Ort

Berlin › Kreisfreie Stadt Berlin › Berlin

Branchenbuch Berlin 10785 Berlin

Kreisfreie Stadt Berlin
Berlin (Gemeinde in Berlin) gilt als Großstadt / Metropole in Berlin. Berlin als Kreisfreie Stadt hat 3.501.919 Einwohner.
1 Blanc - Design Studio Berlin Grafikdesign

13351
Berlin
Durch ein starkes Grafikdesign wird eine Marke leicht identifizierbar, unterscheidet sich von anderen Unternehmen und schafft Vertrauen..
corporate-design-berlin.com/
2 KS SchlĂŒsseldienst Berlin SchlĂŒsseldienst

12437
Berlin
WILLKOMMEN BEIM KS SCHLÜSSELDIENST Ihr VertrauenswĂŒrdiger Partner Unsere Dienstleistungen: TĂŒröffnungen Schlosswechsel Einbruchschutz Notdienst 24/7 Schließanlagen Beratung und Installation von Sicherheitstechnik..
schluesseldienst.berlin/notdienst/
3 Lab der Musik Musikschule

10967
Berlin
Lerne von den besten Musikern, im Komfort deines Zuhauses Trete einer lebendigen Gemeinschaft von Mitlernenden bei. Werde der..
www-lab-der-musik.de
4 Berliner KĂŒchenstudio Kitchen Studio

10969
Berlin
FIND YOUR DREAM KITCHEN IN OUR ONLINE KITCHEN STUDIO BERLIN Contact us https://berlinerkuechenstudio.de/ info@berlinerkuechenstudio.de +4915792604279 Credit Card, Cash, Bank Transfer Mo-Sa. 8.00 -..
berlinerkuechenstudio.de/
5 School of Sculpture Bildhauerschule

13409
Berlin
In dem idyllischen Garten der alten Monopol Destille in Reinickendorf lÀdt die "School of Sculpture Berlin" dazu..
schoolofsculpture.com/ Helvetica Loin Poppins Heading Body Montserrat My Groups
6 Harfenspieler buchen Harfenspieler

10783
Berlin
Entdecken Sie Harfenspieler Buchen - Atemberaubende Harfenmusik fĂŒr Ihre Veranstaltung Harfenspieler Buchen ist die perfekte Wahl fĂŒr alle..
harfenspieler-buchen.de
7 Garnelen-Guemmer Aquaristik

12167
Berlin - Steglitz
Herzlich Willkommen in unserem Aquaristik LadengeschĂ€ft. Wir beschĂ€ftigen uns seit ĂŒber 10 Jahren mit der modernen Aquaristik..
garnelen-guemmer.de/pflanzen/
8 Toplightstore Beleuchtungsarmatur

98829
Berlin
Toplightstore ist ein erstklassiger Online-Shop fĂŒr hochwertige Kronleuchter und andere Beleuchtungsoptionen zu außergewöhnlichen Preisen...
toplightstore.de

Kostenlos: 42 Tipps & Tricks für Arbeitswelt & Leben:
Erhalten Sie Ihr Buch "Tipps und Tricks für Arbeitswelt und Leben"
kostenlos per E-Mail als .pdf Datei:

9 SEO Agentur Berlin Online-Marketing-Unternehmen

10627
Berlin
Die SEO-Sicht ist eine auf Suchmaschinenoptimierung (SEO OnPage & OffPage) spezialisierte SEO Agentur in Berlin. Der Vorteil..
seo-sicht.de
10 Jolie Begleitservice Begleitservice

10967
Berlin
Bundesweit, vor allem in Berlin, bietet Jolie Begleitservice fĂŒr Herren und Damen zu Events, Veranstaltungen, ebenso Haus-..
jolie-highclass-escortservice.com
11 Ootel.co Hotel

12621
Berlin
Entdecken Sie erstklassige UnterkĂŒnfte in Berlin mit Ootel.com. Unser Hotel und Hostel bietet erschwinglichen Komfort fĂŒr jeden..
ootel.com
12 Webspace One Webdesign

10319
Berlin
WEBSPACE ONE ist eine fĂŒhrende Webdesign-Agentur in Berlin, die sich auf die Erstellung von maßgeschneiderten Websites spezialisiert..
webspaceone.de
13 Ootel.com Hotel

12681
Berlin - Marzahn
Dieses moderne Hostel bietet eine 24-Stunden-Rezeption und einfach eingerichtete Zimmer. Hier wohnen Sie im Stadtteil Marzahn-Hellersdorf, nur..
ootel.com Berlin Hotel Hostel Ootelcom Buchen Bed Room Budget
14 Alpha Reparaturdienst Elektro- und

13409
Berlin
Mit unserem Elektro Reparatur Experten sind wir Ihre Ansprechpartner fĂŒr die Reparatur von HaushaltsgerĂ€ten in Berlin. Dank..
alpha-reparaturdienst.de/ Reparatur Garantie Berlin HaushaltsgerÀte Reparaturdienst Alpha Ihr GerÀte
15 Anja Mey fotografie & design Fotograf

13467
Berlin
Fotografie und Design Fotodesign Hochzeitsfotografie Firmen-, Event- und Portraitfotografie..
anjamey.de Sans Roboto Hochzeit Product Posts List Cart Add
16 NEO Catering Berlin Catering

10247
Berlin
Professioneller Caterer fĂŒr private und gewerbliche Events jeglicher Art in Berlin und Umgebung. Individuelle Beratung fĂŒr kleine..
neo catering berlin gmbh
17 Anabolik Apotheke Pharmakologie

12163
Berlin
Das Unternehmen befasst sich mit der Lieferung, der Beratung und dem Verkauf von Arzneimitteln..
anabolikapotheke.com/ Kaufen Steroide Pharmaceuticals Magnus Anabolika Deutschland Tabletten Peptide
18 Ahmed Yousef LL.M. Ägyptischer Anwalt in Attorney At

10117
Berlin
Wir sind eine Rechtsanwaltskanzlei mit Rundumservice. Wir bieten Rechtshilfe in Rechtsfragen im Zusammenhang mit Àgyptischem und internationalem..
egy-lawyer.com/?lang=de Egyptian Anwalt Recht Berlin Germany Deutschland Law Rechtsanwalt
19 Beiladung-in-Berlin Movers

10178
Berlin
Wir sind Ihr Beiladungs Experte in Berlin – auf unserer Seite finden Sie alles, was Sie fĂŒr..
beiladung-in-berlin.de/ Berlin Beiladung Umzug Ihren Transport GegenstÀnde Angebot Ihr
20 Ihr FĂŒhrungs Coach Coach

10437
Berlin
Als Wirtschaftspsychologin begleite ich Sie auf Ihrer Reise zur persönlichen und beruflichen Weiterentwicklung. In meinen individuellen Coachings..
xn--ihr-fhrungs-coach-62b.de/ Cookie Lioba Name Coaching Eich Inhalte DatenschutzerklÀrung Ireland
21 Beiladung-in-Berlin Movers

10178
Berlin
Wir sind Ihr Beiladungs Experte in Berlin – auf unserer Seite finden Sie alles, was Sie fĂŒr..
beiladung-in-berlin.de/ Berlin Beiladung Umzug Ihren Transport GegenstÀnde Angebot Ihr
22 formlos Plastik Bildhauerei

10405
Berlin
Skulpturen, Formdesign, Malerei..
petergragert.jimdo.com Home BĂŒhnen Filmplastik Texte Seite Malerei Arbeiten Berlin
23 Transportheld.de Auto

12277
Berlin
Wir von Transportheld.de machen es Ihnen leichter, das Beste aus Ihren Reisen und Abenteuern zu machen. Wir..
transportheld.de/dachbox-mieten/ Du Cookie Dachbox Name Arial DatenschutzerklÀrung Berlin Helvetica
24 MĂŒller & Woschke UG Umzugsfirma

14167
Berlin
Bei umzug-berlin.de MĂŒller & Woschke UG erhalten Sie kostenlose und unverbindliche Umzugsangebote aus Berlin, nach Berlin und..
umzug-berlin.de Berlin Umzug Umzugsunternehmen MĂŒller Woschke Ihr Ihren Umzugsfirma
25 Privat- GeschÀfts- und Hypothekenkredite zu 2 FINANZIEREN

1000
Berlin
wellcometrustplc.com Loan Finance Business We Apply Management Us Bank
26 Umzugsunternehmen-Berlin.de Umzugsunternehmen

10117
Berlin
Um ein individuelles und maßgeschneidertes Umzugsangebot zu erhalten, wenden Sie sich an ein zuverlĂ€ssiges Umzugsunternehmen. Professionelle und..
umzugsunternehmen-berlin.de/ Berlin Umzug Umzugsunternehmen Kosten Wohnung Cookie UmzĂŒge Umzugsangebote
27 Aktion gegen den Hunger gGmbH Hilfsorganisation

10179
Berlin
aktiongegendenhunger.de Hunger Mio Aktion Unsere Menschen Spenden Nothilfe Osten
28 StudiBucht Ghostwriter Preise

10405
Berlin
studibucht.de/preise/ Ghostwriter Seite Eventrocket Preise Kosten Ghostwriting Promiset Rocket
29 Frieden UmzĂŒge UmzĂŒge

13357
Berlin
Frieden UmzĂŒge in Berlin ist Ihr kompetenter und verlĂ€sslicher Dienstleister fĂŒr UmzĂŒge in Berlin. Als selbststĂ€ndig gemachtes..
frieden-umzuege.de Sans Berlin UmzĂŒge Frieden Umzug Ihren Cuse Leistungen
30 Heid Immobilienbewertung Berlin SachverstÀndiger Immobiliengutachter Berlin Immobilienbewertung

12105
Berlin
Heid Immobilienbewertung Berlin, Ihr zuverlĂ€ssiger Partner fĂŒr wichtige Schritte wie den Kauf, Verkauf oder die Vererbung von..
heid-immobilienbewertung.de/berlin/ Berlin Immobilienbewertung Immobilie Immobiliengutachter SachverstÀndigen Unsere Gutachten Immobilien
31 kredite24-sofort.de Finanzen

10179
Berlin
Kredite24 Sofort ist bestrebt, die Finanzplanung fĂŒr jeden zu erleichtern. Unser Angebot an Krediten ist auf einfache..
kredite24-sofort.de/ Kredit Sofort Roboto Kredite Monate Rate Tipp Laufzeit
32 OneCareer GmbH Beratung

10719
Berlin
OneCareer - Deine Plattform fĂŒr beruflichen Aufstieg. In unserer Rolle als zertifizierter BildungstrĂ€ger fokussieren wir auf hochwertige Ausbildung..
onecareer.de/ Weiterbildung One Gmb Dein Partner Weiterbildungen Projektmanager Lehrgang
33 JOB POINT Berlin Arbeitsvermittlung

13587
Berlin
Das Berliner Projekt JOB POINT, unterstĂŒtzt durch die Senatsverwaltung fĂŒr Arbeit, Soziales, Gleichstellung, Integration, Vielfalt und Antidiskriminierung..
jobpoint-berlin.de/ Berlin Sans Arbeit Item Unternehmen Minijobs Menschen Job
34 Luftballons bedrucken lassen Luftballons

10179
Berlin
Luftballons bedrucken lassen - eine kreative Werbemöglichkeit, die fĂŒr jeden Anlass geeignet ist. Egal ob fĂŒr Events..
luftballons-bedrucken-lassen.de Luftballons Nutzen Werbung Events Messen AnlÀsse Drucken Designs
35 Rhetorik Trainer Berlin Rhetorik Trainer

12587
Berlin
Berlin ist nicht nur eine Stadt, sondern ein Schmelztiegel von Ideen, Kulturen und Visionen. Genau hier setzen..
rhetorik-trainer-berlin.de/ Rhetorik Cookie Berlin Name Trainer DatenschutzerklÀrung Kamera Zweck
36 AdsXpress GmbH - Google & Amazon Online Marketing

10587
Berlin
Unser Team versteht die besonderen BedĂŒrfnisse von Einsteigern ins Online Business, kleinen und mittleren Unternehmen (KMUs) und..
adsxpress.de/ Ads Google Kampagnen Amazon Ihr Team Preis Partner
37 Loehn Digital Webdevelopement

13156
Berlin
loehn-digital.com/ Wiedergabeliste Datei Bild Quelle Audio Online Video Ads
38 fĂŒhrerschein kaufen 400 euro Driving Licence

10119
Berlin
Unsere Erfahrung Mit stolzen 15 Jahren Erfahrung haben wir uns als Anlaufstelle fĂŒr Menschen etabliert, die einen legalen..
xn--fhrerschein72-wob.com/ Top Header Sliding FĂŒhrerschein Action Side Klasse Footer
39 Meet your Writer Bildung

12105
Berlin
Meet your Writer ist eine Plattform, auf der akademische Ghostwriter und Auftraggeber:innen erstmals direkt aufeinandertreffen. Keine anonyme..
meet-your-writer.com Wissenschaftliche Arbeit Such Ghostwriter Direkter Kontakt Agentur
40 LB Detektive GmbH · Detektei Berlin Detektei

10707
Berlin
LB Detektive GmbH · Detektei Berlin · Privatermittler: Ihr Ansprechpartner im Bereich Privatermittlungen, Detektivdienste und UnternehmensaufklÀrung. Wir..
lb-detektei.de/detektei/berlin.html Berlin Detektei Cookie Detektive Abhörschutz Lauschabwehr Partner Google
41 Individuelle Berlin Stadtrundfahrten fĂŒr Gruppen Berlin Berlin

12167
Berlin
Hochwertige, individuelle Panorama Berlin Stadtrundfahrten zum Wunschtermin; perfekt fĂŒr kleine und große Gruppen. Qualifizierte Berliner GĂ€stefĂŒhrer StadtfĂŒhrer..
berlin-stadtrundfahrt-online.de Berlin Berliner Stadtrundfahrt City StadtfĂŒhrungen Tour Stadtrundfahrten StadtfĂŒhrung
42 ErfolgsStories Medienunternehmen

10707
Berlin
Das Magazin fĂŒr inspirierende Erfolgsgeschichten und wegweisende Projekte. Tauchen Sie ein in die faszinierende Welt erfolgreicher Persönlichkeiten..
erfolgsstories.net Wochen Roboto Ups Medien Serif Start Personen Unternehmen
43 Umzugsfirma Rauch Umzug &

16321
Bernau bei Berlin
Umzugsfirma Rauch ist ein Spezialist fĂŒr Umzugsdienstleistungen in Brandenburg mit ĂŒber zehn Jahren Erfahrung. Sie bieten eine..
umzugsfirmarauch.de/ Condensed Umziehen Nitro Mutation Titel Eventnitro Vfor Ie
44 mama trattoria Berlin Westend Italienisches Restaurant

14052
Berlin
Entdecken Sie die moderne italienische KĂŒche im Herzen des Berliner Westends bei mama Trattoria am Theodor-Heuss-Platz 2...
mama.eu/mama-berlin-westend/ Cookie Name DatenschutzerklÀrung Anbieter Zweck Inhalte Laufzeit Akzeptieren
45 Top Schmuckgutachter Berlin Schmuckgutachter

10117
Berlin
Gutachten fĂŒr Schmuck durch zertifizierten SachverstĂ€ndigen in Berlin und Umgebung! Im Bereich Nachlass erstellen wir ĂŒber unser..
berlin-schmuckgutachter.de/ Berlin Schmuckgutachter Schmuck Netzer Gutachten Beratung Nicole Stefan
46 Bite Club Praxis fĂŒr KieferorthopĂ€die KieferorthopĂ€die

10437
Berlin
Meine Leidenschaft gilt Ihren Zähnen, genauer gesagt: deren Position. Denn je perfekter diese ist, desto gesünder sind..
bite-club.berlin/ Berlin Prenzlauer Berg Behandlung Club KieferorthopÀdie Kieferorthop Speicherung
47 Sebastian Klammer Grafikdesign Berlin Webdesign Grafikdesign

10407
Berlin
Vom Webdesign bis zum Branding: Gutes Design weckt Neugier – und verbindet. Zum Beispiel Sie und Ihre..
sebastian-klammer.de Grafikdesign Webdesign Sebastian Klammer Berlin Design Web Entwicklung
48 TORBAR Meier Herold Gastro GmbH Französisches Restaurant

10115
Berlin
Lieben Sie die gehobene französische KĂŒche? Haben Sie Lust auf einen Kurzurlaub in Frankreich? In unserer Brasserie..
torbar.berlin Blue Red If Berlin Get Torbarfunctiono Document French
49 Mehrere IT-affine Mitarbeiter AnfĂ€nger Quereinsteiger fĂŒr IT

88662
Überlingen
Aufgaben - Mit Begeisterung stĂŒrzt Du dich in Dein Selbststudium und lernst folgende Grundlagen: Linux (sicherer Umgang mit..
adora-plus.com/ Grey Red Orange Yellow Green Cyan Blue Purple
50 European Network Services GmbH Solartechnik Reparatur

16761
Hennigsdorf bei Berlin
European Network Services - Ihr ☀️Solar-Wechselrichter 🎯Spezialist Schnelle RĂŒckmeldungen. GĂŒnstige Optionen. PV-Systeme im Fokus. Rasche Instandsetzung. Brands: SMA..
ens-group.eu/de Loin Cormorant Stylable Blog Kvo My Garamond Poppins
51 BFT Verpackungen GmbH Verpackungen

12681
Berlin
BFT Verpackungen ist ein Unternehmen, das Verpackungen fĂŒr B2B-Unternehmen vertreibt. Wir bieten Doypacks, Druckverschlussbeutel, Kaffeeverpackungen, Flachbeutel, Versandtaschen..
bft-verpackungen.de/ Html Standbodenbeutel Doypack Kraftpapier Ventil Google Flachbodenbeutel Informationen
52 BFT Verpackungen GmbH Verpackungen

12681
Berlin
BFT Verpackungen ist ein Unternehmen, das Verpackungen fĂŒr B2B-Unternehmen vertreibt. Wir bieten Doypacks, Druckverschlussbeutel, Kaffeeverpackungen, Flachbeutel, Versandtaschen..
bft-verpackungen.de/ Html Standbodenbeutel Doypack Kraftpapier Ventil Google Flachbodenbeutel Informationen
53 YAP you are perfect. Friseur AVEDA

10245
Berlin
Friseur/ Stylist/ Make Up/ Hairdresser/ Hochsteckfrisuren/ Farbtechniken/ Balayage/ Damen/ Herrn/ Kreativ/ Alternativ/ Klassisch/ Dauerwelle/ Esprit/ Friedrichshain/ Charm/..
y-a-p.de Deiner Dich Du Deinen Dir Ajax Termin Content
54 Legal Anabolika Apotheke

10785
Berlin
Legal Anabolika ist ein angesehener Online-Shop fĂŒr Steroide in Deutschland. Der Hersteller ist seit ĂŒber einem Jahrzehnt..
legaleanabolika.com/ Testosteron Steroide Trenbolon Peptide Injektionen Kurse Anabolika Steroid
55 Produktfotograf aus Berlin Produktfotografie

12249
Berlin
Willkommen bei Produktfotografie Berlin. Wie der Name es schon sagt, sind wir Ihre Agentur rund um das Thema..
produktfotografieberlin.de Helvetica Stylable Blog Portfolio Ke Objectassign Ba Page
56 about:dents - Praxis fĂŒr Zahnmedizin Zahnarzt

10409
Berlin
Schöne ZÀhne sind unser AushÀngeschild. Ein schönes LÀcheln zieht an und bleibt im GedÀchtnis, ob in der..
about-dents.de Praxis Team LĂ€cheln Date Termin Behandlung Uhr Zahnmedizin
57 Hotel ChĂąteau Royal Berlin Hotel

10117
Berlin
chateauroyalberlin.com/de Royal Ch Hotel Zimmer Berlin Suiten Restaurant Mitte
58 Hercules Transporte UmzĂŒge

10997
Berlin
Das Möbeltaxi Berlin von Hercules Transporte hat sich auf den professionellen und zuverlÀssigen Kleintransport von Möbeln und..
moebeltaxi-berlin.com Transporte Berlin Möbel Hercules Möbeltaxi Transport Ihr Fsvg
59 SeniorenLebenshilfe Beate Rosner Seniorenbetreuung

16321
Bernau bei Berlin
Die SeniorenLebenshilfe ist bundesweit eins der ersten Unternehmen, die sich auf die vorpflegerische Betreuung spezialisiert haben. Wir..
seniorenlebenshilfe.de/lebenshelfer-brandenburg/lebenshelferin-beate-rosner/ Live Bitte Senioren Pflichtfeld Anfrage Applying Mail Berlin
60 Zahnarztzentrum am Wittenbergplatz Zahnarzt

10789
Berlin
Das Zahnarztzentrum am Wittenbergplatz in Berlin Schöneberg bietet Ihnen eine umfassende Palette von zahnmedizinischen Leistungen. Ob konventionelle..
zahnarzt-berlin-wittenbergplatz.de Wittenbergplatz Infos Zahnspange Prophylaxe Behandlung Zahnimplantate Narkose Zahnarzt
61 qoq.me Soyiale Medien

95128
Berlin
santana row. san jose. ca 300
62 Aslan Ambulanter Pflegedienst GmbH Pflegedienst

12049
Berlin
Aslan-Pflege ist hier, um Ihnen zu helfen. Wir bieten einen glĂŒcklichen und gepflegten Pflegedienst in Berlin. Seit..
aslan-pflege.de/ Berlin Sans Rotate Fade Blur Zoom Pflegedienst Pflege
63 Umzugskracher Berlin-Tiergarten UmzĂŒge

10551
Berlin
Sie wĂŒnschen sich ein professionelles Umzugsunternehmen in Tiergarten-Berlin, der Ihre Einpack-, Transport, und Montageaufgaben ĂŒbernimmt? Das Team..
umzugskracher.de/berlin-tiergarten/ Montserrat Berlin Tiergarten Angebot Font Awesome Free Umzug
64 Umzugskracher Berlin-Kreuzberg UmzĂŒge

10967
Berlin
Sie planen einen Umzug und benötigen dafĂŒr ein erfahrenes Umzugsunternehmen in Berlin-Kreuzberg? Dann sind Sie bei Umzugskracher..
umzugskracher.de/berlin-kreuzberg/ Montserrat Berlin Angebot Font Awesome Free Umzug GĂŒnstiges
65 Butler UmzĂŒge UmzĂŒge

10315
Berlin
Butler UmzĂŒge ist ein renommiertes Umzugsunternehmen, das seit mehr als Jahrzehnten in Berlin, Deutschland, tĂ€tig ist. Unsere..
butler-umzuege.de/ Berlin Umzug UmzĂŒge Butler Umzugsunternehmen Ihr Kosten Ihren
66 RSG Register Solutions gGmbH Medizin Software

10623
Berlin
RSG Register Solutions gGmbH: Ihr Wegbereiter fĂŒr die Einrichtung von Medizinischen Registern und die Entwicklung von Patientenbefragungen..
register-solutions.de Page Not Found Segoe Emoji Noto Sans Color
67 BAS Business And Science GmbH Ghostwriting

10623
Berlin
Die BAS Business And Science GmbH ist eine Ghostwriting-Agentur aus Berlin. Sie vermittelt promovierte Ghostwriter, Coaches &..
business-and-science.de/ Science And Helvetica Not Prefetchable Ghostwriter Agentur Business
68 securyx.eu - Ihr Highspeed Computer und Computer Service

13125
Berlin
Ihr Highspeed Service Ihre alltÀglichen Computerprobleme sind unser Metier. Wir garantieren schnelle und unkomplizierte Hilfe. In unserer..
securyx.eu Start Computer Service Fsys Fcm Fpreset Fsvg Bxml
69 Geabcon Group GmbH & Co. GebÀudereinigung GebÀudereinigung

10707
Berlin
Die GeAbCon-Gruppe ist der richtige Partner, wenn es um GebĂ€udereinigung geht. Seit ĂŒber einem Jahrzehnt kĂŒmmern wir..
gebaeudereinigung-geabcon-group.de/ Berlin GebÀudereinigung Unterhaltsreinigung Group Ihr Ge Reinigung Font
70 Freelancer in Berlin werden Freiberufler

13589
Berlin
Die Freiberufler-Plattform Tiejet in Berlin bietet Freiberuflern in der Stadt eine Plattform, auf der sie ihre FĂ€higkeiten..
tiejet.com Services Design Browse Business Writing Marketing Translation Video
71 Cubepools GmbH SchwimmbÀder Erholungs-

12103
Berlin
Cubepools ist ein fĂŒhrendes Unternehmen, das sich auf die Produktion hochwertiger modularen Pools spezialisiert. Seit 2018 sind..
poolcontainers.de/ Pools Pool Container Schwimmbecken Skin Tone Transport Montage
72 Turbeleuchtung Automotive

13407
Berlin
Erleben Sie die neueste Technologie mit unserer 3D LED TĂŒrbeleuchtung Auto Logo. Perfekt fĂŒr jedes Auto, um..
turbeleuchtung.de/ Cg TĂŒrbeleuchtung Logo Csvg Audi Cpath Mercedes Product
73 FĂŒhrerschein Kaufen - FĂŒhrerschein BĂŒro FĂŒhrerschein

10178
Berlin
FĂŒhrerschein online kaufen vom FĂŒhrerschein BĂŒro, der von den Behörden registriert und legal ausgestellt wird, ohne dass..
xn--fhrerscheinbro-gsbl.de/ FĂŒhrerschein Citalic BĂŒro Informationen Behörden PrĂŒfung Kaufen Kunden
74 catering Gastronomie

10627
Berlin
grannysmithcatering.de Granny Vegan Catering Bowl Smith Spaghetti Service The
75 Coolshiftknobs Automotive

10177
Berlin
Coolshiftknobs bietet mehr als 1000 qualitativ hochwertige Schaltknauf Tuning Produkte. Sie können aus Hunderten von Optionen fĂŒr..
de.coolshiftknobs.com/
76 MTS UmzĂŒge Berlin Umzugfirma

13359
Berlin
Bei uns erhalten Sie alles aus einer Hand: vom passenden Möbelwagen bis zum Umzugsmaterial in Berlin –..
mts-umzug-berlin.de/ Berlin UmzĂŒge Umzug Angebot Umzugsunternehmen Montserrat Umzugsangebot Sachen
77 Berlin-Beiladung Umzug &

13187
Berlin
Willkommen bei Beiladung-Berlin, Ihrem zuverlĂ€ssigen Partner fĂŒr kostengĂŒnstige und umweltfreundliche Transportlösungen in Berlin und Umgebung. Wir spezialisieren..
berlin-beiladung.de
78 Belim Rohr 24 ROHRREINIGUNG

10367
Berlin
Belimrohr24 ist ein professionelles Unternehmen, das sich auf die effiziente Lösung von Kanalisations- und Abflussproblemen spezialisiert hat...
belimrohr24.de/ Eventrocket Rohrreinigung Berlin Notdienst Csvg Belim Rocket Datenow
79 Sanrotech Rohrreinigung Berlin & Abwassertechnik Rohrreinigung &

10997
Berlin
Kundenvorteile auf einen Blick: - GĂŒnstiges Angebot - Unverbindliches Angebot - Anfahrtfrei - 100% Preistransparenz - Versicherungsfreundlich Das macht uns einmalig in ganz..
sanrotech.de Berlin Dein Experte Rohrverstopfung KĂŒche Keller Bad Serviceprinzip
80 Statistik Beratung & Nachhilfe - Explain Bildung

10625
Berlin
Mit meiner weitreichenden Expertise in der angewandten Statistik und zahlreichen erfolgreich abgeschlossenen Datenauswertungen & Statistik Beratungen stehe..
statistikberatung.eu Statistik Datenauswertung Beratung Daten Section Unternehmen Zeichen Portfolio
81 Pflegezentrum Rohmich Pflegezentrum

12459
Berlin
Am Anfang stehen viele Fragen. Gemeinsam mit Ihnen entwickeln wir individuelle und vielfÀltige Betreuungslösungen. Ob Grundpflege, hauswirtschaftliche..
pflegezentrum-rohmich.de/ Rohmich Pflege Pflegedienst Berlin Ihr Versorgung Leistungen Karriere
82 Familientherapie und Beratung nach Jesper Juul Heilpraktikerin FĂŒr

12203
Berlin
beratungspraxis-simpson.de Jesper Juul Inhalte Berlin Therapie Corinna Simpson Familientherapie
83 ForTomorrow gGmbH Klimaschutz

10969
Berlin
Wir sind ForTomorrow, ein gemeinnĂŒtziges Klimaschutz-Unternehmen aus Berlin. Du kannst mit uns CO2 ausgleichen. Wir kompensieren CO2-Emissionen..
fortomorrow.eu Emissionsrechte Klima Abo Klimaschutz Deutschland BĂ€ume For Emissionen
84 SĂ€uglingsbehandlung Ergotherapie

12555
Berlin
Wir bieten Ihnen und Ihrer Familie unseren Schwerpunkt der SÀuglings- und Kleinkinderbehandlung nach IntraActPlus bei Regulationsstörungen, Ess-..
ergotherapie-koepenick.de Fredersdorf Köpenick Timmer Praxis Tel Cookie Ergotherapie Auswahl
85 AD AGENDA Kommunikation und Event GmbH Event- und

12489
Berlin
Als inhabergefĂŒhrte Event- und Kommunikationsagentur fĂŒr dynamische und schlanke Kommunikation stehen wir seit ĂŒber 25 Jahren unseren..
ad-agenda.com Sans Event Kommunikation Home Shopping Gmb Brooklyn Cardo
86 Relaxmaxx – Individuelle Werbemittel mit Wunschmotiv Werbemittel -

12489
Berlin
Begeistern Sie Ihre Kunden und GĂ€ste mit individuellen LiegestĂŒhlen fĂŒr Ihr Unternehmen. Entdecken Sie die einzigartigen Holz-LiegestĂŒhle..
relaxmaxx.com Sans Event Kommunikation Home Shopping Gmb Brooklyn Cardo
87 zielgruppe kreativ | Gesellschaft fĂŒr Marketing Werbe- Kommunikations-

12489
Berlin
Unsere inhabergefĂŒhrte Agentur befindet sich mitten im pulsierenden Berlin. Wir sind spezialisiert auf glĂ€nzende Designs, wasserdichte Brandings..
zielgruppe-kreativ.com Not Prefetchable Zielgruppe Nitro Mutation Werbeagentur Eventnitro Vfor
88 Resilienztraining Alexandra Reimann Coach &

12163
Berlin
Mein Name ist Alexandra Reimann, seit 10 Jahren bin ich als Trainerin und Coach tÀtig und habe..
resilienztraining.online Reimann Resilienztraining Resilienz FĂŒhrungskrĂ€fte Training Alexandra Roboto Condensed
89 myroom24 GmbH Buchungsplattform FĂŒr

10789
Berlin
myroom24.com bietet die besten LangzeitunterkĂŒnfte wie Hotels, Serviced Apartments und gewerbliche UnterkĂŒnfte ab 1 Monat an, um..
myroom24.de UnterkĂŒnfte Unterkunft Apartment Kurz Einstellungen Hotels Apartments Hostels
90 Praxis fĂŒr Einzel- und Paartherapie Psychologen &

12049
Berlin
Einzel- und Paartherapie auf Deutsch, Englisch und Spanisch..
pablo-corbalan.com/ Loin Objectassign Ba Booking Bookings Agcgu Stylable Kcp
91 ErklÀrhelden - Die ErklÀrvideo Agentur in Videoproduktion

10115
Berlin
Unter ErklÀrhelden GbR agiert eine ErklÀrvideo Agentur aus Berlin, die sich darauf spezialisiert hat, animierte ErklÀrfilme..
erklaerhelden.de/ ErklÀrvideo Erkl Ihr ErklÀrvideos Was Grafiken Cookie Vorteile
92 Online Broker Börse

13053
Berlin
Im Zeitalter des Internets treffen immer mehr Kapitalanleger ihre Entscheidungen selbststÀndig. Denn der Online-Handel ist bequem, da..
brokerpoint.de Online Broker Brokerpoint Depot Coaching Aktien Börsen Konto
93 SchnittDienst CAD Schnittkonstruktion Bekleidung

10247
Berlin
CAD Schnittkonstruktion - in den Bereichen DOB / HAKA / KIKO. - Schnittmuster digitalisieren und gradieren - Erarbeitung vom..
schnittdienst.com Schnittdienst Schnitt Jahren Schnittkonstruktion Kostas Murkudis Beate Christoph
94 RWG GebÀudereinigung Berlin GebÀudereinigung

13503
Berlin
Unsere Reinigungsfirma Berlin ist bereits seit mehreren Jahrzehnten im Bereich der GebÀudereinigung tÀtig und hat sich einen..
rwg-gebaeudereinigung-berlin.com/ Berlin GebÀudereinigung Reinigungsfirma Unsere Geb Sauberkeit Helvetica Arial
95 24h PCR Test Express & Schnelltest Corona Testzentrum

10707
Berlin
24h PCR Express Test & Schnelltest Corona Testzentrum Berlin Wilmersdorf. FĂŒr alle LĂ€nder/FlĂŒge geeignet. Ergebnis am gleichen..
coronaspot.de Stylable Poppins Barlow Bold Objectassign Ba Italic Booking
96 Tanja Bögner Business-Coaching

13467
Berlin
Mein Name ist Tanja Bögner, ich bin Personal & Business Coachin. Ich biete Ihnen zielgerichtete Seminare..
tanjaboegner.de Assistenz Store Sans Pro Tanja Is Open Bögner
97 RWG GebÀudereinigung Berlin GebÀudereinigung

13503
Berlin
Wir sind seit 1994 fĂŒr die Sauberkeit zahlreicher Objekte im Rahmen der GebĂ€udereinigung, Unterhaltsreinigung, Glas- und Fensterreinigung..
rwg-gebaeudereinigung-berlin.com/ Berlin GebÀudereinigung Reinigungsfirma Geb Fensterreinigung Unterhaltsreinigung Sauberkeit Helvetica
98 TSM - Lauschabwehr & Abhörschutz Dienstleistung

10318
Berlin
Die TSM – Lauschabwehr & Abhörschutz ist ein renommierter Spezialist im Bereich Sicherheitsdienstleistungen, der sich insbesondere auf..
tsm-lauschabwehr.de/ Lauschabwehr PrivatsphÀre Abhörschutz Security Management Daten Anforderungen Lösungen
99 Svea Carstensen Coaching

10627
Berlin
Als Frau wissen wir, dass das Leben manchmal, wie eine Achterbahn sein kann, mit Höhen und Tiefen..
sveacarstensen.de/ Coaching Grey Red Orange Yellow Green Cyan Blue
100 Scout UmzĂŒge & Transporte Umzugsunternehmen

10553
Berlin
Bei UmzĂŒgen und Transporten sind wir Ihr zuverlĂ€ssiges Umzugsunternehmen in Berlin und der nĂ€heren Umgebung. Unsere Dienstleistungen..
scout-umzug.de/ UmzĂŒge Berlin Umzug Umzugsunternehmen Scout Citalic Besichtigung Umzugshelfer
101 Scout UmzĂŒge & Transporte Umzugsunternehmen

10553
Berlin
Bei UmzĂŒgen und Transporten sind wir Ihr zuverlĂ€ssiges Umzugsunternehmen in Berlin und der nĂ€heren Umgebung. Unsere Dienstleistungen..
scout-umzug.de/ UmzĂŒge Berlin Umzug Umzugsunternehmen Scout Citalic Besichtigung Umzugshelfer
102 Praxis fĂŒr PhysioTherapie Pavlos Tsanidis Physiotherapie

10969
Berlin
KG-Krankengymnastik KG-ZNS Krankengymnastik nach Bobath MLD- Manuelle Lymphdrainage WP/WT-WĂ€rme-, KĂ€ltetherapie ET-Elektrotherapie US-Ultraschall WĂ€rme Kinesiotape KMT-Klassische Massage Therapie BGM-Bindegewebsmassage Segmentmassage Atemtherapie Osteopathischer Konzept Faszienbehandlung GGW Training Gleichgewicht Ihre Gesundheit steht..
physiotherapie-tsanidis.de Physiotherapie Pavlos Tsanidis Praxis Gitschiner Str Berlin Tel
103 Textagentur Schachmatt Textagentur

13407
Berlin
Eine Bachelorarbeit ist der erste große Schritt in Ihrer akademischen Karriere. Eine qualitativ hochwertige Arbeit ist entscheidend..
grow-consulting.de/lektorat-bachelorarbeit Bachelorarbeit Lektorat Helvetica Arial Lucida Daten Einwilligung Website
104 Karos Wedding Vibes Hochzeitsplaner

10405
Berlin
Karos Wedding Vibes steht fĂŒr individuelle und charakteristische Hochzeitsplanung. Sie suchen noch einen Hochzeitsplaner Berlin mit Expertise..
karosweddingvibes.de/ Cuse Ahref Berlin Fsvg Hochzeitsplanung Hochzeitsplaner Fwwwworg Cl
105 ÜbersetzungsbĂŒro Front Runner Berlin ÜbersetzungsbĂŒro Dolmetscher

10249
Berlin
ÜbersetzungsbĂŒro Front Runner Berlin – Wir bringen die Message rĂŒber. Das ÜbersetzungsbĂŒro Front Runner Berlin ĂŒbersetzt, lektoriert und..
front-runner.de/uebersetzungsbuero-berlin-englisch Beglaubigte Berlin Deutsch Englisch Google Französisch Daten Spanisch
106 Fliesenprofi Berlin Fliesenprofi

10243
Berlin
Als Fliesenleger in Berlin habe ich mich auf die professionelle Installation und Reparatur von verschiedensten Fliesenarten spezialisiert..
fliesenprofi-berlin.de/ Cuse Berlin Lucida Not Prefetchable Helvetica Sans Umgebung
107 TĂŒrbeleuchtung Auto

13407
Berlin
Erleben Sie die neueste Technologie mit unserer 3D TĂŒrbeleuchtung Auto Logo. Perfekt fĂŒr jedes Auto, um einen..
turbeleuchtung.de/ Cg TĂŒrbeleuchtung Cpath Csvg Logo Audi Sans AusfĂŒhrung
108 ÜbersetzungsbĂŒro Front Runner Berlin ÜbersetzungsbĂŒro Dolmetscher

10249
Berlin
ÜbersetzungsbĂŒro Front Runner Berlin – Wir bringen die Message rĂŒber. Das ÜbersetzungsbĂŒro Front Runner Berlin ĂŒbersetzt, lektoriert und..
front-runner.de/uebersetzungsbuero-berlin-englisch Beglaubigte Berlin Deutsch Englisch Google Französisch Daten Spanisch
109 WirDÀmmenDeinHaus.com HÀuserdÀmmung EinblasdÀmmung

10997
Berlin
Dein Partner fĂŒr EinblasdĂ€mmung in Berlin. Egal ob Einfamilienhaus oder Immobilienportfolio, egal ob DachdĂ€mmung oder KerndĂ€mmung im..
wirdaemmendeinhaus.com Website Cookie EinblasdÀmmung Informationen Dich Haus DÀmmung Wir
110 Flora Studio Wei & Klein GbR Kunstpflanzen

10117
Berlin
Herzlich Willkommen bei Flora Studio, Ihrem Onlineshop fĂŒr Kunstpflanzen. Bei uns finden Sie eine große Auswahl an..
kunstpflanze.de Kunstpflanzen KĂŒnstliche KunstbĂ€ume Dateget Alle Studio Kunstblumen Shop
111 BuBiBag SitzsÀcke Online

12277
Berlin
FĂŒr Kinder, Jugendliche und Erwachsene stellt BuBiBag eine große Auswahl an SitzsĂ€cken, Palettenkissen, Dekokissen und Kissen her...
bubibag.de/ Sans Sitzsack Schwarz SitzsÀcke Product List Bu Rechteck
112 Abschied und Aufbruch Trauer

14057
Berlin
FĂŒr den Abschied und fĂŒr den Aufbruch biete ich Ihnen meine Begleitung an: Wenn Sie zu fassen..
abschiedundaufbruch.de Aufbruch Leben Abschied Lebensberatung Trauerbegleitung Trauerrednerin Himmel Zeiten
113 Vitrotrade BV Gesundheit

10117
Berlin
Wir bei Vitrotrade BV wissen, wie wichtig Schnelligkeit und Genauigkeit sind, wenn es um HIV-Tests geht. Deshalb..
hivtestkaufen.de/ Test Tests Ergebnis Hause Infektion Schnelltest Ergebnisse Antikörper
114 Ruslan Goryukhin Foundation fĂŒr Wissenschaft Forschung Stiftung

10623
Berlin
Zweck der Gesellschaft ist die Förderung: der Wissenschaft und Forschung (§ 52 Abs. 2 Nr. 1 AO)..
115 Extremer Bikini Extremer Bikini

10178
Berlin
Sunnybikinis mit Sitz in China ist eine Bademodenmarke, die seit 2015 Bikinis entwirft, herstellt und online verkauft...
sunnybikinis.com/de-de/collections/extreme-bikinis Bikini China Sunnybikinis Organization Offer Produkte Badeanzug Stil
116 Etman UmzĂŒge Umzugsunternehmen

10117
Berlin
#1 Umzugsunternehmen Berlin! Bei uns erhalten Sie alles aus einer Hand: vom passenden Möbelwagen bis zum Umzugsmaterial in..
etman-umzuege.de/ Berlin Umzug Du Angebot UmzĂŒge Dich Umzugsunternehmen Minuten
117 Umzug Max Moving Service

16321
Bernau bei Berlin
#1 Umzugsunternehmen Bernau bei Berlin! Bei uns erhalten Sie alles aus einer Hand: vom passenden Möbelwagen bis zum..
helmut-schmidt-allee 14b
118 Umzug Max Moving Service

16321
Bernau bei Berlin
#1 Umzugsunternehmen Bernau bei Berlin! Bei uns erhalten Sie alles aus einer Hand: vom passenden Möbelwagen bis zum..
helmut-schmidt-allee 14b
119 Umzug Max Moving Service

16321
Bernau bei Berlin
#1 Umzugsunternehmen Bernau bei Berlin! Bei uns erhalten Sie alles aus einer Hand: vom passenden Möbelwagen bis zum..
helmut-schmidt-allee 14b
120 GOING PUBLIC! Akademie fĂŒr Finanzberatung AG Weiterbildung

10965
Berlin
Die GOING PUBLIC! Akademie fĂŒr Finanzberatung AG ist ein spezialisierter Partner fĂŒr Weiterbildung in der Finanz-, Versicherungs-..
akademie-fuer-finanzberatung.de Online Weiterbildung Finanzberatung Ich Going Akademie Weiterbildungszeiten Finanzbranche
121 Die Nr. 1 Umzugsfirma aus Berlin Umzug

10559
Berlin
Maßgeschneiderte Umzugslösungen: Unser professionelles Umzugsunternehmen Wenn es um Ihren Umzug in Berlin geht, sind wir Ihr verlĂ€sslicher Partner..
mueller-umzugsfirma-berlin.de Berlin Umzug Umzugsfirma Familienunternehmen Ihren UmzĂŒge Vertrauen Unser
122 SperrmĂŒllmeister Berlin | SperrmĂŒll & Wohnungsauflösung Haushaltsauflösungen

10715
Berlin
Die SperrmĂŒllmeister Berlin sind ein professioneller EntrĂŒmpelungs- und SperrmĂŒlldienst, der seinen Service sowohl an private als auch..
sperrmuell-berlin.de SperrmĂŒll Berlin SperrmĂŒllabholung Entsorgung Abholung Fsvg Ihren SperrmĂŒllentsorgung
123 CleanClimb Seilzugangstechnik Glasreinigung

13053
Berlin
Willkommen auf Clean Climb Berlin, Ihr Spezialist fĂŒr Arbeiten in der Höhe. Mit Hilfe von Seiltechniken erreichen..
cleanclimb-h%c3%b6henarbeiten.de
124 moebeltransport-in-berlin.de Möbeltransport In

10623
Berlin
Möbeltransport Berlin: Experte #1 Contact us: https://www.moebeltransport-in-berlin.de/ info@moebeltransport-in-berlin.de +4915792604200 Credit Card, Cash, Bank Transfer Mo-Su. 7.00 - 22.00 Wir sind Ihr Möbeltransport Experte in..
moebeltransport-in-berlin.de/ Berlin Möbeltransport Transport Möbel Möbeltaxi Ihren Ihr Angebot
125 moebeltransport-in-berlin.de Möbeltransport In

10623
Berlin
Möbeltransport Berlin: Experte #1 Contact us: https://www.moebeltransport-in-berlin.de/ info@moebeltransport-in-berlin.de +4915792604200 Credit Card, Cash, Bank Transfer Mo-Su. 7.00 - 22.00 Wir sind Ihr Möbeltransport Experte in..
moebeltransport-in-berlin.de/ Berlin Möbeltransport Transport Möbel Möbeltaxi Ihren Ihr Angebot
126 moebeltransport-in-berlin.de Möbeltransport In

10623
Berlin
Möbeltransport Berlin: Experte #1 Contact us: https://www.moebeltransport-in-berlin.de/ info@moebeltransport-in-berlin.de +4915792604200 Credit Card, Cash, Bank Transfer Mo-Su. 7.00 - 22.00 Wir sind Ihr Möbeltransport Experte in..
moebeltransport-in-berlin.de/ Berlin Möbeltransport Transport Möbel Möbeltaxi Ihren Ihr Angebot
127 Motorcycle Screens Auto

10178
Berlin
Unsere Firma ist spezialisiert auf Motorrad-Windschutzscheiben, Windschilder fĂŒr MotorrĂ€der und Windabweiser, die das VergnĂŒgen beim Rennen sowie..
motorcyclescreens.eu/de/ Windschutzscheiben Motorrad Windschilder Windabweiser Motorcycle Artikel Windschutzscheibe Weiter
128 eGora GmbH Versandhandel

10707
Berlin
Das Berliner Unternehmen egora betreibt einen Online-Marktplatz, auf dem lokale GeschÀfte aus der Stadt ihre einzigartigen Angebote..
egora.online/ Show Unsere Lieferung Produkte Hause Kategorien HĂ€ndler Lokale
129 Pflegedienst Helppy GmbH Ambulante Pflegedienste

10179
Berlin
Helppy ist ein moderner hĂ€uslicher Pflegedienst, dem neben der optimalen Betreuung von Senioren auch die BedĂŒrfnisse der..
helppy.de/ Helppy Senioren Helpper Pflegedienst Berlin Angehörigen Hause Hilfe
130 Klassik UmzĂŒge - Umzug Berlin Umzug

12681
Berlin
Gern stehen wir Ihnen fĂŒr Ihr Umzugsvorhaben zur VerfĂŒgung. Ob Umzug innerhalb Berlins, deutschlandweit oder in die..
klassik-umzuege.berlin Berlin UmzĂŒge Umzug Klassik Umzugsunternehmen Berliner Preis Ihr
131 Umzugskracher Umzug

13599
Berlin
Beim Umzug stehen meist die Organisation und eine besonders gut strukturierte Vorbereitung im Vordergrund. Ein Umzug im..
umzugskracher.de/ Sans Berlin Not Prefetchable Umzugskracher Umzugsunternehmen Umzugsfirma GĂŒnstige
132 Chroma Online Druckerei Druckerei

10719
Berlin
CHROMA ist eine Online-Druckerei, die auf ModernitĂ€t, Schnelligkeit und QualitĂ€t setzt. 👉 Online bestellen 👉 Kostenloser Canva Produktdesigner 👉 Wir..
chromadruckerei.de/de Countries Chroma Subscription Du Notifyne Product Produkt Front
133 BFKV UG (haftungsbeschrÀnkt) Versicherungsmakler

12689
Berlin
Umfangreiche Onlineberatung oder persönlich vor Ort in Berlin von Versicherungsmakler...
berlinfinanz.com Versicherungen Berlin Ver Profil Versicherungsmakler Kredite Euch Kredit
134 Zumera Group GmbH Unternehmensberatung

10719
Berlin
Zumera ist ein fĂŒhrendes M&A-Beratungsunternehmen mit internationalem Fokus. Zumera bietet mittelstĂ€ndischen Unternehmen eine umfassende Beratung in allen..
zumera.com/de/home/ Unternehmen Kunden Branche Deutschland Investoren Markt Netzwerk Nachfrage
135 Zinkernagel - Balance In Motion Personal Trainer

14059
Berlin
Mein Name ist Marc Zinkernagel, seit ĂŒber 21 Jahren bin ich selbststĂ€ndiger Personal Trainer & High Performance..
zinkernagel.net Marc Training Ich Personal Trainer Zinkernagel Coach Monaten
136 MDL Unternehmensgruppe Reinigungsfirma

10707
Berlin
Ihre Immobilie benötigt eine professionelle Hand, welche sie professionell und hochwertig sÀubert? Wir von der MDL Group..
mdl-group.de/ Borlabs Group Eventrocket Berlin Awesome Reinigungsfirma Symbol Unternehmensgruppe
137 Bling Services GmbH Finanzen

10967
Berlin
Die Bling Card und die zugehörige App von Bling helfen Familien dabei, ihren Kindern den Umgang mit..
bling.de/ Bling App Karte Kinder Trustpilot Geld Taschengeld Google
138 Katro Bau GmbH Bauunternehmen

10779
Berlin
Bauunternehmen in Berlin, Potsdam und Brandenburg. Von der Altbausanierung bis zum schlĂŒsselfertigen Bauen, Badmodernisierung und Heizungsbau –..
katrobau.de Bau Berlin Gmb Katro Brandenburg Leistungen Badmodernisierung Bauunternehmen
139 Olymp-Bau Fußbodenleger

12309
Berlin
Trockenbau und Innenausbau mit Rigipsplatten, Dachausbau Sonstige Arbeiten an WÀnden und InnenrÀumen Decken abhÀngen, Zwischendecken einziehen DÀmmarbeiten, WÀrmedÀmmung von Decken Sonstige..
youtu.be/xfowefs1vae
140 MO45LEGAL - Bschorr | Warneke | RechtsanwÀlte und

10629
Berlin
Willkommen bei MO45LEGAL - unsere Notariats- und Anwaltskanzlei im Immobilien- und Gesellschaftsrecht. Wir beraten ĂŒberregional, im Interesse..
mo45.de Bschorr Warneke Sukowski Michael Ch Ulrike Martin Mandanten
141 Olymp-Bau Fußbodenleger

12309
Berlin
Trockenbau und Innenausbau mit Rigipsplatten, Dachausbau Sonstige Arbeiten an WÀnden und InnenrÀumen Decken abhÀngen, Zwischendecken einziehen DÀmmarbeiten, WÀrmedÀmmung von Decken Sonstige..
142 Umzugshelfer Berlin ➡ ️ ab 46€ Umzugshilfe Berlin

10559
Berlin
Umzugshelfer Berlin Umzugshilfe Berlin bietet professionelle Umzugshelfer zu gĂŒnstigen Umzugskosten an. ✅ Professionelle Umzugshelfer mit jahrelanger Erfahrung ✅..
berlin-umzugshilfe.de/ Borlabs Umzugshilfe Berlin Umzugshelfer Umzug Helfer Cookie Unsere
143 Umzugshelfer Berlin ✔ ️ Umzug mit Umzugshelfer Berlin

10719
Berlin
STUDENTEN-UMZUG.BERLIN – PROFESSIONELLE UMZUGSHELFER IN BERLIN HERZLICH WILLKOMMEN BEI STUDENTEN UMZUG BERLIN Sie suchen zuverlĂ€ssige Studentische Umzugshelfer in Berlin?..
studenten-umzug.berlin/ Defaults Berlin Umzug Umzugshelfer Studenten Ihren Umzugsfirma Angebot
144 Olymp UmzĂŒge Umzug SperrmĂŒll

12309
Berlin
Sehr geehrte Damen und Herren, wir sind ein kleines, Familienunternehmen mit langjÀhriger Branchenerfahrung und freuen uns, Ihnen..
145 Search & Train Unternehmensberatung Unternehmensberatung

13086
Berlin
Die Search & Train Unternehmensberatung fĂŒhrt seit 2007 ganzheitliche Beratungsleistungen in der gesamten D-A-CH Region fĂŒr Mittelstandsunternehmen..
searchandtrain-unternehmensberatungberlin.de/ Seminare Insights Unternehmensberatung Berlin Cookie Unternehmen Informationen Inhalte
146 Rick SchĂŒtze Moderation Event Moderation

12507
Berlin
Gemeinsam bringen wir ihr Event zum Erfolg. Rick SchĂŒtze ist professioneller Event Moderator, der ihrem Event das..
rick-schuetze.com Cookie Moderator Name Moderation DatenschutzerklÀrung Ihr Ireland Informationen
147 Volker Maria Maier Lichtkuenstler

16341
Panketal bei Berlin
Volker Maria Maier bietet einzigartige Showacts mit LED- und Lichtshows, sowie spektakulÀre Feuershows. Buchen Sie deutschlandweit Ihre..
led-show.eu/ Show Volker Maria Maier Lichtjonglage Feuershows Lichtshow Shows
148 Berlin UmzĂŒge 24 Moving Company

12161
Berlin
Mo-Su. 7.00 - 22.00 Credit Card, Cash, Bank Transfer Bei uns erhalten Sie alles aus einer Hand: vom passenden..
berlin-umzuege24.de/ Berlin Umzug Angebote Kostenlose Angebot UmzĂŒge Umzugsunternehmen Zeit
149 Expo Stand Services | Exhibition Stand Trade Fair

10827
Berlin
At Expo Stand Services, we deliver an attractive company stand construction that will appeal to the ideal..
expostandservice.com/exhibition-stand-designs-in-germany/ Exhibition Germany Stand Design Our We Company Services
150 Energetische Beratungen lebendige Konzepte Persönlichkeitsentwicklung

13593
Berlin
Neue Impulse - annehmen - glĂŒcklicher leben - Blockaden lösen - Kraft und Lebensfreude erhöhen - leichter vorwĂ€rts kommen Ich unterstĂŒtze..
elkeseidel-lebendigekonzepte.de Lebendige Elke Seidel Shui Geomantie Konzepte Willkommen Wahrnehmung
151 Psychotherapie-Praxis Curamentis Psychologische Psychotherapeuten

10249
Berlin
Curamentis ist eine Praxis fĂŒr Psychotherapie unter der Leitung von Dr. Svenja Zemma, die Ihnen eine kompetente..
psychotherapie-praxis-curamentis.de Therapie Online Psychotherapie Berlin Mitte Praxis Daten Inhalte
152 Technische Hintegrunddienste IT-Dienstleistungen

12161
Berlin
Technische Hintergrunddienste, professionelle Expertise von Spezialisten Wir verfĂŒgen ĂŒber das umfangreiche Wissen & Know-how, um Ihnen bei der..
it.mxii.com/
153 Schuldnerberatug Berlin - Brandenburg Schuldnerberatug

10117
Berlin
Die Kanzlei Bornemann ist seit ĂŒber 15 Jahren Ihr Experte fĂŒr Konfliktberatung und Schuldnerberatung in Berlin und..
ralf-bornemann.com Bornemann Kanzlei Schuldnerberatung Einwilligung Services Daten Ralf Herr
154 Karlsruher Immobilienbewertung Immobilienbewertung

10179
Berlin
Die Immobilienbewertung in Karlsruhe ist ein wichtiger Bestandteil des Immobilienmarktes in dieser Region. Hierbei handelt es sich..
karlsruher-immobilienbewertung.de/ Sans Awesome Helvetica Karlsruhe Lucida Not Prefetchable Arial
155 BERLINER Beerdigungsinstitut Bestattungen

14052
Berlin
Das Beerdigungs­institut in Berlin Bestattungen fĂŒr einen Abschied in WĂŒrde Besonderen Menschen gebĂŒhrt ein wĂŒrdiger Abschied. Genau das haben..
berliner-beerdigungsinstitut.de/ Berlin Beerdigungsinstitut Bestattung Verstorbenen Abschied Fair Kostenschonend Berliner
156 MEIN GÜNSTIG BESTATTER Bestattungen

14052
Berlin
Wir von MEIN GÜNSTIG BESTATTER bieten Ihnen kostengĂŒnstige Möglichkeiten zur Bestattung an. Auch fĂŒr eine Sozialbestattung stehen wir..
mein-guenstig-bestatter.de/ Einwilligung Daten Website Services Einstellungen Bestatter Inhalte Service
157 Kfz Gutachten Kfz SachverstÀndiger

10713
Berlin
24/7 fĂŒr Sie da - Mit uns können Sie rechnen. Oldtimer, Leasing, Wertgutachten, usw...
kfz-gutachterwilmersdorf.de/ Gutachter Setting Segoe Markus Kfz HĂ€usler Emoji Ihr
158 Institut Muth in Berlin Management

10785
Berlin
institut-muth.de Diese Website Bitte Tagen Letzte Updates Institut Muth
159 Mediationskanzlei & Schuldnerberatung Ralf Bornemann Schuldnerberatung

10127
Berlin
Sie haben den Überblick ĂŒber Ihre Schulden verloren oder sonstige Probleme aus dem Sozialbereich? Dann kann Ihnen..
ralf-bornemann.com/ Bornemann Kanzlei Schuldnerberatung Einwilligung Services Daten Ralf Herr
160 Umzugsunternehmen Berlin Umzugsunternehmen

10969
Berlin
Die beste Beratung und Betreuung in Berlin erhalten Sie bei der Umzugsfirma Unsere Angebotspalette bietet eine breite Auswahl..
umzugsunternehmen-berlin-mueller.de/ Berlin Umzug Angebot Umzugsunternehmen UmzĂŒge Ihren Umzugsfirma Kostenloses
161 Mitsegeltörn durch den sĂŒdlichen Dodekanes Segelreisen

88662
Überlingen
10 Tagestörn durch den Dodekanes von Kos bis nach Rhodos. Der Törnverlauf ist ein Traum. Ein toller..
meeressegeln.de Montserrat Roboto Arimo Lato Noto Sans Bord Segeltörn
162 Fenstero Fensterbau und

13597
Berlin
Der in Berlin ansĂ€ssige und im ganzen Land Brandenburg tĂ€tige Fensterbauer FENSTERO bietet hochwertige Bauelemente zu gĂŒnstigen..
fenstero.de/ Arial Lösung Haus Loft Gewerbe Outer Sansimportantfont Coming
163 GBS-Premium - GBS GrundstĂŒcksbörse & Service Immobilienmakler

12435
Berlin
Immobilienmakler Berlin und bei uns finden Sie die Symbiose aus Erfahrung, Sachverstand und professioneller Vermarktung sowie Service..
gbs-premium.de/ Immobilie Verkauf Muster Berlin Mut VerÀnderung Whats Immobilienmakler
164 tufeeÂź Services & Grosklos Web Services

12555
Berlin
tufeeÂź Services & Grosklos bietet Ihnen eine Vielzahl von Online RSS & XML Utilities und Online SEO..
tufee.de Domains Services Utilities Checker Grosklos Web Domain Reader
165 Agentur eager & small Veranstaltungsservice

10245
Berlin
Als Kreativagentur in Berlin Friedrichshain bieten wir eine breite Palette an professionellen Dienstleistungen fĂŒr Veranstaltungen an. Von..
eagerandsmall.de Agentur Pressekonferenzen Berlin Headset Konzerte Unsere Technikverleih Watt
166 Spanndecken Berlin 24 Spanndecken

13357
Berlin
GrundsÀtzlich ist eine professionelle Installation von einer satinierten Spanndecke nicht problematisch. Jedoch, wenn Sie keinen Fehler machen..
spanndeckenberlin24.de Spanndecken Archivo Narrow Abhaya Libre Co Berlin Spanndecke
167 Joel von Lerber Musiker

10783
Berlin
Joel von Lerber zÀhlt national und international zu den bekanntesten Harfenisten. Bereits als 6-jÀhriger erhielt er seinen..
joelvonlerber.com Home Lerber Cookie Joel Harpist But Musik You
168 Growthartig GmbH Marketing

10969
Berlin
Wir skalieren Unternehmen wirkungsvoll durch cleveres Performance Marketing, einer ganzheitlichen Strategie und datenbasierten Creatives! Namhafte Firmen vertrauen uns..
growthartig.io/ Creatives Marketing Swiper Performance Kunden Growthartig Ads Consulting
169 EntrĂŒmpelung Charlottenburg - Fairwerter Berlin 0177-5180000 Cleaning Service

13597
Ruhlebener Str. 2, 13597 Berlin
Die Fairwerter entrĂŒmpeln fĂŒr Sie auch in Charlottenburg. Kostenlose Besichtigung mit Festpreisangebot. Jetzt anrufen unter 0177-5180000. Kontaktdaten FAIRwerter 24..
entruempelung.berlin/entruempelung-charlottenburg/ Charlottenburg EntrĂŒmpelung Wilmersdorf Feld Berlin New Fairwerter Times
170 Gold An und Verkauf GoldhÀndler

10719
Berlin
Gold und Silber kaufen und verkaufen in Wien und Berlin Die GOLDINVEST Edelmetalle GmbH ist ein Unternehmen, das..
goldinvest-edelmetalle.de Gold Kaufen Verkaufen Edelmetalle Online Beratung GoldmĂŒnzen Mint
171 Dein Stellplatz GmbH - Parkplatz am Parkservice

12526
Berlin
Parken am Flughafen Berlin bei Dein Stellplatz! Unser VerstĂ€ndnis von Parken geht weit ĂŒber das bloße Abstellen..
dein-stellplatz.de/parken/berlin-brandenburg-ber/ Flughafen Berlin Parkplatz Parken Stellplatz Brandenburg Auto Dein
172 R.O.M. logicware Soft- und Hardware GmbH Software

12489
Berlin
R.O.M. logicware GmbH gestaltet und vermarktet digitale Anwendungen fĂŒr Autoren und Personen, die leidenschaftlich gern schreiben. Unser..
papyrus.de/ Cookie Name Autor Du Ireland Google DatenschutzerklÀrung Anbieter
173 Butler UmzĂŒge - Das Umzugsunternehmen aus Umzugsunternehmen

10315
Berlin
Sie suchen einen schnellen und gĂŒnstigen Umzugsservice in oder um Berlin? Butler UmzĂŒge freut sich, Sie als..
butler-umzuege.de/ Borlabs Berlin Umzug UmzĂŒge Butler Cookie Ihr Awesome
174 Cityfoto Berlin - Fotostudio fĂŒr preiswerte Fotostudio

10823
Berlin
Cityfoto Berlin – Dein Fotostudio mit Herz und Leidenschaft in Berlin-Schöneberg. Direkt an der U-Bahn Station Eisenacher..
cityfoto-in-berlin.business.site
175 Mein Ghostwriter Ghostwriting

12103
Berlin
TĂ€tig seit 2021 scheut unsere Ghostwriter Agentur keine MĂŒhen, um fĂŒr unsere Kunden herausragende akademische Arbeiten zu..
meinghostwriter.de/ Wörter Seiten Ghostwriter Arbeit Bachelorarbeit Hausarbeit Ghostwriting Masterarbeit
176 Goldstaub Barcatering GmbH & Co KG Catering


Berlin-Brandenburg
Ob geschĂ€ftlich, privat oder öffentlich. Wir haben fĂŒr jedes Format das passende Konzept. Mit kreativem Geschmackssinn fĂŒr..
goldstaub-barcatering.de Ihr Goldstaub Events Barcatering Bar Festivals Ihren Business
177 KEYZO - Film & Animation Videoproduktion

10437
Berlin
KEYZO ist ein Film- und Videoproduktionsunternehmen mit Sitz in Berlin. Wir sind auf die Produktion anspruchsvoller Imagefilme..
keyzo.de Film Sansfont Videoproduktion Animation Berlin Produktion Unsere Kunden
178 Berliner Hochzeitsfotograf Hochzeitsfotograf

10179
Berlin
Als Hochzeitsfotograf in Berlin bin ich verantwortlich fĂŒr die Aufnahme und Dokumentation der schönsten Momente an Ihrem..
berliner-hochzeitsfotograf.de/ Berlin Not Prefetchable Momente Awesome Hochzeitsfotograf Nitro Mutation
179 openMIND Travelmanagement Software

12555
Berlin
Die Reisekostenabrechnungs-App von openMIND – fĂŒr eine effiziente Abrechnung Ihrer GeschĂ€ftsreisen Mit unserer SaaS-Lösung digitalisieren und entlasten Sie Ihre..
openmind-travelmanagement.com/ Reisekostenabrechnung GeschÀftsreisen Kundinnen Vorteile Reisekosten Dienstreisen Einstellungen Digitalisierung
180 seonicalsÂź SEO-Agentur Berlin Werbeagentur

10555
Berlin
Als Onlinemarketing-Agentur sorgen wir dafĂŒr, dass Ihr Web-Auftritt technisch, strukturell und inhaltlich auf die neuesten Suchmaschinen-Standards optimiert..
seonicals.de/seo-agentur/berlin/ Google Website Online Agentur Berlin Ihr Cookie Ihren
181 BMobility24 GmbH Reisebusunternehmen

10365
Berlin-Lichtenberg
Sehr geehrte Damen und Herren, wir möchten uns als Busunternehmen fĂŒr den Raum Berlin/Brandenburg vorstellen. Seit Anfang..
bmobility24.de Cookie Berlin Name Fuhrpark DatenschutzerklÀrung Inhalte Bus Ireland
182 Umzug MĂŒller Umzug

10969
Berlin
Bei uns steht die Zufriedenheit unserer Kunden an erster Stelle, deshalb arbeiten wir ausschließlich mit qualifizierten Umzugspartnern..
umzugsunternehmen-berlin-mueller.de Berlin Umzug Angebot Umzugsunternehmen UmzĂŒge Ihren Umzugsfirma Kostenloses
183 Tiny Sins Onlineshop

13585
Berlin
Unser Online-Shop hĂ€lt fĂŒr Dich eine Auswahl an ĂŒber 6.000 Erotikartikeln bereit. In unserem Sortiment findest Du..
tinysins.de Web Map Shop Tiny Sins Dein SĂŒnden Hyphenopoly
184 TYPO3 & Shopware Agentur Berlin - Internetagentur

10117
Berlin
Als TYPO3 Agentur in Berlin konzipieren wir Ihr TYPO3 CMS entsprechend Ihrer Unternehmensanforderungen. Wir sind TechnologiefĂŒhrer im..
3m5.de Relaunch Dresden Projekten Inhalte Insights Webentwicklung Partner LĂ€nder
185 Synergie Physiotherapie Berlin Schöneberg Physiotherapie

10779
Berlin
Physiotherapeutische Behandlungen Als Team sind wir zertifiziert fĂŒr Krankengymnastik Die Krankengymnastik ist eine Behandlungsform und dient dazu Krankheiten aus..
synergie-physio.de Physiotherapie Berlin Synergie Schöneberg Physiotherapeut Team Behandlung Patient
186 NRG Projekt Photovoltaik

12557
Berlin
NRG Projekt ist Ihr Partner fĂŒr Projektleitung, Photovoltaik und Solarthermie in Berlin und Brandenburg! NRG Projekt bietet ein..
nrg-projekt.de Cookie Name DatenschutzerklÀrung Website Informationen Ireland Inhalte Anbieter
187 Kriesmann und Seib GbR Dreamotions Musikproduktion

10589
Berlin
Dreamotions Tonstudio Berlin: Aufnahmen unter der Wolkendecke fĂŒr Profis und Amateure. Moderne Technik, erfahrene Tontechniker..
dreamotions.de/ Berlin Tonstudio Aufnahmen Technik Services Projekte Studio Equipmentliste
188 Umzugsunternehmen Berlin Umzugsunternehmen

10969
Berlin
Wir als Umzugsunternehmen der perfekte Partner fĂŒr Ihren Umzug in Berlin Was uns so gut macht? Wir haben..
umzugsunternehmen-berlin-mueller.de/ Berlin Umzug Angebot Umzugsunternehmen UmzĂŒge Ihren Umzugsfirma Kostenloses
189 Ihre Webdesign Agentur aus Berlin Webdesign

14057
Berlin
Ihre WordPress Webseite erstellen wir nach Ihren WĂŒnschen. Ein Webdesign Berlin wird Ihre Erfolgschancen um 100 %..
hauptstadt-homepage.de Website Webdesign Agentur Pflege Homepage Google Berlin Hosting
190 SeniorenLebenshilfe Daniela Riedel Seniorenbetreuung

14163
Berlin
Die SeniorenLebenshilfe ist bundesweit eins der ersten Unternehmen, die sich auf die vorpflegerische Betreuung spezialisiert haben. Wir..
seniorenlebenshilfe.de/lebenshelfer-berlin/lebenshelferin-daniela-riedel/ Live Bitte Senioren Pflichtfeld Anfrage Applying Mail UnterstĂŒtzung
191 LED Auto Tuning|LED fĂŒr Auto Auto

13407
Berlin
CarledLogo Fokus auf LED Auto Tuning und LED fĂŒr Auto, Einschließlich LEDTĂŒrbeleuchtung, LED Untersetzer, AmbienteBeleuchtung, Beleuchtete..
carledlogo.de Cg Csvg Cpath Auto Sans Logo Plex Cuse
192 myitplanet Annahmestelle fĂŒr Datenrettung Berlin Datenrettung

13403
Berlin
myitplanet: Ihr Experte fĂŒr professionelle Datenrettung. Bei Verlust Ihrer Daten auf MobilgerĂ€ten, Tablets, Computern oder Speichermedien sind..
myitplanet.de/datenrettung/ Cg Csvg Datenrettung Cpath Daten Awesome Cuse Cdefs
193 Abnehmen im Liegen Berlin Beauty

10785
Berlin
abnehmenimliegenberlin.de Playfair Bold Poppins Italic Display Lato Helvetica Kvo
194 SachverstĂ€ndigenbĂŒro Hoenge SachverstĂ€ndige

10711
Berlin
Ein SachverstĂ€ndiger fĂŒr Immobilien ist ein Fachexperte, der sich auf die Beurteilung von Immobilienwerte spezialisiert hat. Er..
sachverstaendigenbuero-hoenge.de/ BausachverstÀndiger SchÀden Immobilien Immobiliengutachter Tipps Tricks Infos Behebung
195 Lead-Generator mit automat. Immobilienbewertung Immobilien

12043
Berlin
Lead-Generator mit automatisierter Immobilienbewertung (PDF) als Komplettlösung fĂŒr Makler. Einfach, individualisiert & automatisiert. Jetzt KOSTENLOS loslegen...
leadmarkt.ch Lead Leads Generator Immobilienbewertung Makler Minuten Immobilienbewertungen Word
196 Hilfe bei Essstörungen - Schwerpunktpraxis bei Psychotherapie

10965
Berlin
Wenn Hunger nicht das Problem ist, dann ist Essen nicht die Lösung. Als Heilpraktikerin fĂŒr Psychotherapie arbeite..
hilfe-bei-essstoerungen-berlin.de/ Essstörungen Ich Berlin Essen Binge Bulimie Eating Essstörung
197 GO Kfz Gutachter Berlin Kfz Gutachter

14059
Berlin
Erstellung von SachverstĂ€ndigengutachten fĂŒr Kraftfahrzeuge, Schadenbewertungen bei UnfĂ€llen, Unfallrekonstruktionen, Technische PrĂŒfungen von Fahrzeugen, Bewertung von SchĂ€den an..
berlinkfzgutchter.de
198 Berliner Umzugsservice Umzugsservice

10179
Berlin
Unser Berliner Umzugsunternehmen bietet zuverlÀssigen und sorgfÀltigen Service bei Ihrem Umzug. Mit unserem erfahrenen Team und modernen..
berliner-umzugsservice.de/ Cuse Helvetica Lucida Not Prefetchable Berlin Arial Firma
199 Reinigungs Kommando (Reinigungsfirme Vienna) Reinigungsdienstleistungen

1070
Wien
Wir, das Reinigungskommando, sind eine Putzfirma. Wir bieten professionelle Hilfe im Kampf gegen den Schmutz und fĂŒr..
reinigungskommando.at Stylable Play Reinigung Post Ba Blog Containermain Kcp
200 MST Sicherheitsdienst Sicherheitsdienst

10627
Berlin
MST Sicherheitsdienst bietet Security Service in Berlin und Umgebung Kunden aus allen Branchen Objektschutz Veranstaltungsschutz - Baustellenbewachung..
sicherheitsdienst-berlin.com Berlin Sicherheitsdienst Security Service Kunden Umland Sicherheit Unsere
201 Berlin SEO Freelancer SEO Freelancer

10627
Berlin
Meine Name ist Noah Lutz und ich bin in Berlin Ihr SEO Freelancer auf Augenhöhe. Ob Anwalt..
berlin-seo-freelancer.de/ Freelancer Cuse Google Berlin Ich Noah Not Prefetchable
202 Regenbogenspuren Haustier Andenken

12359
Berlin
Sie möchten ein personalisiertes Andenken an Ihr Haustier? Unsere personalisierten Andenken sind ein ganz besonderes Geschenk, um Ihr..
regenbogenspuren.de/ Dateget Regenbogenspuren Boxenschilder Contact Toll Berlin Tiergrabsteine Grablichter
203 Zahnarztzentrum am KurfĂŒrstendamm Zahnarzt

10789
Berlin
Schreibe mir ein Text ĂŒber das Zahnarztzentrum am KurfĂŒrstendamm und die angebotenen Leistungen. Das Zahnarztzentrum am KurfĂŒrstendamm bietet..
zahnarzt-berlin-kurfuerstendamm.de Zahnarzt Zahnimplantate Berlin KurfĂŒrstendamm Prophylaxe Infos ZĂ€hne Zahnmedizin
204 Berliner Umzugsunternehmen Umzugsunternehmen

10969
Berlin
Bei uns erhalten Sie alles aus einer Hand: vom passenden Möbelwagen bis zum Umzugsmaterial in Berlin –..
berlinerumzugsunternehmen.de/ Umzugsunternehmen Berlin Sans Symbol Umzug Segoe Emoji Extra
205 Umzugshelfer-Berlin.eu Umzugsunternehmen

13437
Berlin
Bei uns erhalten Sie alles aus einer Hand: vom passenden Möbelwagen bis zum Umzugsmaterial in Berlin –..
umzugshelfer-berlin.eu/ Berlin Umzug Umzugsunternehmen Montserrat Angebot Berlineu Font Umzugshelfer
206 Olymp UmzĂŒge Umzugsunternehmen

10557
Berlin
Bei uns erhalten Sie alles aus einer Hand: vom passenden Möbelwagen bis zum Umzugsmaterial in Berlin –..
olymp-umzuege.de/ Berlin Umzugsunternehmen Umzug Montserrat Angebot Ihr Unternehmen Font
207 TOTENKOPF RING SCHMUCK

10115
Berlin
TOTENKOPF FRAKTION bietet eine große Auswahl an Totenkopf-Kleidung, Totenkopf-Schmuck und Accessoires an...
totenkopf-fraktion.de Totenkopf Fraktion Ring Shirts Shopify Shopifyroutes Shopifyshop Shopifylocale
208 Supervision und Coaching Supervisorin Coach

10961
Berlin
Systemische Supervision fĂŒr Teams, Gruppen und Einzelpersonen zur Reflexion von Ressourcen und Herausforderungen im beruflichen Alltag mit..
ruth-kaukewitsch.de Coaching Supervision Teamentwicklung Berlin Stringfrom Arrayflag
209 bestesparer Fashion

10117
Berlin, Germany
Was hÀlt Sie davon ab, Ihre Lieblingssachen zu kaufen? Ihr Budget und die hohen Preise? Dann machen..
bestesparer.de/ Website Beste Bewertungen Blogs Rabatt Geld Marken Gutscheincodes
210 Rohrreinigung Berlin ROHRMED Rohrreinigung

13051
Berlin
Rohrreinigung in ganz Berlin Verstopfungsbeseitigung aller Art..
rohrmed-rohrreinigung.de
211 Privatumzug - BĂŒroumzug Berlin - Umzugsfachspedition Umzugsunternehmen

10117
Berlin
Wir sind Ihr kompetenter und zuverlĂ€ssiger Umzugspartner in allen Fragen der Planung und des Transports. FĂŒr den Privatumzug..
umzugsfachspedition.berlin Umzug Berlin Umzugsfachspedition If Warning Array Oswald Divi
212 Berliner Weddingplaner Weddingplaner

10785
Berlin
Ich bin ein professioneller Hochzeitsplaner in Berlin und helfe Paaren dabei, ihren perfekten Hochzeitstag zu planen. Von..
berliner-weddingplaner.de/ Cuse Berlin Helvetica Lucida Not Prefetchable Weddingplaner Awesome
213 Wir verlegen Estrich Flooring Contractor

12103
Bessemerstraße 82 10. OG SĂŒd, 12103 Berlin
Engagierter Estrichleger in Berlin und Umgebung. QualitĂ€t begeistert. FĂŒr Ihre Villa in Zehlendorf, die Altbau-Sanierung in Charlottenburg..
wirverlegenestrich.de Estrich Estrichleger Bayern Alz Opening Str Weißenburg Jahren
214 Umzugsunternehmen Bernau bei Berlin Umzugsunternehmen

16321
Bernau bei Berlin
Ein Wohnortwechsel in Bernau bei Berlin oder nach Dachau oder doch nach Braunschweig bedeutet im ersten Moment..
umzugsunternehmen-bernau-bei-berlin.de Bernau Berlin Umzug Angebot UmzĂŒge Umzugslogistik Unsere Umzugsunternehmen
215 Philipp Nedelmann Heilpraktiker

10435
Berlin
Sie leiden unter chronischer Erkrankungen, Schmerzen, Verdauungsprobleme oder Erschöpfung und Burnout? Wir sind eine Heilpraktiker-Praxis, die sich..
philippnedelmann.de/ Berlin Therapie Heilpraktiker Nedelmann Praxis Philipp Prenzlauer Berg
216 felmo Mobiler Tierarzt Berlin Tierarzt

10555
Berlin
felmo ist der mobile Tierarzt in Berlin, der stressfreie Hausbesuche fĂŒr Hunde und Katzen anbietet. Unsere kompetenten..
felmo.de/tierarzt/berlin?utm_source=directories&utm_medium=referral&utm_campaign=stadtbranche Tierarzt Berlin App TierÀrzte Leistungen Termin Hausbesuch TierÀrztin
217 Eberhardt Service Group GmbH Hausmeisterdienstleistung

10707
Berlin
eberhardt-service.de/ Montserrat Poppins Bold Stylable Italic Post Service Bookings
218 Komfort Polsterei Polsterei

12203
Berlin
Wir von Komfort Polsterei kĂŒmmern uns um Ihre Möbel. Ganz egal, ob die Polster neu bezogen werden..
komfort-polsterei.de/ Sans Rotate Fade Blur Zoom Berlin Fly Roll
219 Norva24 Deutschland GmbH Rohrreinigung

10785
Berlin
Norva24 in Deutschland besteht aus mehreren Unternehmen mit verschiedenen Niederlassungen. Wir sind auf UIM (Underground Infrastructure Maintenance)..
norva24.de/ Borlabs Berlin Rohrreinigung Deutschland Norva Gmb Nitro Eventnitro
220 NK Cleaning Service Reinig

12051
Berlin
Sie suchen eine seriöse Reinigungsfirma in Berlin? Dann sind Sie bei uns genau richtig. Wir sind seit..
nk-cleaningservice.de/ Berlin Modern Browsers Reinigung Service Jost Compat Modes
221 Versicherungen Versicherungsmakler

13187
Berlin
Wir bieten individuelle Konzeptionen spezialisiert auf KFZ HĂ€ndler und KFZ WerkstĂ€tten. Doch auch fĂŒr alle anderen Gewerbetreibenden..
aurekon.de/ Montserrat Poppins Bold Italic Regular Post Blog Member
222 Matratzen Matratzen

10787
Berlin
Karibian verkauft bereits seit 1998 in sieben LÀndern erfolgreich Premium Matratzen und produziert jÀhrlich mehr als 65000 Schlafeinheiten. Bei..
karibianhome.de/ Wunschliste Kaltschaum Federkern Naturlatex Matratzen Gel Visco Produkte
223 Stagerockers Kommunikation

10963
Berlin
Stagerockers.de bringt mehr als die meisten zeitraubenden Seminare. Nutze unsere sofort anwendbaren Tipps & Tricks. FĂŒr Deine..
stagerockers.de/ Hörbuch Video Seminar Training Storytelling Coaching PrÀsentation Coach
224 ReproBerlin GmbH Digitaldruckerei &

10623
Berlin
ReproBerlin ist Ihre Digitaldruckerei und Copyshop in der Hardenbergstraße 7 in 10623 Berlin Charlottenburg Mo-Fr 9:30-18:30, Sa 11:00-16:00..
reproberlin.de Berlin Charlottenburg Digitaldruckerei Copyshop Mo Fr Sa Repro
225 Personalberatung Personalvermittlung

10715
Berlin
HSC Personalmanagement ist Ihre Personalberatung wenn es um die Personalsuche von Fach- und FĂŒhrungskrĂ€ften geht. Unsere Headhunter..
hsc-personal.de Personalberatung Headhunter Search Unternehmen Executive Kandidaten FĂŒhrungskrĂ€fte Personalvermittlung
226 No3 Schinkelplatz Apartments

10117
Berlin
Luxus Serviced Apartments in Berlin-Mitte..
no3-schinkelplatz.com/ Schinkelplatz Residence No Berlin Residences Townhouse Superior Residenzen
227 Fotograf


Berlin
Berlin Tageslicht Sophie Brand Fotostudio Vorlieben Studio Arrayis
228 Photography


Berlin
Safari Brand IndividualitÀt Deine Photography Bildern Fotografin StÀrke
229 Naturheilpraxis Shop Gesundheits Online

10435
Berlin
Sie möchten Ihre Gesundheit aktiv unterstĂŒtzen und NahrungsergĂ€nzungsmittel kaufen – legen aber hohen Wert auf QualitĂ€t und..
naturheilpraxis-shop.de Ly Bewertung Reg Bewertungen Dateget Hook Adresse Mail
230 Berliner Immobiliengutachter Immobiliengutachter

12107
Berlin
Mit uns haben Sie einen zuverlÀssigen und fachkundigen Immobiliengutachter in Berlin. Alle SachverstÀndigen im Team agieren frei..
berliner-immobiliengutachter.de/ Sans Cuse Helvetica Segoe Arial Lucida Not Prefetchable
231 Dauerhafte Laser-Haarentfernung Berlin Schönheit &

10709
Berlin
Amara – Aesthetic- & Laserlounge ist ihr kompetenter und professioneller Ansprechpartner fĂŒr dauerhafte Laser-Haarentfernung, apparative Kosmetik sowie..
amara-berlin.de Laser Haarentfernung Behandlung Haut Berlin Haare Amara WellenlÀnge
232 Max Blinker E-roller

10827
BERLIN
Wir bieten Ihnen Elektroroller in höchster QualitĂ€t sowie autorisierten und bequemen Service ĂŒberall. Wir lieben eine nachhaltige..
maxblinker.de/de/
233 meltus Studio Grafik

12681
Berlin
Sie suchen ein individuelles Bild mit dem Sie Ihr Produkt in den Vordergrund bringen können? meltus Studio..
meltus.de Studio Gallery Contact All Services Illustrations Product Visuals
234 Kaspar-UmzĂŒge GmbH Umzugsunternehmen

10829
Berlin
Ein Umzug ist Vertrauenssache. FĂŒr einen sicheren und reibungslosen Umzug gibt es keine zweite Chance. Höchste Sorgfalt..
kaspar-umzuege.de Berlin Umzug Kaspar UmzĂŒge Angebot Umzugsunternehmen Kontakt Mail
235 Quaabo Weiterbildung Berufskraftfahrer Weiterbildungen

10365
Berlin
Quaabo bildet seit 13 Jahren Berufskraftfahrer aus. (Weiterbildungen fĂŒr Lkw-Fahrer & Busfahrer - Modul 95) Wir sind dazu..
quaabo.de Ausbildung Berufskraftfahrer Cookie Weiterbildung Quaabo Website Modul Informationen
236 Detektei Fahtz Berlin Detektei

14089
Berlin
Privatdetektei & Wirtschaftsdetektei Wir bieten unseren Mandanten seit mehr als ĂŒber 20 Jahren seriöse und erfolgreiche Informationsbeschaffungen..
detektei-fahtz.de Berlin Detektei Privatdetektiv Mulifont Fahtz Anliegen Privatdetektive Unsere
237 Miteinander wachsen - Familienbegleitung Krabbelgruppe

12045
Berlin
Familienbegleitung Miteinander wachsen Berlin ich begleite engagierte und undogmatische Eltern, die sich fĂŒr eine bedĂŒrfnisorientiere Erziehung interessieren und gleichzeitig..
miteinanderwachsen.org Eltern Kind Meine Shop Kontakt Leistungen MenĂŒ Gruppen
238 Sabayking Thai Massage Tempelhof Massage

12347
Berlin
Sabayking befindet sich direkt bei McFit in Berlin-Tempelhof und bieten Ihnen in unserer Wellnessoase ein in Deutschland..
thaimassage-tempelhof.de Massage Thai Sonnenstudio Berlin Tempelhof Sabayking Exklusive Sportmassage
239 Miteinander wachsen - Familienbegleitung Krabbelgruppe

12045
Berlin
Familienbegleitung Miteinander wachsen Berlin ich begleite engagierte und undogmatische Eltern, die sich fĂŒr eine bedĂŒrfnisorientiere Erziehung interessieren und gleichzeitig..
miteinanderwachsen.org Eltern Kind Meine Shop Kontakt Leistungen MenĂŒ Gruppen
240 Sibolab UG Atemgastest Zur

10435
Berlin
Manche Krankheiten kann man riechen. Ein leicht sĂŒĂŸlich-fruchtiger Acetongeruch etwa deutet beispielsweiße auf Diabetes, ein Ammoniakgeruch auf..
sibolab.de Arrayfrom Type Start Mathmin Untersuchung Sibo Reizdarm Sibolab
241 Dipl. Psych. Justyna Menke - Beratung Supervision Beratung

10715
Berlin
Supervision, Beratung, Elterncoaching, Hochbegabung, psychologische Beratung, Life Coaching, Outdoor Coaching, Business Coaching, Begabtenberatung, walk-and-talk-Coaching in Berlin..
justyna-menke.de Libre Post Bookings Blog Booking Objectassign Baskerville Stylable
242 Sparrks Business Coaching

10435
Berlin
Sparrks wurde 2021 als Berliner Start-Up ins Leben gerufen. Sparrks bietet eine selbstentwickelte B2B Coaching Plattform, die..
sparrks.io/ Coaching Sparrks Business Coaches Manrope Themen Unternehmen Mitarbeitenden
243 Fotoladen


Berlin
Important Bilderrahmen Fotouhren Kamerazubehör Kategorie Ihrem Versand Fotoalben
244 Matze UmzĂŒge Services

13403
Berlin
FĂŒhlen Sie sich festgefahren und fragen sich, wie Sie da rauskommen? Kein Grund zur Sorge; Rufen Sie..
matze-umzuege.de/ Sans Prefetchable Not Umz Awesome Matze Berlin UmzĂŒge
245 Tante Emma Shop Online Lebensmittel

16321
Bernau bei Berlin
Kennst Du mich noch? Ich bin es, Tante Emma. So wie du erwachsen geworden bist habe auch ich..
tanteemma.io/ Tante App Emma Du Dir Dich Kontakt Store
246 Handwerker-Berlin365 Allround-Handwerker

12359
Berlin
Meine Dienstleistungen werden im Raum Berlin und Umland angeboten. Die Arbeitszeit liegt im Zeitfenster zwischen 7.30 Uhr..
handwerker-berlin365.de Berlin Handwerker Speicherung Böden Art Zugriff Zustimmung Zweck
247 DIE WELTBERÜHMTE REIBE AUS FINNLAND Handwerkliche KĂŒchen

12159
Berlin
AnckeramicÂź KĂŒchen Utensilien 100% handgefertigte Ceramico keramikreiben aus Finnland. Darunter Muskatnussreibe, Knoblauchreibe, Ingwerreibe, Parmesanreibe, Zitruspresse, Kaffeefilter-Halter..
anckeramic.de/ Fbw Text My Cormorant Helvetica Blog Ri Ligh
248 Zahnarztpraxis Spreekrone Zahnarzt

13509
Berlin
Willkommen in der Zahnarztpraxis Spreekrone Berlins Zahnspezialisten fĂŒr die ganze Familie Moderne Zahnmedizin in entspannter AtmosphĂ€re – kein Gegensatz..
spreekrone.de/ Zahnarzt Berlin Reinickendorf Praxis Termin Spreekrone Zahnarztpraxis Kontakt
249 DachProfi Berlin Services

10243
Berlin
Dachdecker ist ein Unternehmen in Berlin, das erstklassigen Service und Reparaturen fĂŒr DĂ€cher von HĂ€usern und GebĂ€uden..
dachprofi.berlin/ Berlin Dach Dachdecker Ihr WÀrmedÀmmung Dachbeschichtung Angebot Kontakt
250 LeadMarkt.ch Kostenloser Lead-Generator mit automatisierter WerteinschÀtzung Immobilien

12043
Berlin
Benutzerfreundlicher Leadgenerator fĂŒr Makler & Werbeagenturen - prozessoptimiert durch mehrfache A/B-Tests. GerĂ€teĂŒbergreifend, einfach & schnelle Integration in..
leadmarkt.ch/ Lead Leads Generator Immobilienbewertung Makler Minuten Immobilien Immobilienbewertungen
251 Tageslichtlampe Medizin

10715
Berlin
Tageslichtlampe Test – Die besten Tageslichtleuchten zur Lichttherapie Tageslichtlampen haben mittlerweile gut Fuß auf dem deutschen Markt gefasst..
tageslichtlampetest.com/ Tageslichtlampe Lux Lampe Beurer Test Tageslichtleuchten Philips Tageslichtleuchte
252 Praxis fĂŒr systemische Therapie und Beratung Psychotherapie

14169
Berlin
Systemische Einzel-, Paar-, Familientherapie und Beratung, Traumafachberatung und Craniosacrale Körpertherapie...
praxis-benter.de Heilpraktikerin Berlin Sonja Benter Beratung Therapie Cranio Biodynamik
253 Hotel Dorint KurfĂŒrstendamm Berlin Hotel

10789
Berlin
Die preisgekrönte Architektur von Jan Kleihues, spektakulĂ€re Kunst von LĂŒpertz, Toscanelli & Kampmann sowie die einzigartig aufstrebende..
hotel-berlin.dorint.com/de
254 Hotel Essential by Dorint Berlin-Adlershof Hotel

12489
Berlin-Adlershof
hotel-berlin-adlershof.dorint.com/de
255 Leadership Coaching MĂŒnchen Coaching

10437
Berlin
Jeder Mensch ist anders. IndividualitÀt macht uns aus, das Leben spannend und lebenswert und stellt uns gleichzeitig oft..
leadership-coaching-muenchen.com/ Coaching MĂŒnchen Leadership Eich Unternehmen Lioba Mitarbeiter Work
256 Sabayking Thai Massage & Wellness Charlottenburg Thai Massage

14059
Berlin
Sabayking ist Ihr exklusives Thai Massage und Wellness Studio in Berlin-Charlottenburg. Wir bieten Ihnen eine vielfalt an..
sabayking-thaimassage.de Massage Schmerzen Massagen Thai Unsere Stress Sabayking Muskeln
257 Maticz Technologies Software Development

26944
Berlin
Maticz is a Top Blockchain Development company in India that aims to help Fintech and other businesses..
maticz.com/ Development We Get Maticz Software Our Demo Web
258 Kunsttherapie | ErnÀhrungsberatung | Innere StÀrke Kunsttherapie und

10243
Berlin
Meine Grundhaltung: Meine Arbeit ist geprĂ€gt von der WertschĂ€tzung fĂŒr die jeweilige Familie, hochgradigem EinfĂŒhlungsvermögen in die aktuelle..
kunsttherapie-berlin.art/ Wnfo Text Wnf My Book Bookings Post Profile
259 Fahrschule Performance Tegel Fahrschule

13507
Berlin
Herzlich willkommen in der Performance-Fahrschule Filiale Berlin Tegel. Wir bilden in folgenden Klassen aus: FĂŒhrerscheinklasse fĂŒr PKW:..
performance-fahrschule.de Redirect Webkit Moz Khtml Homepage
260 LOVE DESTINATION Events - Pia Etzold Hochzeitsservice

10409
Berlin
Ich bin Hochzeitsplanerin & Event Designerin und plane Hochzeiten in Berlin und ganz Europa. Von den ersten..
lovedestination.events/ Luxes La Script Belleza Destination Berlin Tag Planung
261 Hire a Doctor Group Ärztevermittlung

10405
Berlin
Als Personaldienstleister im Gesundheitswesen vermittelt die Hire a Doctor Group medizinisches/pflegerisches Fachpersonal fĂŒr Vertretungen in Gesundheitseinrichtungen und..
hireadoctor.de/ Cookie Website Doctor Hire Group Teams Informationen Unsere
262 Familiesportrait Portrait Zeichnen

10179
Berlin
Lass dein Foto professionell von uns zeichnen oder dein Bild malen lassen. Wir erstellen eine atemberaubende Zeichnung..
familiesportrait.de/products/portrait-zeichnen-lassen Farbe Foto Bleistift Fotovorlage Bleifstiftzeichnung Bild Portrait Offer
263 Majori Systems GmbH Informationstechnik

10557
Berlin
Majori Systems ist Ihr reliabler Kooperationspartner, bei allen Fragen rund um das Thema Microsoft 365. Mit unseren..
bertha-benz straße 5
264 COMPANIFY Franchiseberatung Unternehmensberatung Strategieberatung

10117
Berlin
Mit Franchisesystemen erfolgreich wachsen. COMPANIFY Franchiseberatung Berlin hilft Unternehmen und GrĂŒndern, die ein eigenes Franchisesystem aufbauen wollen. Ein..
companify.de/ Franchise Cookie Google Informationen Website Berlin Firmensitz Standort
265 Dreipeo - Die Hundeschule und Hundephysiotherapie Hundetraining Hundephysiotherapie

14050
Berlin
Hallo liebe/r Hundehalter/in! Mein Name ist Andrea Popp und ich bin zertifizierte Hundeerzieherin und Verhaltensberaterin (IHK Potsdam) mit..
dreipeo.de/ Hund Minuten Training Listenelement Link Element Befunderhebung Therapie
266 Hochdruckreiniger Testsieger Einkaufen

12685
Berlin
Dieser neue Ratgeber informiert seine Leser ĂŒber die neusten Anbieter und Testberichte von Hochdruckreinigern...
hochdruckreinigers-testsieger.de/ Testsieger Hochdruckreiniger Alle Blick This Stringfrom Arrayflag
267 Hochdruckreiniger Testsieger Einkaufen

12685
Berlin
Dieser neue Ratgeber informiert seine Leser ĂŒber die neusten Anbieter und Testberichte von Hochdruckreinigern...
hochdruckreinigers-testsieger.de/ Testsieger Hochdruckreiniger Alle Blick This Stringfrom Arrayflag
268 RĂŒmpelgenie Cleaning

13156
Berlin
Wenn Sie in Berlin oder Umgebung wohnen und persönliche Hilfe bis hin zu EntrĂŒmpelungen oder UmzĂŒgen benötigen..
ruempelgenie.de/ Sans Montserrat EntrĂŒmpelung Berlin RĂŒmpelgenie Service Cuse Entsorgung
269 Unicoaching-Berlin Wissenschaftscoaching

12157
Berlin
Bei jedem Arbeitsschritt auf dem Weg zur fertigen Masterarbeit werden Sie von kompetenten Wissenschaftlern begleitet. Wir leiten..
unicoaching-berlin.de/wissenschaftliches-coaching/masterarbeit/ Coaching Hilfe Seite Dissertation Forschung Wissenschaftliches Lektorat Qualitative
270 Agas Immobilien GmbH Immobilien

10115
Berlin
Herzlich Willkommen bei Ihrem MaklerbĂŒro Agas Immobilien! Wir helfen Ihnen bei allen Belangen rund um Ihr jetziges..
agas-immobilien.de Berlin Immobilien Vermarktung Ort Ihr Agas Mwin Unsere
271 WĂŒstentouren wĂŒstenreisen kameltrekking marokko Marokkoreisen

10369
Berlin
UNSERE ANGEBOT DES JAHRES 2022 – 6 fĂŒr 5 Wenn Sie als Gruppe bei uns fĂŒr sechs Personen..
wuestenperle.com Wuestenperle Marokkoreisen This Stringfrom Arrayflag Fwuestenperlecom Fgebirgstour Type
272 Abschleppdienst Krause Abschleppdienst

10961
Berlin
Einer der besten und zuverlÀssigsten Abschleppdienste in ganz Deutschland ist Krause Abschleppdienst. Wir bieten Abschleppdienste in allen..
abschleppdienst-krause.de/ Sans Abschleppdienst Berlin Krause Cuse Ihr Website Service
273 hellseher-magier.com Lebensberatung

88662
Überlingen
Alles begann in Transsilvanien, im Herzen RumÀniens. Dort, wo Bram Stoker seine Inspiration holte und mit Vlad..
hellseher-magier.com/grandmaster-der-magie-ueber-mich Containerhtkcinline Ich Post Blog Objectassign Video RumÀnien Captcha
274 Praxis fĂŒr Homöopathie in Berlin Treptow Gesundheit

12437
Berlin
Diese Praxis fĂŒr klassische Homöopathie liegt im ruhigen Baumschulenweg in Berlin. Die Heilpraktikerin behandelt hier in Treptow-Köpenick..
naturheilpraxis-homoeopathie-berlin.de Homöopathie Berlin Behandlung Details Heilpraktiker Praxis Treptow Köpenick
275 Praxis fĂŒr Integrative Lerntherapie Margret Bradfield Lerntherapie

12103
Berlin
Hilfe beim Lesen, Schreiben und Rechnen bei einer LRS und Dyskalkuli...
lerntherapie-bradfield.de Cookie Lerntherapie Consent Praxis Lese Integrative These The
276 Euer Trauredner: Markus Lemke | Freie Hochzeitsredner

10245
Berlin
freietrauungberlin-markuslemke.de/ Trauung Markus Trauredner Berlin Hochzeit Trauzeremonie Lemke Freie
277 Mobile Hundeschule Fellkumpelz Berlin Brandenburg Hundeschule

12437
Berlin
Mein Name ist Tobias von den Fellkumpelz. Ich bin Hundeerzieher und Verhaltensberater mit IHK/ BHV Ausbildung und Abschlusszertifikat. Ich..
fellkumpelz.de Sans Open Hund Tobias Oswald Uv Training Fellkumpelz
278 Rechtsanwalt Uwe Heichel Rechtsanwalt

10587
Berlin
Rechtsanwalt Uwe Heichel in Berlin Charlottenburg-Wilmersdorf Das Immobilienrecht in Deutschland ist sehr komplex. Es wird beeinflusst von diversen..
rechtsanwalt-heichel.de Heichel Berlin Uwe Rechtsanwalt Feld Dieses Charlottenburg Wilmersdorf
279 Dave Brice Handy Jammer

10115
Berlin
jammer-store.de ist ein Störsender-GroßhĂ€ndler mit mehr als 15 Jahren Berufserfahrung, den Kunden die professionellsten Lösungen. https://www.jammer-store.de/WLAN-bluetooth-storsender.html..
jammer-store.de/ Störsender Antennen Signal Handy Handheld BÀnder Wi Jammer
280 030 Immobilienbewertung Immobilienbewertung

10179
Berlin
Wir sind Ihr Ansprechpartner fĂŒr eine unabhĂ€ngige Immobilienbewertung in Berlin und Umgebung. Unsere Experten bieten dabei Gutachten..
030-immobilienbewertung.de/ Sans Cuse Awesome Helvetica Prefetchable Lucida Not Csvg
281 Dachdeckerei Briegmann Dachdecker

13409
Berlin
Wir von der Dachdeckerei Briegmann sind sowohl fĂŒr Privatkunden als auch fĂŒr Unternehmen, Architekten und öffentliche Auftraggeber..
dachdeckerei-briegmann.de/ Briegmann Dachdeckerei Berlin Dach Meisterbetrieb Kontakt Dachdeckermeister Team
282 June Six Hotel Berlin City West Hotel

10623
Berlin
BohĂšmeflair, KĂŒnstlertreff, Institution im Nachtleben – der Berliner Savignyplatz ist der Hotspot in City West. In diesem..
june-six-hotels.com/hotels/berlin-city-west/ June Six Hotel Zimmer City Berlin West Uhr
283 IKARUS Steuerberatung in Berlin und Dessau Steuerberaterin

10963
Berlin
Wir sind Ihr zuverlÀssiger Steuerberater und decken sÀmtliche steuerrechtlichen Aspekte Ihres Unternehmens ab. Dazu gehören alle steuerrechtlichen..
ikarus-steuerberatung.de/ Steuerberatung Berlin Dessau Bettina Höll Steuerberaterin Lohnbuchhaltung Arial
284 Psychologische Praxis Zehlendorf | Psychotherapie & Psychotherapie

14167
Berlin
Die Psychologische Praxis Zehlendorf besteht aus einem Team hochqualifizierter Psychologen, Psychotherapeuten (HeilprG), Paartherapeuten und Hypnosetherapeuten. Unsere Praxis..
psychologische-praxis-zehlendorf.de Psychologische Praxis Zehlendorf This Stringfrom Arrayflag
285 EastSeven Hostel Berlin Hostel

10119
Berlin
EastSeven Hostel in Berlin - Du suchst nach einem gemĂŒtlichen Hostel in Berlin? Freue dich auf..
eastseven.de Sans Gothic One Berlin Prenzlauer Berg Hostel Segoe
286 Berliner BausachverstÀndiger BausachverstÀndiger

10179
Berlin
Wir sind Ihr zuverlÀssiger BausachverstÀndiger und Baugutachter in Berlin. Unser Team bestehend aus Spezialisten begleitet Sie bei..
berlin-bausachverstaendiger.de/ Sans Cuse Awesome Lucida Not Prefetchable Helvetica Berlin
287 Davinci Medic Ästhetische Medizin

10409
Berlin
Bei Davinci Medic Berlin stehen Sie als Patient im Mittelpunkt. Wir bieten Ihnen modernste wissenschaftlich fundierte Therapieverfahren..
davincimedic.de/ Tattooentfernung Berlin Eingewachsener Medic Zehnagel Entfernung Davinci Speicherung
288 Interior Studio Isabella Hamann Innenarchitektur

14057
Berlin
ELEGANTE HIGHLIGHTS FÜR JEDES INTERIOR Interior Studio Isabella Hamann bietet individuelle Planungen die auf die BedĂŒrfnisse der..
ih-interiorstudio.com/ Giobagnara Leder Farbe Farben Designs Wildleder Materialien Italien
289 Zauber-Engel Zauberei mit Herz und Humor KĂŒnstler

13503
Berlin
Professionelle Zauberkunst Charmant, sympathisch, individuell FĂŒr alle AnlĂ€sse im Raum Berlin Brandenburg..
zauber-engel.de Berlin Zauberer Brandenburg Magie Ich GĂ€ste Hochzeit Art
290 Wikinger UmzĂŒge UmzĂŒge

12053
Berlin
Es stehr ein Umzug wn und Sie benötigen professionelle UnterstĂŒtzung von einer UMzugsfirma bei ihrem Umzug? Dann..
wikinger-umzuege.de/ Berlin Umzug Wohnungsauflösung Möbel Leistungen Umzugsunternehmen UmzĂŒge Kontakt
291 BB Fliesen - Fliesenleger Berlin Handwerk

10115
Berlin
bb-fliesen.de Apx Fliesen Amin Berlin Mosaik Details Planung Prefetchable
292 Work-Life-Balance Coaching

14165
14165 Berlin
Alle meines Coachings (Coaching fĂŒr FĂŒhrungskrĂ€fte, NLP-Kompaktkurs, Onlinekurse uvm.) zielen darauf, dich dabei zu unterstĂŒtzen, deine Probleme..
work-life-balance-berlin.de Work Life Balance Coaching Berlin Online Coach Condensed
293 Dehler Coaching Coaching

10117
Berlin
Ich setze alles darauf an, das Potenzial meiner Klientinnen und Klienten voll auszuschöpfen und dabei Ideen zu..
dehlercoaching.de/ Coaching Berlin Dehler Business Ursula Coach Konfliktmoderation FĂŒhrungskrĂ€fte
294 Rohr-Frei Berlin Rohrreinigung

10117
Berlin
Als Firma fĂŒr Rohrreinigung in Berlin sind wir Ihr seriöser und erfahrener Ansprechpartner. Mit unserem Notdienst sind..
rohr-frei-berlin.de/ Sans Rotate Franklin Fade Blur Frei Zoom Roll
295 Odontik Odontik

12099
Berlin
Ihr Zahnarzt in Tempelhof VON PROPHYLAXE BIS ZAHNERSATZ Unser professionelles Team freut sich auf Ihren Besuch in unserer Zahnarztpraxis..
odontik.de/ Tempelhof Zahnarzt Stefanos Baraliakos Uhr Damm Unser Tempelhofer
296 Odontik Odontik

12099
Berlin
Ihr Zahnarzt in Tempelhof VON PROPHYLAXE BIS ZAHNERSATZ Unser professionelles Team freut sich auf Ihren Besuch in unserer Zahnarztpraxis..
odontik.de/ Tempelhof Zahnarzt Stefanos Baraliakos Uhr Damm Unser Tempelhofer
297 Resilienztraining Online Coaching

10711
Berlin
Viele neue FĂŒhrungskrĂ€fte jonglieren am Anfang damit, plötzlich nicht mehr Team-Mitglied zu sein, sondern in der Rolle..
resilienztraining.online Reimann Resilienztraining Resilienz FĂŒhrungskrĂ€fte Training Alexandra Mitarbeiterinnen Herausforderungen
298 Valera Medizinisches Kleintierzentrum Berlin Tierarzt

14163
Berlin
Valera – Medizinisches Kleintierzentrum ist ein tierĂ€rztliches Behandlungszentrum fĂŒr Kleintiere. In unserem Standort in Berlin Zehlendorf beschĂ€ftigen..
valera.vet Product Tock Berlin Kleintierzentrum Team Medizinisches Tierarzt MenĂŒ
299 KuÂŽDamm 101 Design-Hotel Berlin Hotel

10711
Berlin
kudamm101.com/
300 apprime GmbH | App Agentur Berlin App Entwicklung

10405
Berlin
Die App Agentur apprime GmbH aus Berlin bietet native iOS App und Android App Entwicklung, sowie hybride..
apprime.de App Sans Cookie Google Entwicklung Name Mobile Informationen

Kleinanzeigen, Kommentare und Mitfahrgelegenheit Berlin

+ Kommentar oder Kleinanzeige für Berlin eintragen!

301 Home Augenarztpraxis im
10783
Berlin
Augenarztpraxis im Ärzte Centrum Bülowstraße
aerzte-buelowstrasse.de
302 Albers DAS SPORTRESTAURANT Albers Wettboerse GmbH Albers
10783
Berlin
Großzügig konzipiert ist das Albers Sportrestaurant der Treffpunkt aller Besucher des Pferdesportparks BerlinKarlshorst. Der aufmerksame
albers-restaurant.de Albers Berlin Restaurant
303 Home
10783
Berlin
Kultur FREIES MUSEUM BERLIN
artfactory-berlin.de
304 Weihnachtsmarkt auf dem Winterfeldtplatz Berlin
10783
Berlin
Der traditionelle Weihnachtsmarkt auf dem Winterfeldtplatz ist einzigartig und an den Adventssonntagen geöffnet.
weihnachtsmarkt-winterfeldtplatz.de Berlin Weihnachtsmarkt Winterfeldtplatz
305 Formular.de Tipps & Formular.de ist ein Angebot der Formblitz AG
10783
Berlin
Auf Formular.de finden Sie umfangreiche Informationen zu juristischen Themen wie Mietvertrag Arbeitsvertrag Patientenverfügung
formular.de
306 Cafe Peri Start
10783
Berlin
Homepage of Cafe Peri
cafe-peri.de
307 Czollek consult Willkommen! Leah
10783
Berlin
Diversity Dialoge Mediatorin Trainerin Dozentin Konflikte produktiv und zufriedenstellend lösen Kommunikation Dialog Unternehmen Kommunikationskultur
czollek-consult.de Leah Carola Czollek
308 PROFORMA Corporate Design Gesellschaft fĂŒr Unternehmenskommunikation mbH & Co. KG Design
10783
Berlin
Corporate Design Agentur Berlin Agentur für Unternehmenskommunikation WebEntwicklungen und Beratung. Für Unternehmen
proforma.de Design Gestaltung Corporate
309 Business Development Germany German
10783
Berlin
We bring your business on the German market – contact us today!
businessdevelopmentgermany.de German Companies German Marketing
310 DJ Frank DJService DJ
10783
Berlin
Dj Frank Berlin DJService für Partys Feste Hochzeiten ...
dj-frank-berlin-brandenburg.de DJ Berlin Brandenburg Party Hochzeit
311 Berlin Taekwondo Willkommen Berlinsan Taekwondo Sportverein e.V. Adnan
10783
Berlin
Olympic Sports Center Berlinsan Taekwondo e.V. Adnan Karabulut
berlintaekwondo.de Adnan Karabulut Taekwondo Berlin
312 Wohnungsauflösung Berlin 030 wohnungsauflö
10783
Berlin
Wohnungsauflösung Berlin günstig und schnell von Complett Räumung 030 261 01 714
berlin-wohnungsaufloesung.de Wohnungsauflösung Berlin Wohnungsauflösungen Entrümpelung En
313 RAe Böhm & MeyerDulheuer §§
10783
Berlin
Rechtsanwälte Rechtsanwalt Matthias Böhm Notar Helmuth MeyerDulheuer RA RAe §
boehmmeyerdulheuer.de §§ § Rechtsanwälte
314 Astrid Elisabeth Stebich
10783
Berlin
Astrid Elisabeth Stebich Make up Artist & Friseurmeisterin aus Berlin. Make up & Haare
elice-beth.de
315 Home www.berlinevangelisch.de Gesellschaft fĂŒr Unternehmenskommunikation mbH & Co. KG Abgeltungssteuer
10783
Berlin
www.berlinevangelisch.de – Das ServicePortal der Evangelischen Kirche in Berlin.
berlin-evangelisch.de Abgeltungssteuer Advent Austritt Bach Berlin
316 Berlin Apartments Potsdamer Str Berlin
10783
Berlin
Apartments in Berlin nähe Potsdamer Platz für Gruppenreisen Gruppenunterkunft
berlin-aparts.de Berlin Apartments Berlin Gruppenreise
317 Bar Voyage barvoyages bar
10783
Berlin
Bar CafĂ© Kleinkunstbühne
barvoyage.de Bar Berlin Kleinkunst Berlin
318 Home ‱ Kunstsaele Berlin Kunstsaele
10783
Berlin
Die Kunstsaele Berlin verbinden Galerie Sammlung und Kulturprojekte an einem Ort. Neben den wechselnden
kunstsaele.de Kunstsaele Oehmen Bergmeier
319 WerbeartikelAgentur für Fahrradsattelbezüge
10783
Berlin
Kultkeks ist Ihr Partner für individuelle Werbemittel und Werbegeschenke. Unser Sortiment reicht von der Handysocke
kultkeks.de
320 TRIO PALMERA Salsa
10783
Berlin
Seit nunmehr 26 Jahren ist das TRIO PALMERA unterwegs um landesweit und über die Landesgrenzen
josefinol.de Salsa Cumbia Merengue
321 Home Labbow Personalleasing e.K.
10783
Berlin
Personalberatung und dienstleistungen
labbow-personalleasing.de
322 Marian Kiss Marian
10783
Berlin
Marian Kiss Film Berlin Filmemacherin Filmmaker Regiesseurin Director
mariankiss.de Marian Kiss Film
323 Marianne Rosenberg | RoseWeb Public Image GmbH Marianne
10783
Berlin
Die offizielle Website von Marianne Rosenberg mit aktuellen Infos SongDownloads Biografie Diskografie
rosenberg.de Marianne Rosenberg Pop
324 MännerMinne e.V. Erster schwuler choir
10783
Berlin
MännerMinne e.V. Erster schwuler Männerchor Berlin gegründet 1987 Mitglied im Berliner Sängerbund.
maennerminne.de Choir Chorus Gay
325 | MARTINA DOEHRING | c/o Formblitz AG Martina
10783
Berlin
Dies ist die offizielle Website der Sopranistin Martina Doehring
martinadoehring.de Martina Doehring Sängerin
326 EVA GmbH EVA GmbH
10783
Berlin
KFZ Reparatur oder Ausfuhrversicherung:sofort in unserem OnlineShop. Auch Gebrauchtwagengarantie und Finanzierung für Privatpersonen und Händler
eva-evb.de
327 Diversitygendertraining.de joomla
10783
Berlin
Joomla! dynamische PortalEngine und ContentManagementSystem
energydeal.de Joomla Joomla
328 :: Keding / ESS Keding / ESS Elektronische Sicherheitssysteme GmbH / Keding GmbH & Co. KG sicherheitssystem
10783
Berlin
ESS GMBH Planung Lieferung Montage Inbetriebnahme von elektronischen Signal und Anzeigeanlagen
ess-sicherheit.de Sicherheitssysteme Alarmanlagen Brandmeldetechnik Brandmelder Brandmeldeanl
329 Hauptstadtplan | interaktiver stadtplan Adler & Schmidt GmbH Bundeshauptstadt
10783
Berlin
Interaktiver häusergenauer Stadtplan der Berliner Innenstadt. Suchmöglichkeit nach den Kategorien Sehenswürdigkeiten Kultur Regierungsbauten
hauptstadtplan.de Bundeshauptstadt Berlin Hauptstadt Bundesregierung Reichstag
330 Home GmbH & Co. KG ML4
10783
Berlin
Personalleasing ML4 Personalmanagement GmbH & Co.
ml4-dienstleistungen.de ML4 ML4Personalmanagement ML4
331 Keding GmbH & Co.KG Integral
10783
Berlin
IntegralSecurity Integralsecurity Integral Security Integral Security Antennentechnik und Sicherheitstechnik Alarmanlagen Brandmeldeanlagen Einbruchmeldeanlagen Videoüberwachung und mehr)
keding.de Integral Security IntegralSecurity Integralsecutity Integral
332 Start Kauffeld und
10783
Berlin
Kauffeld und Jahn
kauffeldundjahn.de
333 Willkommen bei Pascha Grill joomla
10783
Berlin
Joomla! dynamische PortalEngine und ContentManagementSystem
pascha-grill.de Joomla Joomla
334 PartytechnikBerlin Verleih von Berlin
10783
Berlin
Partytechnik Berlin verleiht Lichttechnik und Tontechnik für Eure Party/Veranstaltung
partytechnik-verleih-berlin.de Berlin Partytechnik Verleih Party Verleih
335 Home
10783
Berlin
Tierärzte Tierarztpraxis Marianne Gass
petstation.de
336 Willkommen bei perko profundus! Perko
10783
Berlin
perko profundus
perko-profundus.de Perko Gudrun Profundus Wissenschaftscoach Education
337 Ludger Jungnitz Men's Maenner
10783
Berlin
Ludger Jungnitz Men's Care Men's Studies
mensstudies.de Maenner Lebensqualitaet Gesundheit
338 Berlin Apartments Potsdamer Str Berlin
10783
Berlin
Apartments in Berlin nähe Potsdamer Platz für Gruppenreisen Gruppenunterkunft
cityapartsberlin.de Berlin Apartments Berlin Gruppenreise
339 HumanistischSystemische Beratung Frank systemisch
10783
Berlin
Erkennen und Auflösen von Verstrickungen Familienstellen Psychodrama Gestaltherapie Trauma
frankstamer.de Systemisch Familienstellen Aufstellung
340 Flowers of life Flowers
10783
Berlin
Flowers of life richtet sich an alle Menschen die Begleitung Gesellschaft oder eine persönliche
flowers-of-life.de Flowers Of Life Brigitte
341 INTEGRAL SECURITY Sicherheitstechnik Keding GmbH & Co. KG IntegralSecurity
10783
Berlin
Sicherheitstechnik von Integral Security dem deutschlandweiten Firmenverbund für Sicherheitstechnik (Alarmanlagen Brandmeldeanlagen Einbruchmeldeanlagen
integralsecurity.de IntegralSecurity Sicherheitstechnik Integral
342 IJam.de – mediendesign Webdesign
10783
Berlin
10 Schritte zur eigenen Website | iJam.de Mediendesign
ijam.de Webdesign Mediendesign Homepage
343 Startseite » Gesine Palmer » Herzlich Willkommen auf Gesine
10783
Berlin
Dr. Gesine Palmer leitet das Berliner Büro für besondere Texte. Die Religionsphilosophin bietet Kommunikationsberatung und
gesine-palmer.de Gesine Palmer Redenschreiben
344 Politikmanagement mit Gitta Stieber Politikmanagement
10783
BERLIN
Gitta Stieber Berlin Politikmanagement Qualifizierung und Weiterbildung die Sie in sozialen
gittastieber.de Politikmanagement Kommunikation SoftSkills
345 Gift Music Gift Music GmbH Weltmusik
10783
Berlin
Ein kleines Weltmusiklabel aus Berlin
giftmusic.de Weltmusik Label Berlin
346 GEAG Immobilienverwaltung Berlin:Wir verwalten GEAG Immobilienverwaltungs GmbH Wirtschaft
10783
Berlin
GEAG Immobilienverwaltungs GmbH: kompetente Verwaltung und Betreuung von Immobilien in Berlin Brandenburg Sachsen
geag-berlin.de Wirtschaft Immobilien Immobilienverwaltung
347 Business Development Germany German
10783
Berlin
We bring your business on the German market – contact us today!
business-development-germany.de German Companies German Marketing
348 Moritz Tilman Achelis | rechtsanwalt
10783
Berlin
Rechtsanwalt Arbeitsrecht Achelis Baurecht Architektenrecht Grundstücksrecht Wohnungseigentumsrecht Medizinrecht
ra-achelis.de Rechtsanwalt Arbeitsrecht Achelis
349 RDM: Startseite Landesverband Berlin und Brandenburg e.V. rdm
10783
Berlin
RDM Ring Deutscher Makler Landesverband Berlin und Brandenburg e.V.
rdm-berlin-brandenburg.de Rdm Ring Deutscher
350 Startseite Willkommen
10783
Berlin
Willkommen:  
hd-computer24.de
351 Rita Leinenweber · Astrologie Astrologie
10783
Berlin
Ich freue mich Ihnen meine Kenntnisse in Astrologie Massage & energetischen Heilweisen
ritaleinenweber.de Astrologie Horoskop Geburtshoroskop
352 GEAG Immobilienverwaltung Berlin:Wir verwalten GEAG Immobilienverwaltungs GmbH Wirtschaft
10783
Berlin
GEAG Immobilienverwaltungs GmbH: kompetente Verwaltung und Betreuung von Immobilien in Berlin Brandenburg Sachsen
sabinespehr.de Wirtschaft Immobilien Immobilienverwaltung
353 Rundum Ich Ihr massage
10783
Berlin
Massage Ernährungsberatung Fitness und Personal Training Hypnosetherapie in Berlin für Privatkunden
rundum-ich.de Massage Ernährung Hypnose
354 Astrologische Gesundheits und Lebensberatung Astrologie
10783
Berlin
Astrologische Gesundheits und Lebensberatung Yvonne v. Bechtolsheim: Astrologie Reiki Ernährungsberatung und Radionik in
schwarzer-second-hand-shop.de Astrologie Reiki Ernährungsberatung
355 Roger Thilo EDV Service Roger
10783
Berlin
Wir bieten ITLösungen im Businessbereich für alle Branchen und Unternehmensgrößen. innovativ zuverlässig
rthilo.de Roger Thilo EDV Service
356 PROBase easy PROFORMA GmbH & Co. KG CMS
10783
Berlin
Mit PROBase easy erstellen wir individuell hochwertige Webauftritte Sie brauchen nur noch die Texte
pro-base-easy.de CMS ContendManagemnetSystem Contend
357 Sm hope ick Kindermode
10783
berlin
Die Teilnahme am Wettbewerb „Meine Heimat“ auf der Kreativplattform Dawanda.de war Anlass Designs zu
smhope.de Kindermode
358 LOOK22 Home LOOK22 LOOK22
10783
Berlin
LOOK22 MediaService ~ zielgruppenoptimiertes Webdesign ~ aussagekräftige Fotografie ~ perfekte Grafik ~ treffsichere Texte ~
look22.de LOOK22 MediaService Internet Fotografie Grafik
359 Raumdesignerin .Silke Smida. kunst
10783
Berlin
Art by Silke Smida composed drawings find new places!
raumdesignerin.de Kunst Design Graffiti Wandtattoos Acryl
360 BEGINE Treffpunkt und Frauen
10783
Berlin
Interkulturelles Frauenkulturzentrum Künstlerinnenförderung Konzerte Ausstellungen Potsdamer Str. 139 BerlinSchöneberg
begine.de Frauen Lesben Frauencafé
361 Complett Räumung | Wohnungsauflösung wohnungsauflö
10783
Berlin
Wohnungsauflösung Berlin günstig und schnell von Complett Räumung 030 261 01 714
complett-berlin.de Wohnungsauflösung Berlin Wohnungsauflösungen Entrümpelung En
362 Contravision breaking news contra medienwerkstatt e.v. ContraVision
10783
berlin
short film festival in berlin germany march 20th to march 28th
contravision.de ContraVision Cinema Contra
363 Doktus.de Dokumente uploaden FORMBLITZ AG doktus
10783
Berlin
Hier findet man Dokumente zu allen Themen und kann Dokumente suchen verwalten
doktus.de Doktus
364 | MARTINA DOEHRING | c/o Formblitz AG Martina
10783
Berlin
Dies ist die offizielle Website der Sopranistin Martina Doehring
martina-doehring.de Martina Doehring Sängerin
365 Wolfgang Kommerell | kommerell.de Wolfgang
10783
Berlin
Website von Wolfgang Kommerell: Segeln Fotografie.
kommerell.de Wolfgang Kommerell Fotografie
366 Marianne Rosenberg | RoseWeb Public Image GmbH Marianne
10783
Berlin
Die offizielle Website von Marianne Rosenberg mit aktuellen Infos SongDownloads Biografie Diskografie
roseclub.de Marianne Rosenberg Pop
367 Linux auf CD/DVDR linux
10783
Berlin
LinuxDistributionen auf CDR und DVDR tuxpost.de Shop
tuxpost.de Linux Iso Shop
368 Home Texts and Birgit
10783
Berlin
Dr. Birgit Hollenbach brings language and science together. Her university studies of translation and biochemistry
textsandtranslations.de Birgit Hollenbach Translation
369 .:|Stadtrundfahrten|Originelle Alternative Stadtrundfahrt|Berliner Dialekt Berlin
10783
Berlin
| BerlinerSchnauze Stadtrundfahrten | Alternative Stadtrundfahrt im Berliner Dialekt | Mundart sehr Orginelles Geschenk
berliner-schnauze.de Berlin Stadtrundfahrt Stadtrundfahrten Information Private
370 Übersetzer Deutsch Rumänisch Rumänisch
10783
Berlin
Übersetzungen Deutsch Rumänisch Dolmetscher für Rumänisch in Berlin profesionelle Übersetzung kundenorientiert
turbatu-translations.de Rumänisch Übersetzer Deutsch Rumänisch
371 Home / tausendschwarz.de Angebot
10783
Berlin
HomepageTitel Berlin
tausendschwarz.de Angebot Kompetenz Beratung
372 Subversionen.de | praeludium
10783
Berlin
——— Beuys + Agnoli
subversionen.de
373 Betreutes Wohnen in Demenz betreutes
10783
Berlin
Der FAW e.V. begleitet und verwaltet ambulant betreute Wohngemeinschaften für Menschen mit Demenz.
verein-faw.de Betreutes Wohnen Demenz Wg
374 TRIO PALMERA Salsa
10783
Berlin
Seit nunmehr 26 Jahren ist das TRIO PALMERA unterwegs um landesweit und über die Landesgrenzen
trio-palmera.de Salsa Cumbia Merengue
375 Astrologische Gesundheits und Lebensberatung Astrologie
10783
Berlin
Astrologische Gesundheits und Lebensberatung Yvonne v. Bechtolsheim: Astrologie Reiki Ernährungsberatung und Radionik in
sternen-klar.de Astrologie Reiki Ernährungsberatung
376 Italienische Weine Online Weine
10783
Berlin
Vinila Weine aus Italien. Wer via eCommerce in Deutschland die besten italienischen Weine online
vinila.de Weine Wein Aus Italien
377 NAS Planung & Baumanagement Nas Planung & Baumanagement GmbH & Co. KG Berlin
10783
Berlin
NAS Planung & Baumanagement GmbH & Co. KG Telefon +49 (0)30. 216 95 45
xn--nas-planungsbro-cwb.de Berlin Ahmet Nas
378 AllmendeKontor Gemeinschaftsgarten Allmende-Kontor e.V.
10783
Berlin
Allmende = Gemeingut = Commons: Berliner AllmendeKontor Gemeinschaftsgarten und eine der größten Hochbeetanlagen der
allmende-kontor.de
379 Beste Hunde: OnlineMagazin für
10783
Berlin
Das Online Hundemagazin mit aktuellen Artikeln zu Gesundheit Ernährung Erziehung und Verhalten
bestehunde.de
380 Berliner Schlagerfest 2012 berliner
10783
Berlin
Das Berliner Schlagerfest geht in die 2. Runde.
berliner-schlagerfest.de Berliner Schlagerfest 2012 Schlagerfest Berlinmitte
381 Birgit Schlieps Birgit
10783
Berlin
Urban Sculpture. Die Künstlerin Birgit Schlieps arbeitet mit dem urbanen Raum als Phantom Mythos
birgitschlieps.de Birgit Schlieps Kunst
382 Startseite Willkommen
10783
Berlin
Willkommen:  
ep-store.de
383 Business Development Germany German
10783
Berlin
We are the leading German Marketing Company bringing your business on the German market. Our
cockpit-germany.de German Companies German Marketing
384 Coworkingberlinsquarehaus.de coworkingberlinsquarehaus Webseite! Square Haus am Nollendorfplatz GmbH
10783
Berlin
SquareHaus work meet share collaborate coworking büros konferenzraum
coworking-berlin-squarehaus.de
385 Business Development Germany German
10783
Berlin
We are the leading German Marketing Company bringing your business on the German market. Our
dashboard-germany.de German Companies German Marketing
386 Herzlich Willkommen Willkommen Forner + Forner GbR
10783
Berlin
Als kreatives und innovatives Unternehmen für Beratung und Kommunikation möchten wir Sie als vertrauensvoller Partner
ff-beratung.de
387 Home Schwarzweiß
10783
Berlin
Neue Wege Neue Sichten Neue Fotografien Du möchtest besser wahrnehmen und kreativ sein
fotografisch-sehen-lernen.de SchwarzweißFotografie Konzeptfotografie Fotografisch
388 Fotostudio Altman. Hochzeit Wettbewerb Studioalex.de
10783
Berlin
Suchen Sie einen professionellen Fotografen mit über 25 Jahre Erfahrung in der Fotografie? Dann sind
fotostudioalex.de Studioalex.de Hochzeit Wettbewerb Meine Traumhochzeit!
389 DIF | Dit is mirapodo – operated by myToys.de GmbH
10783
Berlin
DAS Berliner Modeblog zu Fashiontrends und Modesünden Parties und Veranstaltern Designern und Kollektionen
dit-is-fashion.de
390 Heilpraxis Susanne Weis Heilpraxis
10783
Berlin
Heilpraxis Susanne Weis
heilpraxisweis.de Heilpraxis KLANGTHERAPIE HOMÖOSYNERGETIK AUSLEITUNG ERNÄRUNG
391 BAKUNAPOLI BakuNapoli
10783
Berlin
BAKUNAPOLI.Aserbaidschanische und italienische Küche.
baku-napoli.de BakuNapoli Restaurant Berlin Aserbaidschanische Küche
392 Kristina Jacoby Startseite Ghostwriter
10783
Berlin
Kristina Jacoby unterstützt Autoren bei der Erstellung ihrer Bücher
kristinajacoby.de Ghostwriter Ghostwriting Wissenschaftliches
393 Startseite Klinisches Krebsregister Klinisches Krebsregister fĂŒr Brandenburg und Berlin gGmbH Klinisches
10783
Berlin
Informationen zur klinischen Krebsregistrierung in Brandenburg
kkrbb.de Klinisches Krebsregister Brandenburg
394 Kniggeinberlin.de Willkommen bei Knigge
10783
Berlin
Gesellschaftlicher Schliff selbstsicheres und stilvolles Auftreten ist heute wichtiger denn je. Jeder kann Benehmen
knigge-in-berlin.de Knigge Seminare KniggeSeminare Benehmen Benimmkurse
395 PROJECT318 photography
10783
Berlin
Homepage für die Vernissage / Ausstellung PROJECT318 der SRH Hochschule der populären Künste (hdpk).
project318.de Photography Design Motion
396 Ludger Jungnitz Prozessbegleitung Prozessbegleitung
10783
Berlin
Prozessbegleitung Berlin Ludger Jungnitz
prozessbegleitung-berlin.de Prozessbegleitung Coaching Projekte
397 SPAM Magazin SPAM
10783
Berlin
SPAM Magazin Ausgabe 01
spam-music.de SPAM; Magazin Musik
398 Text Julia Richter
10783
Berlin
Erstklassige Unternehmenskommunikation Texte und Konzepte in Berlin
text-juliarichter.de
399 ReBuy der einfache An reBuy reCommerce GmbH gebraucht
10783
Berlin
An und Verkauf für gebrauchte Handys Tablets Videopiele Filme CDs
rebuy.de Gebraucht Kaufen Gebraucht Verkaufen
400 Pasta e PiĂč Startseite Frische
10783
Berlin
Frische Pasta in Berlin
pasta-e-piu.de Frische Pasta Berlin Raviolli Ghnochi
401 Aktuelles Bürgerinitia
10783
Berlin
Stadtplanung von unten Stadtentwicklung TempelhofSchoeneberg Berlin
stadtplanung-von-unten.de Bürgerinitiative Bürgerbegehren Bürgerentscheid Anwohnervers
402 Taxi Bildungscenter Berlin Treffpunkt Bildung GmbH Taxischein
10783
Berlin
Wir schulen seit 18 Jahren erfolgreich auf die Ortskundeprüfung mit eigenem ständig aktuellem
taxi-bildungscenter.de Taxischein PSchein Taxifahrer Fahrgastbeförderung Ortskundeprüfun
403 Studio NiMa Produktion Mode Kauffeld und Jahn GbR
10783
Berlin
Vom Entwurf bis zur Produktion. Mode und Textil. Studio NiMa ist in der Bekleidungsindustrie
studionima.de
404 Schuhe Online Shop myToys, mirapodo und ambellis - Shops der myToys.de GmbH
10783
Berlin
Schöner Schuhe shoppen ♄ riesige Auswahl für Damenschuhe ✓ Herrenschuhe ✓ und Kinderschuhe ✓ Bestellen
mirapodo.de
405 Yoga in Kreuzberg Yoga
10783
Berlin
Yoga in Berlin an Ihrem Arbeitsplatz oder besuchen Sie YogaKurse in Berlin Kreuzberg mit
yoga-und-massage.de Yoga Am Arbeitsplatz Yoga
406 MyToys | Alles für myToys, mirapodo und ambellis - Shops der myToys.de GmbH
10783
Berlin
myToys Ihr OnlineShop für Spielzeug Kindermode Babyausstattung und vieles mehr. Über 100.000
mytoys.de
407 Werbung auf dem Sattelschoner|
10783
Berlin
Sattelschützer als Werbemittel: Bedrucken Sie Sattelbezüge mit Ihrem Logo. Individuelle Gestaltungsmöglichkeiten Lieferung nach drei
kultsattel.de
408 Finest Whisky Shop Whisky
10781
Berlin
Unsere Philosophie ist es hochwertige seltene und alte Flaschen der verschiedensten Destillen und Abfüller
finestwhisky.de Whisky Verkauf Berlin
409 Black meadow music production Martin Klein und Christian Kociolek GbR
10781
Berlin
black meadow music production is a label situated in Berlin.
black-meadow.de
410 Immocollect.de by Portal Financecollect Immocollect.de by Portal Financecollect GmbH Immocollect.de
10781
Berlin
Immobilienangebote von Immocollect.de by Portal Financecollect GmbH
immocollect.de Immocollect.de By Portal Financecollect GmbH
411 Simply : pr + simply
10781
Berlin
simply : die PR und Marketing Agentur für erklärungsbedürftige Produkte! fon +49 (0) 30. 21
agentur-simply.de Simply Public Relation
412 Ashtanga Yoga Schule Berlin Ashtanga
10781
Berlin
Ashtanga Yoga Schule in Berlin Schöneberg am Winterfeldtplatz Pallasstr. 89 10781 Berlin
ashtangayogaschoeneberg.de Ashtanga Yoga Berlin Schöneberg
413 Rosenscharf und Edelsüß Catering ZOE
10781
Berlin
Restaurant ZOE Berlin. Asiatische und mediterrane Küche zwischen Hackeschem Markt und Alexanderplatz in Berlin Mitte.
aromamanufaktur.de ZOE Restaurant Lounge
414 Online Marketing: Wissen &
10781
Berlin
Endlich von Online Marketing profitieren. Portal & Ratgeber für erfolgreiches Internetmarketing mit Grundlagen & Tipps
omkt.de
415 :: NATURKOSMETIK CALLA
10781
Berlin
Fachgeschäft für Naturkosmetik und Naturwaren. Kosmetische Behandlungen nach Dr. Hauschka und M.Gebhardt.
calla-naturkosmetik.de
416 Architektur Planung Beratung
10781
berlin
Architekten Hannover Berlin Architekturplanung Bauberatung Projektentwicklung Wertermittlung Architektur architectura nova
chocmoc.de
417 ChristianErdmann.de Christian
10781
Berlin
Willkommen auf der privaten Site von Christian Erdmann. Erfahren Sie mehr über meine Dozententäigkeit und
christian-erdmann.de Christian Erdmann Dozent Verwaltungsrecht Doppik.kom.bb
418 Christine Ordnung | Home xxxxx
10781
Berlin
xxxxx
christine-ordnung.de Xxxxx
419 CORINO 4 MEN CorinoArt
10781
Berlin
Photographer for beauty nude art fashion faces lingerie interieur
corino4men.de CorinoArt Photography Fotografie
420 Claudia Scholl Aktuelle Claudia
10781
Berlin
Claudia Scholl Buchkonzeption Gestalterische Konzepte Kinderkunstprojekte Illustration und Corporate Design
claudia-scholl.de Claudia Scholl Berlin Kartonzauber Grafikdesign
421 URBANIS Startseite URBANIS GmbH URBANIS
10781
Berlin
Herzlich willkommen bei der URBANIS GmbH
bvg-holding.de URBANIS Berlin Unternehmen
422 Home Chatwins Chatwin
10781
Berlin
CHATWINS: Bücher rund ums Reisen gibt es hier nach Ländern und Kontinenten sortiert. Reisen heißt:
chatwins.de Chatwin Chatwins Bruce Chatwin A
423 52. DeutschFranzösisches Volksfest Schaustellerverband Berlin e.V. Deutsch
10781
Berlin
Das mit Abstand größte jährliche Volksfest in Berlin Willkommen auf über 40.000mÂČ Erlebnisfläche!
deutsch-franzoesisches-volksfest.de Deutsch Französisches Volksfest Laune
424 Beateberlin AGENTUR FÜR EVENTS beateberlin
10781
Berlin
beateberlin Agentur für Events und Stadterlebnisse in Berlin und Umgebung
beateberlin.de Beateberlin Agentur Agency
425 Berliner Berufsverband der Gesundheitsaufseher/Hygieneinspektoren BBGH
10781
Berlin
Der Berliner Berufsverband der Gesundheitsaufseher/Hygieneinspektoren stellt sich vor und bietet Informationsmaterial rund um den öffentlichen
bbghev.de BBGH BVH Hygiene
426 Organisationsberater Berater für Bio
10781
Berlin
Unternehmensberater für Ökologische Landwirtschaft (Biolandbau) und Biomarkt (Biohandel) – Experte für Bio Lebensmittel und Biolandbau
bio-projektmanagement.de Bio Lebensmittel Bioprodukte
427 BeGreen Netzwerk für nachhaltiges beGreen Netzwerk fĂŒr nachhaltiges Wirtschaften e.V. Verein
10781
Berlin
Alles Wissenswerte von der Historie über Ergebnisse Veranstaltungen und neueste Trends bis hin zur
begreen-net.de Verein Mitgliedschaft Beitrittserklärung
428 IOB Internationale OmnibusBetreibergesellschaft ZOB
10781
Berlin
ZOB Zentraler Omnibusbahnhof Berlin an Funkturm und Messegelände:
berlinzob.de ZOB Zentraler Omnibusbahnhof Berlin APC
429 Blauwerke verlag # groschenhefte blauwerke
10781
Berlin
Verlag aus Berlin fuer konkrete Literatur und konkrete Wissenschaft. Gebrauchstexte für die Westentasche.
blauwerke-berlin.de Blauwerke Blauwerke Berlin
430 Werbe und Vertriebsmangement GSW
10781
Berlin
Die “ FIGARO news” sind das GSW Club Magazin für die Mieter der GSW Immobilien
effektivwerbung24.de GSW Club Figaro News
431 Elena nehrmann promotion
10781
Berlin
Kultur Kommunikation
elenanehrmann.de Promotion P.r. Pr
432 MACKE Boutique Berlin
10781
Berlin
Mode ist Kultur Entsprechend diesem Motto bieten wir Ihnen stil und anspruchsvolle Mode und
macke-berlin.de
433 DigitalphotoBerlin Foto
10781
Berlin
Phototechnik Fehling Fotografie Bearbeitung Entwicklung Vergrößerung von Diabildern Digitalfotografien
digitalphoto-berlin.de Foto Fotografie Photo
434 Diethard Küster Regisseur
10781
Berlin
Diethard Kžster Regisseur Produzent Autor Regie Produktion
diethard-kuester.de
435 HOME MEDIATION
10781
Berlin
ALEXANDER STAUBACH | MEDIATION | STAUBACHBERATUNG
staubach-beratung.de MEDIATION | KONFLIKT | KONFLIKTKLÄRUNG
436 BEOBOOKS Bücher aus Bücher
10781
Berlin
BEOBOOKS Bücher aus Serbien Katarina Belovukovic
beo-books.de Bücher Serbien
437 Bettina Willumeit | Styling bettina
10781
Berlin
innovatives kundenorientiertes Fashion Styling für die Bereiche Werbung Editorialproduktionen und Onlinevermarktung
bettina-willumeit.de Bettina Willumeit Stylistin
438 HOME
10781
Berlin
HOME
kunsttherapieraum.de
439 Joomla Toplist Hauptseite joomla
10781
Berlin
Dies ist die deutsche JoomlaTopseitenliste. Hier finden Sie die wahrscheinlich besten Seiten die mit
joomla-toplist.de Joomla Toplist Best
440 Jugendhilftweiter.de Jugend
10781
Berlin
Modellprojekt Jugendräte: Eine Homepage von den Jugendräten des Modellprojekts Jugendräte von Berlin SchönebergNord
jugend-hilft-weiter.de Jugend Hilft Weiter
441 LumpenPrinzessin ... Kinderkleidung Kinderkleidung
10781
Berlin
Die LumpenPrinzessin bietet seit über 15 Jahren Alles für Baby und Kind in gut erhaltener
lumpenprinzessin.de Kinderkleidung Kindermode Kinderschuhe
442 Herzlich Willkommen auf LittleThailand.de thai
10781
Berlin
Die neuesten und beliebtesten ThaiMassagen ThaiRestaurants Shops und mehr Mit vielen Bewertungen
little-thailand.de Thai Verzeichnis übersetzer Shops Restaurants
443 Evelyn Bornemann Berlin Berlin
10781
Berlin
Evelyn Bornemann in Berlin Physiotherapie Psychotherapie (HPG) Coach nach der TippingMethode hilft
evelyn-bornemann.de Berlin Physiotherapie Psychotherapie
444 ||| EuroKaukAsia     EuroKaukAsia e.V.
10781
Berlin
KaukasischEuropäischer Kultur und Wissenschaftsverin e.V.
eurokaukasia.de
445 Excelle.consulting | Produktions und excelle.consultin
10781
Berlin
excelle.consulting bietet kundenindividuelle Lösungen zu Fragen der strategischen Unternehmensentwicklung und der Gestaltung operativer Leistungsstrukturen sowie
excelle-consulting.de Excelle.consulting Excelle Excelle.de
446 F/21 Büro für Nora
10781
Berlin
f/21 Büro für Zukunftsfragen ist Beratungsinstitut und Denkfabrik. f/21 beobachtet die Gegenwart identifiziert
f-21.de Nora Stampfl Nora S. Stampfl
447 MEHR ALS STERNE |
10781
Berlin
Natalia Domagala
mehr-als-sterne.de
448 Investieren wie die Superreichen Investieren
10781
Berlin
Wie auch Sie schnell und einfach die Investments der Superreichen finden die nur ein
superreichtum.de Investieren Geld Anlegen
449 Mediation in Diversity Mediation
10781
Berlin
Mediation in Konfliktfällen Preisgünstige Mediationsausbildung nach anerkannten Standards von Bundesverbänden oder erfahrene Mediatoren? Kontaktieren
meddiv.de Mediation Berlin Mediationsausbildung Berlin
450 Jura Service Berlin | kaffeevollautomat
10781
Berlin
Jura Service Berlin| Kaffeemaschine u. Kaffeeautomat ReparturWartung u. Kundendienst in Berlin.Reparaturen von Kaffeemaschinen u.
jura-service-berlin.de Kaffeevollautomaten Reparatur Jura Service Kaffeemaschinen
451 Kanzlei Klaus Koblitzek homepage
10781
Berlin
homepage dokument webpage page web netz
kanzlei-koblitzek.de Homepage Dokument Webpage Page Web
452 Kanzlei Rechtsanwalt Böcker joomla
10781
Berlin
Joomla! dynamische PortalEngine und ContentManagementSystem
kanzleiboecker.de Joomla Joomla
453 Rechtsanwaltskanzlei und Notariat Michael Rechtsanwalt
10781
Berlin
Rechtsanwaltskanzlei und Notariat Michael Müller Rechtsanwalt und Notar Michael Müller in Berlin Schöneberg berät
kanzlei-mmueller.de Rechtsanwalt Notar Berlin
454 Schauspieler Coaching Berlin Karin
10781
Berlin
Mit dem KarriereTraining für Schauspieler durchstarten und dranbleiben. Die eigene Karriere lustvoll und aktiv gestalten.
karin-kleibel.de Karin Kleibel PR
455 LumpenPrinzessin ... Kinderkleidung Kinderkleidung
10781
Berlin
Die LumpenPrinzessin bietet seit über 15 Jahren Alles für Baby und Kind in gut erhaltener
kind-in-berlin.de Kinderkleidung Kindermode Kinderschuhe
456 Claudia Scholl Aktuelle Claudia
10781
Berlin
Claudia Scholl Buchkonzeption Gestalterische Konzepte Kinderkunstprojekte Illustration und Corporate Design
kartonzauber.de Claudia Scholl Berlin Kartonzauber Grafikdesign
457 Krups | Siemens | aeg
10781
Berlin
Krups | Siemens | AEG | ReparaturServiceWartung und Kundendienst in Berlin.Kaffeemaschinen und Kaffeevollautomaten
kaffeemaschine-reparatur.de Aeg Krups Siemens Kaffeevollautomaten Kaffeemaschinen
458 Home
10781
Berlin
Elzers Seiten zum Wohnungseigentumsrecht
oliverelzer.de
459 Patwork
10781
Berlin
Feinmechanik
pat-work.de
460 Peter Bruns Homepage Peter
10781
Berlin
Homepage von Peter Bruns
peterbruns.de Peter Bruns Cello
461 Rechtsanwälte PfaffHofmann u. Lee Rechtsanwalt
10781
Berlin
Die Rechtsanwaltskanzlei PfaffHofmann u. Lee legal Rechtsanwaltsgesellschaft bietet eine und zielorientierte Beratung. Schwerpunkt Wirtschaftsrecht z.B.
phl-legal.de Rechtsanwalt Rechtsanwaltskanzlei Arbeitsrecht
462 ..::Phoenix Lounge::.. Phoenix
10781
Berlin
Phoenix Lounge. Bar Restaurant Cafe in Schöneberg.
phoenix-lounge.de Phoenix Lounge Phoenix
463 Physimetron Elektronische Messtechnik Transimpedanzvers
10781
Berlin
Rauscharme analoge und digitale elektronische Messtechnik
physimetron.de Transimpedanzverstärker Pikoamperemeter Vorverstärker
464 Mobilienberlin.de living
10781
Berlin
mobilien: die schönen dinge zum leben wohnen und arbeiten! besuchen sie uns in berlinschöneberg...
mobilien-berlin.de Living Wohnen Wohnaccessoires
465 Otto Events Veranstaltungstechnik veranstaltungstec
10781
Berlin
Otto Events organisiert Ihre Veranstaltung in Berlin Brandenburg und Potsdam. Wir vermieten Veranstaltungstechnik
ottoevents.de Veranstaltungstechnik Berlin Potsdam
466 Naturheilpraxis im Hofbogen behandlung
10781
Berlin
Naturheilkunde Praxis Hofbogen Heilung Anwendung Rheuma Therapie Heilpraktiker
heilpraktikerin-schoeneberg.de Behandlung Therapie Körper
467 HALBE STUNDEN // HALF Kurzfilm
10781
Berlin
Film
halbestunden.de Kurzfilm Leere Familie
468 Flamencomeetsclassic flamenco
10781
Berlin
flamencomeetsclassic ist ein Tanztheater aus Berlin das klassische Texte Flamencomusik und Tanz zu
flamenco-meets-classic.de Flamenco Tanz Tanztheater
469 Flats & Co. Flats & Co. GmbH Waldmannstr.
10781
Berlin
Eigentumswohnungen Waldmannstr. 3 BerlinLankwitz
flatsandco.de Waldmannstr. 3
470 Praxis für integrale Medizin Integral
10781
Berlin
Arztpraxis Dr. Martin Bosch BerlinSchöneberg
integralmedicine.de Integral Medicine Arztpraxis
471 Startseite
10781
Berlin
Anwälte & Steuerberater PSInkasso
inkasso-in-berlin.de
472 Gerd Brendel | Journalist Gerd
10781
Berlin
Gerd Brendel Journalist
gerdbrendel.de Gerd Brendel Journalist
473 Autorin Martina Gneist CBT
10781
Berlin
Autorin Martina Gneist Projekte und Philosophie
gn-konzepte.de CBT WBT Lernkonzepte
474 Startseite hanslux Open
10781
Berlin
Beratung und Dienstleistungen für Computer Netze und ITSicherheit unter Verwendung von OpenSource Produkten
hanslux.de Open Source Freie Software
475 Theater Hans Wurst Nachfahren Grüffelo
10781
Berlin
Hans Wurst Nachfahren Theater für Kinder und Erwachsene in BerlinSchöneberg zeigt Spielplan
hasn-wurst-nachfahren.de Grüffelo Puppentheater Berlin
476 Organisationsberater Berater für Bio
10781
Berlin
Unternehmensberater für Ökologische Landwirtschaft (Biolandbau) und Biomarkt (Biohandel) – Experte für Bio Lebensmittel und Biolandbau
handel-und-wandel.de Bio Lebensmittel Bioprodukte
477 Fachanwalt für Arbeitsrecht Berlin Fachanwalt
10781
Berlin
Fachanwalt für Arbeitsrecht Erbrecht und Versicherungsrecht in Berlin sowie Notar Berlin. Kanzlei Gäbelein &
gaebelein-veith.de Fachanwalt Arbeitsrecht Versicherungsrecht
478 DFRV Regionalgruppe Berlin
10781
Berlin
| Website der Regionalgruppe Berlin des Deutschen Fundraising Verbands
fundraisingverband-berlin.de
479 Fußballwörterbuch in 7 Sprachen
10781
Berlin
FußballWörterbuch in 7 Sprachen: Homepage des Buches von Kaya Yildirim
fussballwoerterbuch.de
480 Felicitas Jacobs Theaterpädagogin Theater
10781
Berlin
Ich biete vielfältige theaterpädagogische Qualifikationen als Ausbildung oder Fortbildung initiiere theatrale Prozesse und entwickle
felicitasjacobs.de Theater Pädagogik Spiel
481 Organisationsberater Berater für Bio
10781
Berlin
Unternehmensberater für Ökologische Landwirtschaft (Biolandbau) und Biomarkt (Biohandel) – Experte für Bio Lebensmittel und Biolandbau
conradthimm.de Bio Lebensmittel Bioprodukte
482 Startseite constant balance Fußpflege
10781
Berlin
Heilsame Behandlungen für Körper Geist und Seele Fußpflege Massagen und Heilarbeit
constant-balance.de Fußpflege Wellness Entspannung
483 Organisationsberater Berater für Bio
10781
Berlin
Unternehmensberater für Ökologische Landwirtschaft (Biolandbau) und Biomarkt (Biohandel) – Experte für Bio Lebensmittel und Biolandbau
consultantfororganictrade.de Bio Lebensmittel Bioprodukte
484 Querschnitt Weine
10781
Berlin
Querschnitt Weine Weinhandlung in BerlinSchöneberg
querschnitt-weine.de
485 Startseite
10781
Berlin
Rechtsanwältin Sylvia PfaffHofmann: Ihr Recht in guten Händen! Spezialgebiete: Europarecht Einbuergerungsrecht und Asylverfahrensrecht
rechtsanwaeltinpfaff-hofmann.de
486 Praya ThaiMassage Startseite Massage
10781
Berlin
Praya ThaiMassage Ihre Praxis in Berlin bietet professionelle Physiotherapie und Massagen als therapeutisches
prayathai.de Massage Praxis
487 Startseite
10781
Berlin
Anwälte & Steuerberater PSInkasso
ps-inkasso-berlin.de
488 Kanzlei Rechtsanwalt Böcker joomla
10781
Berlin
Joomla! dynamische PortalEngine und ContentManagementSystem
rechtsanwaltskanzlei-24.de Joomla Joomla
489 Fachanwalt Strafrecht Rechtsanwalt Fachanwalt
10781
Berlin
Fachanwalt Strafrecht Rechtsanwalt Feldkamp Berlin
rechtsanwaltskanzlei24.de Fachanwalt Strafrecht Rechtsanwalt
490 Reinigung360.de | Professionelle Gebäudereinigung Reinigung
10781
Berlin
Gebäudereinigung Büroreinigung Bauendreinigung Glassreinigung Laborreinigung Praxisreinigung Spezialreinigung Teppichreinigung
reinigung360grad.de Reinigung Reinigung Berlin
491 REISEDIENST WITTER: Tolle Reisen. Witter
10781
Berlin
REISEDIENST WITTER: Tolle Reisen. Viel Vergnügen!
reisedienst-witter.de Witter Reisedienst REISEDIENST
492 Schiek Sports Germany Bodybuilding Schiek
10781
Berlin
Offizieller Distributor Schiek Sports in Deutschland erhältlich Schiek Sports Schiek Sport Handschuhe
schiek-store.de Schiek Sport Handschuhe
493 Schiek Sports Germany offizieller Schiek
10781
Berlin
Offizieller Distributor von Schiek Produkten in Deutschland Fitness Bodybuilding Zubehör Fitnesshandschuhe Zughilfen Handgelenkschutz Bandagen
schiek-germany.de Schiek Fitnesshandschuhe Trainingsgürtel
494 HOME
10781
Berlin
Schulshirt Schulkleidung Schuluniform TShirts PoloShirts Sweatshirts Kapuzenshirts Kleidung Uniform Schule Freizeit Caps
scoolchic.de
495 Senioren Beratung Berlin Seniorenberatung
10781
Berlin
Seniorenberatung Berlin
senioren-beratung-berlin.de Seniorenberatung Pflegeheimberatung Neue
496 Datenschutzanalyse externer Datenschutzbeauftragter PrivCom Datenschutz GmbH Datenschutz
10781
Berlin
Wir organisieren als externe Datenschutzbeauftragte mit DatenschutzAudits Schulungen und Sicherheitstests datenschutzkonforme und sichere Prozesse.
privcom.de Datenschutz Audits Datensicherheit
497 PROMINENTENBAU© Prominentenbau
10781
Berlin
Erwachsene bauen mit LEGO Elementen für Kinder
prominenten-bau.de Prominentenbau Prominent DAI Lego Hellweg
498 PME PME
10781
Berlin
PME ProBau Management und Entwicklungsgesellschaft mbH
pme-gmbh.de PME ProBau Management Entwicklungsgesellschaft
499 Startseite
10781
Berlin
Rechtsanwältin Sylvia PfaffHofmann: Ihr Recht in guten Händen! Spezialgebiete: Europarecht Einbuergerungsrecht und Asylverfahrensrecht
recht24-berlin.de
500 IOB Internationale OmnibusBetreibergesellschaft ZOB
10781
Berlin
ZOB Zentraler Omnibusbahnhof Berlin an Funkturm und Messegelände:
iob-berlin.de ZOB Zentraler Omnibusbahnhof Berlin APC
501 Nina Petrick – Autorin Nina
10781
Berlin
Nina Petrick freie Autorin für Kinder und Jugendbücher Belletristik und Kurzgeschichten. Ihr Jugendbuch
nina-petrick.de Nina Petrick Autorin
502 Digital Innovation Facilitator GuentherLange GmbH digitale
10781
Berlin
Mit Design Thinking systematisch zu kreativen Problemlösungen für das InternetBusiness: Jens Otto Lange moderiert Ideen
jensottolange.de Digitale Innovation Kreativität
503 Berlinatnight.de :: Stadtmagazin für Musikkalender
10781
Berlin
NightlifeGuide für Berlin: Clubs Bars Parties Tickets Kinoprogramm Konzerte
berlinatnight.de Musikkalender Movie Genießen
504 Www.djembeberlin.de
10781
Berlin
Du möchtest die westafrikanische Trommel Djembe spielen lernen. Hier findest du eine Liste von Lehrern
djembe-berlin.de
505 Naturheilpraxis im Hofbogen behandlung
10781
Berlin
Naturheilkunde Praxis Hofbogen Heilung Anwendung Rheuma Therapie Heilpraktiker
hofbogen.de Behandlung Therapie Körper
506 Theater Hans Wurst Nachfahren Grüffelo
10781
Berlin
Hans Wurst Nachfahren Theater für Kinder und Erwachsene in BerlinSchöneberg zeigt Spielplan
hans-wurst-nachfahren.de Grüffelo Puppentheater Berlin
507 Berliner Berufsverband der Gesundheitsaufseher/Hygieneinspektoren BBGH
10781
Berlin
Der Berliner Berufsverband der Gesundheitsaufseher/Hygieneinspektoren stellt sich vor und bietet Informationsmaterial rund um den öffentlichen
hygieneinspektoren.de BBGH BVH Hygiene
508 Kanzlei Rechtsanwalt Böcker joomla
10781
Berlin
Joomla! dynamische PortalEngine und ContentManagementSystem
kanzlei-boecker.de Joomla Joomla
509 ..::Phoenix Lounge::.. Phoenix
10781
Berlin
Phoenix Lounge. Bar Restaurant Cafe in Schöneberg.
phoenixlounge.de Phoenix Lounge Phoenix
510 Rosenscharf und Edelsüß Catering ZOE
10781
Berlin
Restaurant ZOE Berlin. Asiatische und mediterrane Küche zwischen Hackeschem Markt und Alexanderplatz in Berlin Mitte.
rosenscharf-edelsuess.de ZOE Restaurant Lounge
511 Tucanu Webseiten leicht Jürgen
10781
Berlin
tucanu der Weg zur eigenen Homepage leicht zu haben einfach zu bedienen
tucanu.de Jürgen Kubens Beratung
512 Nicolai Thärichen Komponist Arrangeur Thärichens
10781
Berlin
Nicolai Thärichen Komponist Arrangeur Pianist Aktuelles 2009 Thärichens Tentett Konzerte
thaerichen.de Thärichens Tentett Konzerte Myspace
513 Felicitas Jacobs Theaterpädagogin Theater
10781
Berlin
Ich biete vielfältige theaterpädagogische Qualifikationen als Ausbildung oder Fortbildung initiiere theatrale Prozesse und entwickle
theaterpaedagogische-kunst.de Theater Pädagogik Spiel
514 URBANIS Startseite URBANIS GmbH URBANIS
10781
Berlin
Herzlich willkommen bei der URBANIS GmbH
urbanis-berlin.de URBANIS Berlin Unternehmen
515 Ihre Website erstellen
10781
Berlin
Alles rund um die Website. Vorkonfiguriert oder maßgeschneidert für lokale Unternehmen aus Dienstleistung Handwerk
spreelink.de
516 Studio la voce Sängerin
10781
Berlin
Stefania Erzmoneit Habsburgerstrasse 5 10781 Berlin fon: 03021 99 68 23 fax:
studiolavoce.de Sängerin Sängerin Klang
517 Home Andrea Schlinkert Queer
10781
Berlin
Dies ist die Seite von Andrea Schlinkert Tanzlehrerin und Djane in Berlin.
tangoschlampen.de Queer Tango Queer Argentino
518 Willkommen auf der Startseite Tango
10781
Berlin
Tango Rueda eine Begegnung in vier Takten in Berlin
tangorueda.de Tango Rueda Berlin
519 VIEV | NEW
10781
Berlin
VIEV – das sind Wagner & Werner ein deutschchilenisches Designerkollektiv aus Berlin.
viev.de
520 Excelle.consulting | Produktions und excelle.consultin
10781
Berlin
excelle.consulting bietet kundenindividuelle Lösungen zu Fragen der strategischen Unternehmensentwicklung und der Gestaltung operativer Leistungsstrukturen sowie
excelle.de Excelle.consulting Excelle Excelle.de
521 Wanderreisen Pierolt Wanderreisen
10781
Berlin
Wanderreisen Pierolt Wandern im Spreewald Hüttenwanderung in den Lienzer Dolomiten Wandern rund
wanderreisen-pierolt.de Wanderreisen Pierolt Wandern Im
522 SammlungsVerkauf coupon
10781
Berlin
Webdealscout Suche deine Gutscheine Deals und Rabatte
webdealscout.de Coupon Gutschein Geschenk
523 Theo G. Gilbers Sexualpädago
10781
Berlin
Sexualpädagogische Fortbildung für pädagogische und psychosoziale Fachkräfte
theogilbers.de Sexualpädagoge Und Sexualtherapeut
524 Schmuckmanufaktur Berlin Goldschmiedin Schmuckmanufaktur
10781
Berlin
Schmuckmanufaktur Berlin Goldschmiedin Schmuck Trendart
schmuckmanufaktur-berlin.de Schmuckmanufaktur Berlin Goldschmiedin
525 LumpenPrinzessin ... Kinderkleidung Kinderkleidung
10781
Berlin
Die LumpenPrinzessin bietet seit über 15 Jahren Alles für Baby und Kind in gut erhaltener
schuhchen.de Kinderkleidung Kindermode Kinderschuhe
526 Robert Berghoff Berlin robert
10781
Berlin
Mit einfachem Blick auf die Dinge: Bildgestaltender Kameramann Director Of Photography Cinematographer
robertberghoff.de Robert Berghoff Filme
527 Schuldnerberatung Berlin Schuldenberatung Berlin Schuldnerberatung
10781
Berlin
â–ș Schuldnerberatung Berlin vom Anwalt Privatinsolvenz Restschuldbefreiung Verbraucherinsolvenz Schuldenberatung Verbraucherinsolvenzverfahren. Rechtsanwalt Pillig Berlin
restschuldbefreiung.de Schuldnerberatung Berlin Privatinsolvenz Restschuldbefreiung Schuldenberatu
528 HOME
10781
Berlin
Schulshirt Schulkleidung Schuluniform TShirts PoloShirts Sweatshirts Kapuzenshirts Kleidung Uniform Schule Freizeit Caps
schulschick.de
529 Home – Goldschmiede Schmuckbotschaften
10781
Berlin
Goldschmiede Schmuckbotschaften aus Berlin entwirft individuellen Schmuck!
schmuck-gewecke.de
530 Startseite
10781
Berlin
Anwälte & Steuerberater PSInkasso
schygulla-inkasso.de
531 Gabriele Steiner Praxis für Ärztin
10781
Berlin
Gabriele Steiner Praxis für Homöopathie am Winterfeldtplatz in BerlinSchöneberg Ärztin für Allgemeinmedizin
steiner-gabriele.de Ärztin Homöopathie Homoeopathie
532 Stephan Szasz Startseite Über
10781
Berlin
Ich bin Stephan Szasz aus Berlin und erzähle euch auf dieser Webseite ein paar Geschichten
stephan-szasz.de Über Mich Hobby
533 Patwork
10781
Berlin
Feinmechanik
viosk.de
534 52. DeutschFranzösisches Volksfest Schaustellerverband Berlin e.V. Deutsch
10781
Berlin
Das mit Abstand größte jährliche Volksfest in Berlin Willkommen auf über 40.000mÂČ Erlebnisfläche!
volksfest-berlin.de Deutsch Französisches Volksfest Laune
535 Apartment Dr. Claudia Malzfeldt
10781
Berlin
Startseite
westerlandapartment.de
536 Wirtschaftsmediatoren Berlin Wirtschaftsmediat
10781
Berlin
Wirtschaftsmediatoren Berlin
wirtschaftsmediatoren-berlin.de Wirtschaftsmediator Mediator Madiation Spannagel Eckolt
537 Home Musik
10781
Berlin
Kinderlieder Wir Kinder vom Kleistpark gute Musik für Kinder Konzerte für Kinder
wirkindervomkleistpark.de Musik Für Kinder Kinderkonzerte
538 Ölmühle Berlin Olivenöl
10781
Berlin
Olivenöl aus der ölmühle Berlin Schöneberg. Bei uns finden Sie ein Sortiment von über 60 meist
xn--lmhleberlin-qfb4f.de Olivenöl Olivenholz Balsamico
539 Home
10781
Berlin
Sachverständiger von der Handwerkskammer Berlin öffentlich bestellter und vereidigter Sachverständiger für das Dachdeckerhandwerk Steildacheindeckungen
xn--stutenbumer-heinz-wqb.de
540 Brautkleider alles für Kalamov und Kalamova GbR
10781
Berlin
Bei uns finden Sie moderne und günstige Brautkleider Abendmode Accessoires Dessous. Schneller
weddingssecrets.de
541 Anke Sevenich | Schauspielerin
10781
berlin
Anke Sevenich gehört zu den besten wenn auch eher unauffälligen Schauspielerinnen des deutschen Fernsehens
anke-sevenich.de
542 Restaurant AltÖsterreich Startseite Restaurant
10781
Berlin
Restaurant AltÖsterreich heißt: Echtes Wiener Schnitzel duftende Frittatensuppe eine ordentliche Portion Kaiserschmarrn oder
alt-oesterreich.de Restaurant AltÖsterreich Alt
543 Startseite Queer
10781
Berlin
Musikversierte und begeisterte Djane mit breitgefächertem Musikrepertoire für jegliche Anlässe buchbar. Ob Standard und Lateinmusik
andrea-schlinkert.de Queer Tango Queer Argentino
544 Welcome to Berlin Gym aktiv
10781
Berlin
Auf diesen Seiten findet Ihr alle Informationen rund um den Verein Berlin Gym – Verein
berlin-gym.de Aktiv Fitness Kampfsporttraning
545 Berliner Berufsverband der Gesundheitsaufseher/Hygieneinspektoren BBGH
10781
Berlin
Der Berliner Berufsverband der Gesundheitsaufseher/Hygieneinspektoren stellt sich vor und bietet Informationsmaterial rund um den öffentlichen
bhbbev.de BBGH BVH Hygiene
546 Bing Ma Communication China
10781
Berlin
Neue Seite
bingma.de China Business Marketing
547 Schreibcoaching in Berlin Schreibcoaching
10781
Berlin
Schreibcoaching: Sie schreiben gerade an einer wissenschaftlichen Abschlußarbeit? Bringen Sie sich mit Schreibcoaching wieder in
faden-verloren.de Schreibcoaching Wissenschaftliche Abschlussarbeit
548 Ferienhaus Wittingen
10781
Berlin
Ferienhaus Wittingen
ferienhaus-wittingen.de
549 Organisationsberater Berater für Bio
10781
Berlin
Unternehmensberater für Ökologische Landwirtschaft (Biolandbau) und Biomarkt (Biohandel) – Experte für Bio Lebensmittel und Biolandbau
consultantorganictrade.de Bio Lebensmittel Bioprodukte
550 Home
10781
Berlin
Brandenburger Tor Variationen mit FotoGalerie TorVariationen Brandenburg Berlin Logo
brandenburger-torheiten.de
551 Floorwalker.de Einfach. Schnell. floorwalker
10781
Berlin
Ein Floorwalker bietet nicht nur bei der Einführung neuer Software effektiven Support sondern auch
floorwalker.de Floorwalker Floorwalking Office
552 FHING Aktuell Werbung
10781
Berlin
für heute ist nichts geplant
fhing.de Werbung Postkarte Schwul
553 Restaurant AltÖsterreich Startseite Restaurant
10781
Berlin
Restaurant AltÖsterreich heißt: Echtes Wiener Schnitzel duftende Frittatensuppe eine ordentliche Portion Kaiserschmarrn oder
diodata-restaurant.de Restaurant AltÖsterreich Alt
554 Startseite House of House of Queer Sisters e.V. Queer
10781
Berlin
Wir sind Sisters und Guards die Gutes tun und dies überall wo wir gebraucht
house-of-queer-sisters.de Queer Sisters Schwulen
555 OnlineShop Bastelkits. Made
10781
Berlin
Wir haben ein Kit entwickelt mit dem man gleich loslegt in dem gute
bastelkits.de
556 Linda Sixt Linda
10781
Berlin
Linda Sixt
linda-sixt.de Linda Sixt
557 Lofts & Co. Lofts & Co. GmbH lofts
10781
Berlin
Lofts & Co. Best in Lofts!
loftsandco.de Lofts Berlin Dachwohnung Berlin
558 Antiquariat Mertens und Pomplun Antiquariat Mertens & Pomplun GbR Antiquariat
10781
Berlin
Antiquariat antiquarische Bücher OriginalPhotographien Fotografie Plakate Landkarten Luxuspapier
mp-rarebooks.de Antiquariat Antiquarische Bücher
559 MR Patterns Willkommen Nähen
10781
Berlin
Mr Patterns das Schnittstudio fuer SelberMacher
mrpatterns.de Nähen Schnittmuster Schnittkurs
560 Psychotherapie und Coaching in
10781
Berlin
Sie suchen einen Psychotherapeuten oder Coach in Berlin? Sie sind in einer schwierigen privaten oder
monika-holz.de
561 Gaastra Napapijri Diesel online Markenmode
10781
Berlin
Fashiontex 24 Online Shop. Ihr Designer Online Shop mit Markenbekleidung wie Gaastra Jacke Poloshirt
fashiontex24.de Markenmode Gaastra Napapijri
562 Heilpraktikerin in Berlin Schöneberg Homöopathie
10781
Berlin
Isabel Blume Heilpraktikerin Klassische Homöopathie und Shiatsu in Berlin
isabel-blume.de Homöopathie Klassische Homöopathie
563 Http://www.KinderladenKonfetti.de
10781
Berlin
Mitten im Schöneberger Winterfeldtkiez in Berlin liegt der kleine bunte Kinderladen Konfetti. Zwei Erzieherinnen
kinderladen-konfetti.de
564 MUTTER RESTAURANT BAR BERLIN thai
10781
Berlin
Die MUTTER in Berlin Schöneberg bietet vom Frühstück im Außenbereich thailändischer Küche und Cocktails
mutter-berlin.de Thai Bar Berlin Thaifood Frühstück
565 Zuhause Mundgerecht Magazin Save
10781
Berlin
MUNDGERECHT ist mehr als nur ein Magazin. Eigentlich sind wir ein soziales Startup mit einer
mundgerecht-magazin.de Save Food Nachhaltiges Essen
566 Home Siebergraphic Siebergraphic Berlin
10781
Berlin
siebergraphic macht die Grafik für Sie in Berlin Nürnberg und Umgebung. Egal was
siebergraphic.de Berlin Grafik Illustration
567 Schlüsseldienst Tempelhof Endpreise direkt Schlüsseldie
10781
Berlin
Günstiger Schlüsseldienst für Tempelhof. Probleme mit Ihrem Türschloss? Kein Problem. Wir helfen kostengünstig schnell
schluesseldienst-tempelhof-berlin.de Schlüsseldienst Tempelhof Ihr Schlüsseldienst
568 StoppRitalin | Die ScherretMethode Wachstumsstö
10781
Berlin
Bei immer mehr Kindern und Jugendlichen in Deutschland stellen Ärzte Aufmerksamkeits und Hyperaktivitätsstörungen fest.
stopp-ritalin.de Wachstumsstörungen ADHS Ritalin StoppRitalin ScherretMethode
569 HOME
10781
Berlin
HOME
ulrikespeyerer.de
570 Wellfina Wellness Fitness Naturheilkunde
10781
Berlin
Angebot: Personal Training Ernährungsberatung Mesotherapie (Anti Aging) Kinesiologie Neuraltherapie Schröpfen
wellfina.de Naturheilkunde Heilpraktiker Personaltraining

Ergebnisse der Bewertung der Themenseite zu Neueröffnungen, verkaufsoffene Sonntage, Gutscheine und Coupons in Berlin
32 Bewertungen ergeben 3 StadtBranche Punkte

Berlin
Berlin ist die Bundeshauptstadt der Bundesrepublik Deutschland und zugleich eines ihrer LĂ€nder. Die Stadt Berlin ist mit rund 3,5 Millionen Einwohnern die bevölkerungsreichste und mit 892 Quadratkilometern die flĂ€chengrĂ¶ĂŸte Gemeinde Deutschlands sowie nach Einwohnern die zweitgrĂ¶ĂŸte der EuropĂ€ischen Union. Sie bildet das Zentrum der Metropolregion Berlin/Brandenburg und der Agglomeration Berlin . Der Stadtstaat unterteilt sich in zwölf Bezirke. Neben den FlĂŒssen Spree und Havel befinden sich im Stadtgebiet kleinere FließgewĂ€sser sowie zahlreiche Seen und WĂ€lder.

LandkreisKreisfreie Stadt Berlin
BundeslandBerlin
Postleitzahl10785
Vorwahl030
BahnhofBerlin Potsdamer Platz
Finanzamt

Berlin Karte

Berlin Karte Kreisfreie Stadt Berlin Berlin Berlin Stadtplan Kreisfreie Stadt Berlin Berlin