110 ist die erste Adresse zu Fragen rund um das Thema Mode. Wir bringen Modedesigner
modeopfer110.de Mode Blog Modeblog
454 Parfümerie Flaconi: Parfum Flaconi GmbH
10969
Berlin
Jetzt Parfum Pflege MakeUp bei Flaconi online bestellen! #10004;Versand in 12 Tagen
parfum-news.de
455 Parfümerie Flaconi: Parfum Flaconi GmbH
10969
Berlin
Jetzt Parfum Pflege MakeUp bei Flaconi online bestellen! #10004;Versand in 12 Tagen
flaconi.de
456 Plissee Rollo und Advalux UG (haftungsbeschränkt)
10589
Berlin
Ihr Plissee Spezialist im Internet. Advalux bietet ihnen Sonnenschutzprodukte ?made in Germany? zu TopPreisen. 0
advalux.de
457 Holzspielzeug wie Schaukelpferd Holzspielzeug
13189
Berlin
Das gesamte KugelbuntTeam wünscht ein fantastisches 2015!
kugelbunt-shop.de Holzspielzeug Kugelbahn Schaukelpferd
458 Versteigerungen Auktionen im
14055
Berlin
Online Auktionen kostenlose Wertschätzung sowie Ankauf Verkauf von Antiquitäten ? Auctionata ? So
auctionata.de
459 That's so me Anne Höweler / Camilla Rando GbR 25
10243
Berlin
Mode Blog von und mit Camilla Rando Anne Höweler AnneKathrin Bieber und Kathrin
thatssome.de 25 Hours Hotel Hotel Wien
460 Tukup Preissuchmaschine Preisvergleich
12353
Berlin
tukup shopping Erst Tukup. Dann kaufen.
tukup.de Preisvergleich Angebote Preis
461 Geschenkartikel günstig kaufen Geschenk
12437
Berlin
Onlineshop für ausgefallene Geschenke und besondere Geschenkideen von formano Rinconada Sagrado
zauberhafter-laden.de Geschenk Geschenke Geschenkidee
462 Willkommen bei Marktportal Kleinanzeigen
12107
Berlin
Willkommen in unserem KleinanzeigenPortal zahlreiche neue Anzeigen warten auf Ihren Besuch! Auch Sie können
auvgebrauchtwaren.de Kleinanzeigen Anzeigen Markt
463 Bastelshop Bastelartikel LaBlanche
10407
Berlin
famosio der Bastelshop für Scrapbooking Papier Kartenkarton Motivpapier Sticker Motivstempel und Stanzschablonen rund um den
famosio.de LaBlanche Joy Scrapberry
464 Kompetente Hilfe für Ihre Bachelorarbeit
12157
Berlin
Mit gezielter Hilfe schließen Sie Ihr Studium erfolgreich ab. Ein qualifiziertes Lektorat lässt Ihre Dissertation
das-unicoaching.de Bachelorarbeit Masterarbeit Dissertation
465 Pflanzenschutz und Dünger günstig elementum GmbH
10115
Berlin
Unkraut im Garten: Mit den richtigen Mitteln und Unkrautvernichtern gegen das Unkraut. Dazu Dünger zu
duenger-und-pflanzenschutz.de
466 Im Internet Telefonieren reventix GmbH voip
10785
Berlin
Großes Informationsportal zu Thema Telefonieren im Internet für Unternehmen und Privat. Viele Tipps Studien
im-internet-telefonieren.de Voip Telefonie Cloud
467 Hochwertige Zaun Toranlagen Pleschinger Immobilien GmbH
13627
Berlin
TRAUMSERVICE ? TRAUMQUALITÄT ? TRAUMPREISE Wir stehen für Qualität Service und Transparenz! Jetzt Traumzaun
traum-zaun24.de
468 WILLKOMMEN IM EUROPACENTER ? EUROPAHAUS Grundstücksgesellschaft mbH & Co KG
10587
Berlin
Einkaufszentrum Berlin: Direkt neben der KaiserWilhelmGedächtniskirche gelegen bietet Ihnen das Einkaufszentrum EuropaCenter ein Erlebnis
europa-center-berlin.de
469 SchnappSchnapp.de Das Schnäppchenportal
12103
Berlin
Auf SchnappSchnapp.de findest du jeden Tag neue Schnäppchen Deals und Gutscheine um Geld zu
schnappschnapp.de
470 Underground Lasergame Lasertag
13189
Berlin
Spiele Lasertag in Berlin! Deutschlands größte unterirdische Lasertag Area!
underground-lasergame.de
471 Schnäppchen Blog für Gutscheine Toptarif Internet GmbH
10437
Berlin
Im Blog für Schnäppchen findet Ihr Gratisartikel oder Gutscheine sowie Gutscheincodes und Coupons. Testet die
schnappen4u.de
472 Dessous Korsetts onlineshop
10589
Berlin Berlin
Korsetts Corsagen Mieder Dessous in großer Auswahl günstig online bestellen bei Zugeschnürt
zugeschnuert-shop.de Onlineshop Corsage Korsett Korsett
473 ShoppenEinfach.de So einfach war ShoppenEinfach.de
13057
Berlin
ShoppenEinfach.de So einfach war shoppen noch nie!!! shoppeneinfach.de vertreibt selber keine der dargestellten Produkte
shoppeneinfach.de ShoppenEinfach.de So Einfach War Shoppen
474 Restposten günstig | Fernseher Arena RKD GmbH returbo.
10707
Berlin
Mit Elektronik Restposten bis zu 80% sparen: Digitalkamera Fernseher viele andere Elektronikartikel günstig online kaufen
returbo.de Returbo. Günstig Billig
475 InKatalog | Der Webkatalog
13439
Berlin
InKatalog | Der Webkatalog
inkatalog.de
476 Rechtsanwaltskanzlei | Rechtsanwälte in ra-online GmbH Rechtsanwalt
10719
Berlin
Willkommen auf der Seite der Rechtsanwaltskanzlei Rechtsanwälte Fachanwälte Steuerberater Rasehorn Partner in
rasehorn-rae-stb.de Rechtsanwalt Rechtsanwälte Halle
477 Http://www.wohlert.de » Persönliches Blog Nach
10365
Berlin
Venedig und Heimweg Dienstag: Rom > Rimini 2 Tage Rom (Sonntag/Montag) Ein
wohlert.de Nach Abendmahl Minuten
478 Architektur Künstlerbedarf kaufen Modulor GmbH für
10969
Berlin
Stifte Marker ArchitekturModellbau Plexiglas Multiplex oder MDF Papier Papeterie
modulor.de Für Kreative Leute Materialien
479 Preisvergleich Produktportal Schottenland GmbH
10243
Berlin
Schottenland.de Der unabhängige Preisvergleich mit dem schnellsten Weg zum kleinsten Preis
schottenland.de
480 HKMStore Berlin by Jollys #IndexMetaKeyword
10713
Berlin
#IndexMetaDescriptionStandard#
hkm-berlin.de #IndexMetaKeywordsStandard#
481 Start NAJU Naturschutzjugend NAJU im NABU e.V.
10117
Berlin
Die Naturschutzjugend NAJU ist die Jugendorganisation des NABU und deutschlandweit der größte Kinder und Jugendverband
naju.de
482 Kiezmacher Förderverein Brüsseler Kiez e.V.
13353
Berlin
Blog eines Fördervereins in Berlin Wedding Brüsseler Kiez
kiezmacher.blogspot.de
483 Millionaere Millionaerinnen Geld
13465
Berlin
Millionaerinnen zeigt Trends Ideen Innovationen und Kunst.
millionaerinnen.de Geld Verdienen Millionaer
484 Startseite WELTKUNST Online ZEIT Kunstverlag GmbH & Co. KG
10117
Berlin
WELTKUNST das Kunstmagazin der ZEIT: Kunstgeschichten von der Antike bis zur Gegenwart aus
weltkunst.de
485 Die Werbeartikler bedruckte Werbeartikel
14057
Berlin
Die Werbeartikler sind Spezialisten für Werbeartikel und Werbemittel. Wir entwickeln suchen und produzieren für
die-werbeartikler.de Werbeartikel Bedrucken Werbemittelhändler
486 Bead of Berlin Shop
13507
Berlin - Tegel
Mit den BerlinBeads hast Du immer ein Stück der Metropole bei Dir!
beadofberlin.de Shop Onlineshop Bead
487 PAN Atelier für PANAtelier
16341
Zepernick b. Berlin
PANAtelier für Gestaltung Reinhard Jacob Figürliche Plastik Farbgestaltung Restaurierungen Gedenktafeln
pan-atelier.de PANAtelier PAN Reinhard
488 Directory: Recently Added Listings Webkatalog Berlin
10787
Berlin
Lokaler WebseitenKatalog für Berlin. Über 5.000 redaktionell kommentierte bewertete Internetadressen in über 330 Themenbereichen.
berlin-bookmarks.de Webkatalog Berlin Internetadressen
489 Getshoes.de | Sneaker kaufen Sneaker
13156
Berlin
Dein Sneaker Shop Sneakers online kaufen ? Ausgesuchte Sneaker von Adidas Dekline
getshoes.de Sneaker Sneakers Sneaker
490 Rennrad Pässe quäldich.de GmbH Rennrad
10999
Berlin
quaeldich.de ist die Nummer 1 zum Thema Pässefahren mit dem Rennrad. Pässelexikon Tourenberichte (z.B.
quaeldich.de Rennrad Fahrrad Radsport
491 Webspardose Die Sparexperten Webspardose
12159
Berlin
Webspardose Die Sparexperten
webspardose.de Webspardose Die Sparexperten
492 Schädlingsbekämpfung Berlin Kammerjäger schädlingsbekämpf
13509
Berlin
Schädlingsbekämpfung Berlin Kammerjäger Berlin Dr. Hermann bietet Integrierte Schädlingsbekämpfung nach neuestem Stand von
dr-hermann-berlin.de Schädlingsbekämpfung Kammerjäger Berlin
493 ICareWiki | websites Reha
12619
Berlin
iCareWiki | websites besser finden
icarewiki.de Reha Team Rollstühle
494 Homepage der evangelischen Kirchengemeinde St.
10969
Berlin
Die evangelische Kirchengemeinde St. Jacobi Luisenstadt Berlin Kreuzberg und die St. Jacobi Kirche Kreuzberg stellen
jacobiluisenstadt.de St. Jacobi Kirche Evangelische
495 Neuigkeiten Zwischenraum Festival
13187
Berlin
Das ZwischenraumFestival geht in die sechste Runde. Vom 7.9. August 2015 erschaffen und gestalten wir
zwischenraum-festival.de
496 ConnectedMarketing.de
10965
Berlin
Marketing mittels Mundpropaganda ("Word of Mouth Marketing") Buzz Marketing Viral Marketing oder Virus
connectedmarketing.de
497 Nachrichten und aktuelle Informationen Welt.de
10969
Berlin
Nachrichten und aktuelle Informationen und News aus Politik Wirtschaft Finanzen Wetter
welt.de Welt.de Www.welt.de Welt
498 Fussball Adressbuch das
12203
Berlin
Fussball Adressbuch ist das führende Branchenverzeichnis für Entscheider in Vereinen und Verbänden
fussball-adressbuch.de
499 LEUE NILL GmbH Deutscher Industrie- und Handelskammertag (DIHK) e.V.
10178
Berlin
Unabhängiger internationaler Versicherungsvermittler für Industrie Gewerbe und Privat.
leue-und-nill.de
500 Home Gold Ankauf goldankauf
12163
Berlin Steglitz
Seriöser Goldankauf Berlin beim Juwelier Amber zu hohen Preisen. Verkaufen Sie uns Ihr Altgold
goldankauf-amber.de Goldankauf In Berlin Goldankauf
501 Auktionshaus J. Weiner Berlin Angebot
10825
Berlin - Schöneberg
Auktionshaus Weiner Berlin
auktionshaus-weiner.de Angebot Kompetenz Beratung
502 Damenkleider von King Louie
10711
Berlin Deutschland
Canadian Classics Parka Fundy Bay Wunderschöne Kleider von King Louie in Berlin Charlottenburg
curlylotta.de
503 Willkommen bei Xternals.de Dessous
12163
Berlin - Germany
Ihr OnlineHaendler fuer schoene Waesche sexy Dessous Lingerie heisse Clubwear und High
x-ternals.de Dessous Lingerie LegAvenue Leg Avenue
504 .:Road Riot:. Streetfighter Webshop Streetfighter
13156
Berlin - Deutschland
Streetfighter Streetfighters Hardcorefighter Hardcorefighters Motorrad bike motorcycle Maschine
road-riot.de Streetfighter Streetfighters Hardcorefighter
505 Stadtmarketing Bernau bei Berlin BeSt Bernauer Stadtmarketing GmbH
16321
Bernau bei Berlin
Die Best Bernauer Stadtmarketing GmbH profiliert und vermarktet das Image der Stadt Bernau bei Berlin.
best-bernau.de
506 Ferien Hotels im Kontaktdaten der Astrotel Internetmarketing GmbH Ferien
15566
Schöneiche bei Berlin
Ferien Hotels im Sauerland Erholung und wunderschöne Natur vereint für Ihren Urlaub und
ferien-hotel-im-sauerland.de Ferien Hotels Sauerland
507 Angebote für Ihren Kurzurlaub Astrotel Internetmarketing GmbH Angebote
15566
Schöneiche bei Berlin
Buchbare Angebote für Ihren Kurzurlaub in den schönsten Urlaubsregionen von Deutschland.
kurzurlaub4you.de Angebote Kurzurlaub Deutschland

Kostenloses Buch Tipps & Tricks für Arbeitswelt & Leben:
Erhalten Sie Ihr Buch "Tipps und Tricks für Arbeitswelt und Leben"
kostenlos per E-Mail als .pdf Datei:




Goldwaage Edelmetallhandel Schmuck Berlin - Öffnungszeit kann zu Feiertagen wie Karneval (Rosenmontag Faschingsdienstag Aschermittwoch), Valentinstag, Ostern (Gründonnerstag Karfreitag Ostersonntag Ostermontag), Tag der Arbeit und Himmelfahrt abweichen. Statistiken: 5 StadtBranche Punkte für "Schmuck Berlin" - Anzahl der Besucher und Erfahrungsberichte werden einbezogen. + Kontakt Schmuck in Berlin Goldwaage Edelmetallhandel › Kreisfreie Stadt Berlin - Schmuck Bewertungen Öffnungszeiten und Berlin Erfahrungen Stand:

Neuer Eintrag 

Schmuck ist ein Ziergegenstand oder eine Maßnahme zur Verschönerung. Der Begriff hat eine weitere und eine engere Bedeutung: Schmuck in der Stadt Berlin aus Berlin (13347) Öffnungszeit und Erfahrungen
Tipp der Redaktion Starke Rabatte auf Amazon Produkte:
Besonders als Geschenk immer eine gute Idee:
Freitags Angebote bei Amazon bis zu -75% reduziert
Rabatte prüfen ›


△ nach oben kostenfreier Eintrag Datenschutz