optional Stadt:
Ort ›

Berlin › Kreisfreie Stadt Berlin › Berlin

Branchenbuch Berlin 10785 Berlin

Kreisfreie Stadt Berlin


1 Brauchen Sie eine finanzielle Hilfe Geld Finanziell
12309
Berlin
Brauchen Sie eine finanzielle Hilfe? Bist du in irgendeiner Finanzkrise oder brauchst du Geld, um dein eigenes...
2 Kugelschreiber-Unikate Kunst
10117
Berlin
Kugelschreiber-Unikate aus schwarzem Ebenholz, manche mit Kristallen oder Gold. Jedes hat sein eigenes Design. Auswechselbare, in Schreibwarenhandlungen...
waltino.com Waltino Waltinos Sculptures Design Newsletters Each Mobile Walter
3 thewebmax Webdesign
10587
Berlin
thewebmax | Web Design & Web Development & SEO - Berlin...
thewebmax.de Design Berlin Development Web Contact Streubel Charlottenburger Ufer
4 Ärztlicher Notdienst Medlanes Ärztlicher Notdienst
10969
Berlin
Unser ärztlicher Bereitschaftsdienst bietet Ihnen fachärztliche Hilfe direkt zu Hause, an Ihrem Arbeitsplatz oder im Hotel. Wir...
medlanes.com/medlanes-aerztlicher-notdienst-in-berlin/ Berlin Notdienst Medlanes Admin Gynäkologischer ärztlicher Dermatologischer Agb
5 Berliner Umzüge e.K. Umzug
13353
Berlin
Als Berliner Umzüge haben wir uns als Ziel gesetzt, für die Zufriedenheit all unserer Kunden zu sorgen. Schon...
berlinerumzuege.de Umzug Berlin Umzüge Berliner Fotos Umzugsfirma Liste Google
6 DJ Sash Brandenburg DJ
12355
Berlin
DJ für die Region Brandenburg...
dj-sash-brandenburg.de Dj Brandenburg Hochzeits Event Sash Erhalten Scrollen Webseite
7 BERLINMEDIAGROUP Berlin Medienunternehmen
10117
Berlin
BERLINMEDIAGROUP - Ihr Partner für Konzeption, Großformatdruck, Druck, Werbetechnik, Displays und Realisierung. Als Werbeagentur mit über zehn...
berlinmediagroup.de/standorte/berlin.html
8 BERLINMEDIAGROUP Berlin Medienunternehmen
10117
Berlin
BERLINMEDIAGROUP - Ihr Partner für Konzeption, Großformatdruck, Druck, Werbetechnik, Displays und Realisierung. Als Werbeagentur mit über zehn...
berlinmediagroup.de/standorte/berlin.html
9 BERLINMEDIAGROUP Berlin Medienunternehmen
10117
Berlin
BERLINMEDIAGROUP - Ihr Partner für Konzeption, Großformatdruck, Druck, Werbetechnik, Displays und Realisierung. Als Werbeagentur mit über zehn...
berlinmediagroup.de/
10 BERLINMEDIAGROUP Berlin Medienunternehmen
10117
Berlin
BERLINMEDIAGROUP - Ihr Partner für Konzeption, Großformatdruck, Druck, Werbetechnik, Displays und Realisierung. Als Werbeagentur mit über zehn...
berlinmediagroup.de/
11 BERLINMEDIAGROUP Berlin Medienunternehmen
10117
Berlin
BERLINMEDIAGROUP - Ihr Partner für Konzeption, Großformatdruck, Druck, Werbetechnik, Displays und Realisierung. Als Werbeagentur mit über zehn...
berlinmediagroup.de/
12 Mineralwasser Testsieger Onlineshop
13086
Berlin
Dieser Ratgeber informiert seine Leser über die besten Abfüller und Quellen von Mineralwasser....
mineralwasser-testsieger.de/ Mineralwasser Test Gerolsteiner Medium Ratgeber Glasflaschen Naturell Testsieger

Kostenloses Buch Tipps & Tricks für Arbeitswelt & Leben:

Erhalten Sie Ihr Buch "Tipps und Tricks für Arbeitswelt und Leben"
kostenlos per E-Mail als .pdf Datei:


13 Tritt - Case in Toskana Tourismus Reisen
10997
Berlin
Tritt – Case in Toscana vermittelt eine große Variation an Unterkünften; ob Ferienhaus, Pension oder doch ein...
tritt-toskana.de/ Toskana Toskanade Ferienwohnungen Agriturismo Toskana@tritt Strandurlaub Urlaub Unterkunft
14 USB - Umzugsservice-Berlin - Halteverbot Berlin Umzug
10555
Berlin
Den Umzug bzw. die Baustelle rechtzeitig planen! Wenn Sie umziehen, sollten Sie im Vorfeld das Szenarium gedanklich...
umzugsservice-berlin.com Halteverbot Offnen Umzug Berlin Umzugsservice Hamburg Agb Halteverbotszone
15 Jura Reparaturen Berlin Marzahn Hellersdorf Kaffeeautomaten
12621
Berlin
Reparatur - Annahmestelle in Berlin Marzahn - Hellersdorf Cafe Klatsch Kaulsdorf Mädewalder Weg 35 12621 Berlin Kaulsdorf Di - So: ...
kaffeemaschinen-reparatur-berlin.info
16 Jura Reparaturen Berlin Marzahn Hellersdorf Kaffeeautomaten
12621
Berlin
Reparatur - Annahmestelle in Berlin Marzahn - Hellersdorf Cafe Klatsch Kaulsdorf Mädewalder Weg 35 12621 Berlin Kaulsdorf Di - So: ...
kaffeemaschinen-reparatur-berlin.info
17 Möblierte Apartments & Wohnungen Immobilien
12621
Berlin
Möblierte Apartments & Wohnungen direkt vom Eigentümer...
das-apartment-berlin.de Erfahren Mail Rückrufservice Apartments Moderne Liebevoll Prenzlauerschließen Vorgehensweise
18 Nassrasierer Testsieger Drogerie
13086
Berlin
Auf diesem Ratgeber können sich alle Verbraucher über die Vorteile und Nachteile von Nassrasierern informieren. Erleichtert wird...
nassrasierer-testsieger.de/ Gillette Nassrasierer Wilkinson Sword Platz Rasierer Hydro Fusion
19 Asahi Bonsai -Kruttasch GbR Garten Online-Shop
10623
Berlin
Asahi Bonsai ist ein Bonsai Spezialist und Online-Shop mit Hauptsitz in Berlin. Asahi Bonsai bietet eine enorme...
asahi-bonsai.de/ Bonsai Versandkosten Kaufen Cm Pflegetipp Wacholder Mädchenkiefer
20 Unfallversicherung Test Versicherung
13086
Berlin
Wir stellen euch die Anbieter und Policen von Unfallversicherungen vor. Durch die Veröffentlichung von Testergebnissen werden Vorteile...
unfallversicherungen-tests.de/ Unfallversicherung Besten Testhellip Laut Unfallversicherungen Ratgeber Bu Testet
21 La Casa del Habano Berlin Tabak Onlineshop
10623
Berlin
„La Casa del Habano“ ist mit „Herzog am Ludwigsplatz“ und „Herzogs am Hafen“ ein von Zigarren Herzogs...
zigarren-herzog.com/de/ Zigarren Robusto Herzog Hafen Versandkosten Punch Upmann Kiste
22 Zigarren Herzog am Ludwigsplatz Tabak Onlineshop
10719
Berlin
„Herzog am Ludwigsplatz“ ist neben „Herzog am Hafen“ und „La Casa del Habano“ ein von den Zigarren...
zigarren-herzog.com/de/ Zigarren Robusto Herzog Hafen Montecristo Punch Upmann Kiste
23 Herzogs Zigarrenlager am Hafen GmbH & Tabak Onlineshop
10245
Berlin
Bis heute bleibt Zigarren Herzog das einzige Zigarrenhaus Deutschlands, das von einem echten Hombre Habanos geleitet wird....
zigarren-herzog.com/en/ Cigars Robusto Montecristo Box Shipping Punch Upmann Herzog
24 Hauptstadt CrossFit in Mitte Sport Fitness
10115
Berlin-Mitte
Hauptstadt Crossfit bietet zwei zentrale Crossfitboxen, eines davon liegt direkt in Berlin Mitte. Unterrichtet von Sportexperten und...
info@hauptstadt-crossfit.de Crossfit Berlin Hauptstadt Box Probetraining Training Kostenloses Mitglied
25 Hauptstadt CrossFit in Charlottenburg-Wilmersdorf Sport Fitness
10715
Berlin
In Berlin bietet Hauptstadt Crossfit zwei Crossfitboxen, verfügbar in Charlottenburg-Wilmersdorf und direkt in Berlin Mitte, zentraler gehts...
hauptstadt-crossfit.de/ Crossfit Berlin Hauptstadt Box Probetraining Training Werde Mitglied
26 Planika Kamine Wohnen &
13583
Berlin
Die auf Planika Kamine präsentierten Outdoor Ethanol Kamine sind Produkte von höchster Qualität. Dadurch wird die sichere...
planikakamine.de/ Z Y
27 Jazzband Jazz Royal Jazzband Für
10405
Berlin
Jazzband Berlin: „Jazz Royal – Das königliche Jazzerlebnis“ untermalt Events wie Gala Dinner, Stehempfang und Hochzeit musikalisch....
jazzroyal.de/ Z Y
28 Berlinstadtservice Tourismus
13597
Berlin
Berlinstadtservice ist das Hauptstadtportal Berlin und spiegelt die gesamte Bandbreite des Berliner Stadtlebens wieder. Unsere Informationen richten...
berlinstadtservice.de/ [] Berlin Hauptstadtportal Berliner Berlinstadtservice Nahverkehr Hotels Umweltzone
29 Brautkleider Brautmode
10789
Berlin
Wir haben für Sie eine schöne Auswahl an Brautkleidern zusammengestellt. Jedes unserer Brautkleider zeichnet sich durch ein...
matsouri.de Designer Couture Lookbook Abendkleider Brautkleider Spitzenkleid Quotvickyquot Abendkleid
30 Brautkleider Brautmode
10789
Berlin
Wir haben für Sie eine schöne Auswahl an Brautkleidern zusammengestellt. Jedes unserer Brautkleider zeichnet sich durch ein...
matsouri.de
31 Brautkleider Brautmode
10789
Berlin
Wir haben für Sie eine schöne Auswahl an Brautkleidern zusammengestellt. Jedes unserer Brautkleider zeichnet sich durch ein...
matsouri.de
32 kellerfrei.com Anzeigenportal Für
12623
Berlin
kellerfrei – das kostenlose Portal für Lagerflächen aller Art: Keller, Stellplatz, Garage, Stauraum, Lager, Self Storage kellerfrei ist...
kellerfrei.com/
33 Fensterreparatur Berlin Fensterreparatur

Berlin
Riss oder Steinschlag im Fenster? Sind die Dichtungen porös? Oder schließen ihre Fenster nicht mehr richtig? Die Fensterreparatur Berlin bemüht...
fensterreparatur-berlin.de/ Berlin Fensterreparatur Fenster ✅ Türen Anruf Wartung Inhalt
34 Dringend Geld brauchen? Wir können dir Darlehen Kredit
10115
Berlin
Dringend Geld brauchen? Wir können dir helfen! Bist du durch die aktuelle Situation in Schwierigkeiten oder drohst dir...
35 HELIKUM-SECURITY Sicherheitsdienst
13469
Berlin
helikum-security.de/ Berlin überspringen Navigation Security Securityde Helikum Uns Brandenburg
36 Praxis für Arbeitspsychologische Beratung Psychologische Beratung
10825
Berlin
Ich betrachte nicht nur einzelne Befindungssymptome, sondern sehe immer den ganzen Menschen. Gern begleite ich Sie auf...
praxis-marcusneuzerling.de
37 Praxis für Arbeitspsychologische Beratung Psychologische Beratung
10825
Berlin
Ich betrachte nicht nur einzelne Befindungssymptome, sondern sehe immer den ganzen Menschen. Gern begleite ich Sie auf...
praxis-marcusneuzerling.de
38 Praxis für Arbeitspsychologische Beratung Psychologische Beratung
10825
Berlin
Ich betrachte nicht nur einzelne Befindungssymptome, sondern sehe immer den ganzen Menschen. Gern begleite ich Sie auf...
praxis-marcusneuzerling.de
39 Rechtsanwalt Michael Rudnicki Rechtsanwälte
10623
Berlin
rudnicki-berlin.de/ Verkehrsrecht Berlin Strafrecht Charlottenburg Fachanwalt Straf Rudnicki Jahren
40 Avonprodukte Kosmetik Schmuck
10365
Berlin
Ich bin Avonberaterin in Berlin. NEU! Ihr könnt jetzt online bei mir bestellen, mich aber natürlich auch persönlich...
avon.de/store/silke
41 Personal Trainer Berlin RoRoCoach Robert Rode Personal Trainer
12459
Berlin
Mein Name ist Robert Rode und ich biete schon seit über 20 Jahren Personal Training in Berlin...
rorocoach.de/ ✓ Mental Coach Robert Rode Personal Trainer Artikel
42 Personal Trainer Berli RoRoCoach Robert Rode Personal Trainer
12459
Berlin
Mein Name ist Robert Rode und ich biete schon seit über 20 Jahren Personal Training in Berlin...
rorocoach.de/ ✓ Coach Mental Personal Rode Trainer Artikel Robert
43 Containerdienst und Abfallentsorgung für Berlin Containerdienst
13509
Berlin
Berlin ist eine Weltstadt und als solche im stetigen Wandel. Laufend werden Gebäude abgerissen und neu gebaut...
dino-container.de/
44 Containerdienst und Abfallentsorgung für Berlin Containerdienst
13509
Berlin
Berlin ist eine Weltstadt und als solche im stetigen Wandel. Laufend werden Gebäude abgerissen und neu gebaut...
dino-container.de/
45 Containerdienst und Abfallentsorgung für Berlin Containerdienst
13509
Berlin
Berlin ist eine Weltstadt und als solche im stetigen Wandel. Laufend werden Gebäude abgerissen und neu gebaut...
dino-container.de/
46 Allianz pro Schiene e.V. Bahnverkehr
10117
Berlin
Die Allianz pro Schiene e.V. ist ein Verkehrsbündnis zur Unterstützung des gefahrlosen und ökologischen Bahnverkehrs in der...
allianz-pro-schiene.de/ Allianz Pro Schiene Fakten Daten @schienenallianz Bahnhof Eisenbahner
47 Parkhotel St. Leonhard Hotel und
88662
Überlingen
Ankommen und Wohlfühlen, den Alltag vergessen. Genießen Sie das Ambiente eines erstrangigen Hotels, umgeben von einem 70 ha...
parkhotel-st-leonhard.de
48 Parkhotel St. Leonhard Hotel und
88662
Überlingen
Ankommen und Wohlfühlen, den Alltag vergessen. Genießen Sie das Ambiente eines erstrangigen Hotels, umgeben von einem 70 ha...
parkhotel-st-leonhard.de
49 Turan Messebau Messebau
12099
Berlin
Turan Messebau bietet hochwertiges Handwerk aus einer Hand: maßgeschneiderte Messestände und individuelle Ausstellungsbauten, Innenarchitektur für Läden, Büros...
turan-berlin.de Messebau Handwerk Turan Berlin Werkstätten Architektur Konzepte
50 Turan Messebau Messebau
12099
Berlin
Turan Messebau bietet hochwertiges Handwerk aus einer Hand: maßgeschneiderte Messestände und individuelle Ausstellungsbauten, Innenarchitektur für Läden, Büros...
turan-berlin.de
51 Turan Messebau Messebau
12099
Berlin
Turan Messebau bietet hochwertiges Handwerk aus einer Hand: maßgeschneiderte Messestände und individuelle Ausstellungsbauten, Innenarchitektur für Läden, Büros...
turan-berlin.de/
52 Turan Messebau Messebau
12099
Berlin
Turan Messebau bietet hochwertiges Handwerk aus einer Hand: maßgeschneiderte Messestände und individuelle Ausstellungsbauten, Innenarchitektur für Läden, Büros...
turan-berlin.de/
53 Schloss-Expert Schlüsseldienst Berlin Schloss-Expert Schlüsseldienst Berlin Schlüsseldienst
10785
Berlin
Schloss-Expert Schlüsseldienst Berlin Schlüsselnotdienst 24 Stunden Locksmith ist ein DIREKT-Schlüsseldienst. Türöffnung, Autoöffnung, Tresor öffnen, Türschloss und Schließzylinder wechseln...
schloss-expert.de Berlin Schlüsseldienst Türöffnung öffnen Tresor Schlüsselnotdienst Schluesselnotdienst Locksmith
54 Baustier Bauunternehmen
10623
Berlin
Wir bieten vom Rohbau bis zur Schlüsselfertigen Übergabe alle Baudienstleistung an. Bei Groß- und Kleinaufträgen, sei es...
baustier.de Fliesen Maler Reinigung Tapeten Innenglattputz Graffiti Bieten Webpräsenz
55 Entrümpelung Berlin 24recyclingdienst Entrümpelung
12051
Berlin
Entrümpelung Berlin 80 Euro pauschal Entrümpelungen sofort Keller Wohnung Möber Sperrmüll entrümpeln kurzfristig....
berlin24recyclingdienst.de Entrümpelung Berlin Sperrmüll Möbel Wohnung Keller Preis Sofort
56 pc-reparatur-berlin Pc-reparatur-berlin
10715
Berlin
pc-reparatur-berlin: -Testsieger in ganz Deutschland. -Kostenlose Abholung innerhalb Berlins -Service ab 19, 90€ -Bis zu 10% Rabatt -Ab 5€ Wartungsvertrag -24/7 Notdienst -Über 12...
pc-reparatur-berlin.com Reparatur Berlin Pc Support Einrichten Wartungsvertrag Netzwerk Computerviren
57 notebook-reparatur Notebook-reparatur
13585
Berlin
notebook-reparatur: -Testsieger in ganz Deutschland. -Kostenlose Abholung innerhalb Berlins -Service ab 19, 90€ -Bis zu 10% Rabatt -Ab 5€ Wartungsvertrag -24/7 Notdienst -Über 12...
notebook-reparatur.help Reparatur Berlin Notebook Support Dienstleistungen Wartungsvertrag Reparieren Netzwerk
58 computerviren-entfernen Computerviren-entfernen
10715
Berlin
computerviren-entfernen: -Testsieger in ganz Deutschland. -Kostenlose Abholung innerhalb Berlins -Service ab 19, 90€ -Bis zu 10% Rabatt -Ab 5€ Wartungsvertrag -24/7 Notdienst -Über 12...
computerviren-entfernen.de Reparatur Computerviren Berlin Entfernen Reparieren Center Dienstleistungen Ab
59 datenrettung-berlin Computer-Dattenrettung
10715
Berlin
datenrettung-berlin: -Testsieger in ganz Deutschland. -Kostenlose Abholung innerhalb Berlins -Service ab 19, 90€ -Bis zu 10% Rabatt -Ab 5€ Wartungsvertrag -24/7 Notdienst -Über 12...
datenrettung-berlin.co Reparatur Reparieren Berlin Datenrettung € Center Festplatte Karte
60 Rechtsanwalt Uwe Heichel Rechtsanwälte
10719
Berlin
rechtsanwalt-heichel.de Berlin Wohnungseigentumsrecht Wilmersdorf Heichel Rechtsanwalt Mietrecht Tempelhof Schöneberg
61 Protec Bau & Management - Sanitär Sanitär
13587
Berlin
Protec Bau & Management Ihr Handwerker und Bauplanungsbüro in Berlin, für Sanitär, Heizung, Bäderbau, TGA-Planung und Wohnungssanierung....
sanitaer-berlin.com Planung Tga Bäder Sanitär Heizung Bauleitung Management Protec
62 wlan-einrichten-berlin Internet
10715
Berlin
wlan-einrichten-berlin: -Testsieger in ganz Deutschland. -Kostenlose Abholung innerhalb Berlins -Service ab 19, 90€ -Bis zu 10% Rabatt -Ab 5€ Wartungsvertrag -24/7 Notdienst -Über 12...
wlan-einrichten-berlin.de/ Wlan Einrichten Berlin Laptop Notdienst Repariert Techniker Ihrem
63 Ladenbau Berlin Innenarchitektur Berlin Innenausbau Berlin AAB Raumkultur
13585
Berlin
Innenarchitektur vom Profi für Berlin und Brandenburg. Privat und gewerblich, Büro und Ladenlokal, barrierefreies und altengerechtes Wohnen....
aab-die-raumkultur.de Berlin Innenarchitektur Wohnen Ladenbau Leistungen Navigation Projektablauf Beratung
64 reichow-art online Galerie Kunstgalerie
12163
Berlin
Wir vertreten zeitgenössische Kunst junger internationaler Künstler. Die Werke entsprechen höchsten Ansprüchen und ausgesuchter Qualität. Der künstlerische...
reichow-art.de Alisa Basel Raimann Berlin Austellungen Galerie Künstler Art
65 Die Gottesanbeterin Tiere
10178
Berlin
Hier findest Du alle Informationen rund um Mantiden und ihr Verhalten. Auf Allgemeines, den Körperbau, die Lebensweise...
gottesanbeterin.org
66 Tischtennisplatte Test & Vergleich Sport
10178
Berlin
Jeder kennt es: Es ist endlich Sommer und man will nur raus an die frische Luft. Doch...
tischtennisplatte-test.org Tischtennisplatte Platte Outdoor Test Indoor Prüfen* Platten Netz
67 Immobilien in Berlin und Brandenburg Immobilienmakler
10117
Berlin
Wir von Immobilien in Berlin und Brandenburg bieten Ihnen als Immobilienmakler die Möglichkeit, Immobilien zu kaufen und...
ibb-immo.de Immobilien Berlin Brandenburg Datenschutzerklärung Immobilie Dringend Eigentümer Maik
68 NCP New Carparts liefert Zubehör zum Fachhandel Regale
10713
Berlin
Regale Reifenwagen Reifenkarre Reifenkarren, Regale und Transportwagen: für effiziente Abläufe beim Reifentransport und der Reifenlagerung Allein die Anzahl an...
reifenzubehoer-online.de/ Zubehör Einlagerung New Carparts Ncp Ihr Lagerung Montage
69 Möbeltaxi bietet günstige Transporte Miniumzüge Umzüge Transportunternehmen
13507
Berlin
Möbeltaxi Berlin - Das Original ist seit über 14 Jahren Ihr kompetenter und zuverlässiger Ansprechpartner für Kleintransporte...
moebeltaxi-berlin.de
70 Zahnmedizinisches Fachzentrum am Savignyplatz Dr. Czerwinski Zahnarzt
10623
Berlin
Wir stellen eine fachübergreifende und umfassende Beratung in den Mittelpunkt. Unser Ziel ist die bestmögliche Versorgung unserer...
zahnmedizinisches-fachzentrum-berlin.de/ Zmfs Zahnarzt Savignyplatz Charlottenburg Berlin Fachzentrum Patienten Behandlung
71 Arntberg Verpackungen Werbeartikel
13355
Berlin
Vertrauen Sie auf Arntberg als Ihren starken Partner für Werbemittel. Bedruckte Tragetaschen, Apotheker-Verpackungen, Zuckersticks uvm. finden Sie...
arntberg.de/ Zuckersticks Tragetaschen Erfrischungstücher Servietten Fruchtgummitüten Apotheken Verpackungen Tassendeckchen
72 Kuyo Verpackungen Verpackungen Werbeartikel
13597
Berlin
Egal, ob individuell bedruckte Zuckersticks, Erfrischungstücher, Servietten oder ToGo-Verpackungen: Kuyo besticht durch Qualität, und dies unter Berücksichtigung...
kuyo.de/ Verpackungen Zuckersticks Erfrischungstücher Tassendeckchen Servietten Kuyo Lohnabfüllung Togo
73 ESF Bestattungen und Trauerhilfe GmbH Bestattungen
10249
Berlin
Die ESF Bestattungen und Trauerhilfe GmbH und LK Bestattungs- und Friedhofsdienste GmbH aus Berlin verfügt über langjährige...
esf-bestattungen.de/ Daten Google Website Berlin Bestattungen Analytics Trauerhilfe Formalitäten
74 Anwalt Baurecht Berlin Advoprimum Rechtsanwalt
10719
Berlin
ADVOPRIMUM ist eine auf das Bau- und Immobilienrecht spezialisierte Rechtsanwaltskanzlei. Wir verfügen über hoch qualifizierte Experten und...
baurecht-anwalt24.de Baurecht Berlin Anwalt Bau Fachanwalt Immobilienrecht Architektenrecht Kanzlei
75 Jura Reparaturservice Berlin Kaffeeautomaten
10559
Berlin
Jura Kaffeemaschinen Reparatur Service und Kundendienst in Berlin Alt-Moabit 120 10559 Berlin Mo-Fr.8:00 - 18:00 Uhr...
kundendienst-jura-berlin.de
76 KitchenAid Reparatur Berlin Reparatur
12526
Berlin
DeLonghi Kaffeemaschinen Reparatur-Annahmestelle in Berlin Köpenick-Bohnsdorf Buntzelstr. 91 12526 Berlin - Köpenick Bohnsdorf Öffnungszeiten: Mo - Sa: 07:00...
reparatur-espressomaschine.de Reparatur Jura Delonghi Kitchenaid Gaggia Berlin Lapavoni
77 REDMARKETING - IHRE ONLINE MARKETING AGENTUR
10789
Berlin
Als Ihre Online Marketing Agentur in Berlin bieten wir Ihnen den richtigen Marketing-Mix aus kreativem Webdesign, ergebnisorientierter...
redmarketing.de/ Marketing Berlin Seo Agentur Webdesign Website Google Redmarketing
78 Bettertrust GmbH - Ihre führende PR PR Argentur
10117
Berlin
Als inhabergeführte internationale PR-Agentur mit Sitz in Berlin und Dependancen in München und Zürich, gehören wir zu...
bettertrust.de/ Informationen Pr Leistungen Agentur München Berlin Kommunikation Ceo
79 Popart STUDIO | Webdesign und Website Webdesign Website
10711
Berlin
EINE PROFESSIONELLE WEBDESIGN-AGENTUR FÜR DIE ERSTELLUNG VON WEBSITES UND ONLINE-SHOPS Unsere Dienstleistungen: → Web-Design: Die Dienstleistung des professionellen Web-Designs, umfasst...
popwebdesign.de/
80 Popart STUDIO | Webdesign und Website Webdesign Website
10711
Berlin
EINE PROFESSIONELLE WEBDESIGN-AGENTUR FÜR DIE ERSTELLUNG VON WEBSITES UND ONLINE-SHOPS Unsere Dienstleistungen: → Web-Design: Die Dienstleistung des professionellen Web-Designs, umfasst...
popwebdesign.de/
81 Spezielle Kosmetikbehandlungen wie Hydradermabrasion in Berlin Kosmetikstudio
13507
Berlin
Die ausgebildete Kosmetikerin, Heilpraktikerin und Krankenschwester Anja Zahn erarbeitet ein ganzheitliches Konzept, das über eine normale Kosmetikbehandlung...
kosmetikstudio-reinickendorf.de Haut Reinickendorf Kosmetikstudio Berlin Microdermabrasion Mitesser Behandlung Peeling
82 Möbeltaxi Berlin Transportunternehmen
13507
Berlin
Wir sind seit über 14 Jahren Ihr kompetenter und zuverlässiger Ansprechpartner für Kleintransporte aller Art egal ob...
moebeltaxi-berlin.de Mbeltaxi Transport Berlin Ikea Schrieb Bewertung Umzug Meinungen
83 Berolina Haushaltsgerätedienst Reparatur Haushaltsgeräte
10707
Berlin
berliner-waschmaschinenreparatur.de/ Berolina Reparatur Berlin Haushaltsgerätedienst Waschmaschinen Waschmaschine Uns Menü
84 Jura Espressomaschinen Kundendienst Berlin Kaffeemaschinen
10407
Berlin
Reparatur-Annahmestelle in Berlin Prenzlauer Berg Öffnungszeiten: Mo - Fr: 10:00 - 18:00 Uhr Sa - So: 11:00 -...
kaffeeautomaten-reparatur-berlin.de Reparatur Berlin Jura Delonghi Kundendienst Kaffeemaschine Kaffeeautomaten Saeco
85 DeLonghi Reparaturservice Berlin Reparatur
12209
Berlin
Kaffeemaschinen Reparatur Service und Kundendienst in Berlin Reparatur-Annahmestelle Oberhofer Weg 4 12209 Berlin - Lichterfelde Tel: 030 - 588 480 07 Öffnungszeiten: Mo...
kaffeeautomaten-service-berlin.de
86 RA Rainer Sebel Rechtsanwälte
10243
Berlin
Der erfahrene Volljurist Rechtsanwalt Rainer Sebel vertritt Privatpersonen wie auch Unternehmen insbesondere in den Rechtsgebieten Familienrecht, Arbeitsrecht...
kanzlei-sebel.de Arbeitsrecht Strafrecht Menü Rainer Sebel Friedrichshain Kanzlei Berlin
87 Hacke & Spitze | Das Fachgeschäft Tanzschuhe und
10961
Berlin
Hacke und Spitze ist ein großes Fachgeschäft für Tanzschuhe und Tanzbekleidung in Berlin-Kreuzberg. Das breitgefächerte Angebot...
hackeundspitze.de
88 Hacke & Spitze | Das Fachgeschäft Tanzschuhe und
10961
Berlin
Hacke und Spitze ist ein großes Fachgeschäft für Tanzschuhe und Tanzbekleidung in Berlin-Kreuzberg. Das breitgefächerte Angebot...
hackeundspitze.de
89 FiGD Fachinstitut für Informatik und Grafikdesign Weiterbildung
10407
Berlin
Wir sind ein bundesweit zertifizierter Bildungspartner für Fortbildungen und Intensiv-Qualifizierungen im Herzen Berlins – im Prenzlauer Berg....
figd.de Grafikdesign | Bildung Figd Fachinstitut Geförderte Buchhaltung Informatik
90 Domicile Innenausbau Tischlerei
12555
Berlin
Herstellung hochwertiger Möbel und Innenausbau aus Holzwerkstoffen in eigener Werkstatt. Vom Einzelmöbel bis zu komplexen Projekten, wie Wohnungsausbau...
domicile-online.de Z Y
91 Ernährungsberatung Gesundheit
10829
Berlin
Unabhängige Informationen über Medizin und ganzheitliche Gesundheit. Tipps und Rezepte für eine gesunde Ernährung. Ernährungsberatung. Empfehlung von...
das-gesundheitsplus.de Gesundheitsplus Gesundheit – See Moresee Less Ago Rezepte
92 Tischlerei Tischler
12555
Berlin
domicile-online.de Z Y
93 MS BAUAUSFÜHRUNG MALERMEISTERBETRIEB Maler
12621
Berlin
Wenn Sie auf der Suche nach einer Malerfirma aus Berlin sind, die qualitativ hochwertige Arbeiten anbietet, dann...
ms-bauausfuehrung.de
94 MS BAUAUSFÜHRUNG MALERMEISTERBETRIEB Maler
12621
Berlin
Wenn Sie auf der Suche nach einer Malerfirma aus Berlin sind, die qualitativ hochwertige Arbeiten anbietet, dann...
ms-bauausfuehrung.de
95 Bootsbörse Netboat Boote
12203
Berlin
Nationale und internationale Bootsbörse im Internet seit 1997. Besonders zu empfehlen für den Verkauf von Gebrauchtbooten. Hier...
netboat.com Fr Gebrauchtboote Boote Netboat Bootsbrse Bootsanzeigen Bersetzungsprogramm Seit
96 Rechtsanwalt Steffen Radlbeck Rechtsanwalt
12167
Berlin
Die Kanzlei ist auf dem Gebiet des Zivilrechts tätig. Schwerpunkte liegen auf dem Immobilienrecht, dem Miet- &...
anwalt-radlbeck.de Daten Google Radlbeck Website Steffen Berlin Fotoliacom Analytics
97 Dormis Ferienwohnungen Ferienhäuser
10783
Berlin
Wir sind eine dynamische Firma, die das Zusammenwirken zwischen dem Gast und dem Gastgeber erleichtern will, um...
dormis.com/ Nginx Services Booking Other Apartments Owners Policy How
98 Kaffeevollautomaten Reparatur Service Berlin Kaffeemaschinen Kaffeeautomaten
10559
Berlin
Jura DeLonghi Saeco Gaggia KitchenAid Reparatur Service Berlin Impressum Angaben gemäß § 5 TMG: KAFFEE BÄRLIN Haci Ahmet Bayram Alt-Moabit 120 10559 Berlin Kontakt: Telefon:...
kaffee-baerlin.de
99 Mietfair GmbH Mietrechtsberatung
10625
Berlin
Wir setzen uns für Deine Rechte ein Eine Wohnung in Berlin zu finden, die bezahlbar und attraktiv ist...
mietfair.de
100 13. TEXTILE ART BERLIN Textil
13355
Berlin
die TEXTILE ART BERLIN ist die größte Textilkunstmesse in Berlin: 110 Verkaufsstände, 32 Ausstellungen, 25 Workshops und...
textile-art-berlin.de Berlin Textile Workshops Modenschauen Ausstellungen Textilkunst Messe  »
101 Berolina Plastic Handels UG Verpackungsfolien
10627
Berlin
Der Konfigurator von BEROLINA plastic bietet Ihnen die Möglichkeit mit wenigen Klicks Ihre individuelle Folienverpackung zu gestalten....
verpackungsfolien-nach-mass24.de/ Berolina Folien Verpackungsfolien Folienkonfigurator Seitenfaltenbeutel Bestellung Konfiguration Maßen
102 Schuldenhilfe-Berlin | Ihre Schuldnerberatung mit Herz Schuldnerberatung
10117
Berlin
Wir haben uns auf die Königsklasse der Schuldnerberatung spezialisiert, die außergerichtliche Schuldenbereinigung. Werden Sie mit uns schuldenfrei ohne...
schuldenhilfe-berlin.de Schulden Berlin Insolvenz Schuldenhilfe Raus Schuldnerberatung Hilfe Sprechtage
103 Hörgeräte Hörgeräte
13469
Berlin
Hornig Hörgeräte Berlin - 3x in Berlin. Dirk Hornig, Hörgeräteakustiker mit Tüv Zertifikat lässt auch ihre Ohren...
hornig-hoeren.de/
104 Altkleiderverkauf Berlin Handel und
13127
Berlin
Altkleiderverkauf Bei uns finden Sie höchste unsortierte Qualität aus dem Raum Berlin. Container Sammelware aus Berlin zu Kilopreisen Unsortierte...
altkleiderverkaufberlin.com/ Altkleider Berlin Qualität Sammelware Altschuhe Unsortierte Mindestabnahmemenge Altkleiderverkauf
105 Anwalt Sozialrecht Berlin - Imanuel Schulz Sozialrecht
12043
Berlin
Kostenlose Hilfe im Sozialrecht (Hartz 4): Wir bieten Ihnen kostenlose Rechtsberatung im Sozialrecht (Hartz 4) im Rahmen...
rechtsanwalt-imanuel-schulz.de/sozialrecht-berlin-neukoelln/ Berlin Hartz Rechner Sozialrecht Prüfen Neukölln Jetzt… Anwalt
106 FARAWAYHOME Furnished Apartments Immobilien
10439
Berlin
Über FARAWAYHOME können Sie besten Serviced Apartments und möblierten Wohnungen z.B. in Berlin, Frankfurt, München oder Hamburg...
farawayhome.com
107 KitchenAid Reparatur Berlin Küchengeräte
10559
Berlin
KitchenAid Küchenmaschinen Service Berlin Impressum Angaben gemäß § 5 TMG: KAFFEE BÄRLIN Ahmet Bayram Alt-Moabit 120 10559 Berlin Kontakt: Telefon: 030 / 398 077 95 Telefax:...
kitchenaid-reparatur-service.de
108 Jura Kaffeeautomaten Reparatur Berlin Kaffeemaschinen
10559
Berlin
Reparatur-Service für Jura Kaffeemaschinen in Berlin...
jura-kundendienst-berlin.de
109 Jura Kaffeeautomaten Reparatur Berlin Kaffeemaschinen
10559
Berlin
Reparatur-Service für Jura Kaffeemaschinen in Berlin...
jura-kundendienst-berlin.de
110 Heilpraxis für Massage und Körpertherapie Massage und
12159
Berlin
Die Praxis für Massage und Körpertherapie liegt direkt am S-Bahnhof Friedenau in Schöneberg/Steglitz in ruhiger Lage. Ich...
heilpraxis-valenti-clari.de Z Y
111 Pflegeversicherung Heute Versicherung
13086
Berlin
Wir erklären, was alles wichtig für die private und gesetzliche Pflegeversicherung ist. Alle Testergebnisse stehen dem Leser...
pflegeversicherung-heute.de/ Pflegeversicherung Private Test Vergleich Freibetrag Besonderheiten Gesetzliche Krankenzusatz
112 Medizinstudium Schule
10117
Berlin
Ein Medizinstudium absolvieren? Für die optimale Vorbereitung ist Premedicine Berlin der Ansprechpartner. Egal ob es ein Medizinstudium im...
premedicine-berlin.de Medizinstudium Ausland Informationen Academy Vorbereitung Medical Berlin Zahnmedizin
113 günstige Transporte Umzüge & Entsorgungen Transporte &
13507
Berlin
Wir sind seit über 15 Jahren Ihr kompetenter und zuverlässiger Ansprechpartner für Kleintransporte aller Art egal ob...
moebeltaxi-berlin.de Mbeltaxi Transport Ikea Berlin Schrieb Bewertung Umzug Meinungen
114 Fotostudio Fotografie
12555
Berlin
cross space studio
115 Woodford Trailers in Berlin Firmen
13359
Berlin
Entdecken Sie die große Auswahl an Anhänger Woodford. Wir haben Ihren Anhänger, vom Dreiseitenkipper bis zum...
autotrailer-berlin.de Woodford Geschlossene Anhänger Trailer Rl Galaxy Geschlossen
116 Unsichtbare Zahnspange bei den Zahnärzten am Zahnarzt
10785
Berlin
Schiefe Zähne ade! Mit der unsichtbaren Zahnspange (Invisalign) können Sie in kurzer Zeit Ihre Zähne wieder in...
zahnaerzte-am-potsdamer-platz.de Berlin Zähne Zahnarzt Prophylaxe Praxis Leistungen Schnarchen Bleaching
117 Kampfkunst Selbstverteidigung
88662
Überlingen
serradaescrima.de Domain United Portfolio Domains Registriert Platzhalter Rechte Einstellungen
118 Fenster-Komm Fensterbau
13509
Berlin
fenster-komm.net/ Fenster Daten Google Komm Website Türen Berlin Analytics
119 Kfz-Gutachter Berlin und Brandenburg Kfz-Gutachter
10551
Berlin
Auf der Suche nach einem schnellen und erfahrenen Kfz-Gutachter in Berlin und Brandenburg? Besuchen Sie kfzgutachterberlin.net und...
kfzgutachterberlin.net/ Kfz Berlin Gutachter Fahrzeugs Wertgutachten Unfallgutachter Gutachten Brandenburg
120 Lieblingsbrille Augenoptik Augenoptiker
14199
Berlin
lieblingsbrille-augenoptik.de Gleitsichtbrille Monatslinsen L Sehstärke Augenoptik Ihr Lesebrille N
121 Barrierefreies Bad Barrierefrei
12437
Berlin
Seniorengerecht und Behindertengerechter Umbau Barrierefreies Bauen, Planen & Modernisieren für gehandicapte Menschen. Menschen mit einem Handicap / gehandicapt, sind leistungsschwächere...
handicap-buscher.de Menschen Wohnung Wanne Arbeiten Barrierefreies Handicap Nun Plötzlich
122 Heilpraktiker Wanitschek & Vigl Berlin Heilpraktiker
12047
Berlin
Herzlich willkommen auf unserer Präsenz auf stadtbranche.de. Sind Sie auf der Suche nach einem Heilpraktiker/ einer Heilpraktikerin...
sebastianvigl.de
123 Heilpraktiker Wanitschek & Vigl Berlin Heilpraktiker
12047
Berlin
Herzlich willkommen auf unserer Präsenz auf stadtbranche.de. Sind Sie auf der Suche nach einem Heilpraktiker/ einer Heilpraktikerin...
sebastianvigl.de
124 Profitabel Forex Handeln und als Day Finanzen Trading

Berlin
Als Trader von zu Haus arbeiten und mit hoher Unabhängigkeit die finanziellen Ziele erreichen. Genau diese Möglichkeiten...
maniforex.de Forex Trading Strategie Trader Finde Psychologie Traden Risiko
125 Vital Umzüge Transporte Logistic
13347
Berlin
Über uns/ unser Unternehmen Wir verstehen uns als Dienstleister, für den die Kundenzufriedenheit an erster Stelle steht. Bei...
vital-umzuege.de Berlin Umzüge Umzug Vital Wedding Günstig Umzugsfirma Transport
126 Studio Pur Fotogen GmbH Fotostudio
10249
Berlin
studio-pur-fotogen.de/ Studio Fotogen Preise Pur Kindercasting Bilder Bewerbungsfotos Berlin
127 Glaserei Thiel GmbH Glaserei
12555
Berlin
berlin-glaserei-thiel.de/ Glaserei Berlin Thiel Köpenick Mahlsdorf Umgebung Kunstglaserei Glas
128 Schneeball GmbH Winterdienst Grünanlagenpflege
12349
Berlin
In Zukunft zufrieden! Als Unternehmen, mit einem anderen Konzept, gilt es viele Punkte zu beachten und Herausforderungen zu...
schneeball-gmbh.de Winterdienst Berlin Information_ Schneeball Berliner Notdienst Unternehmen Berlintelefon
129 Pylones Geschenkartikel
12163
Berlin
Pylones stiftet Unruhe in der Welt der Geschenke: wir schütteln sie durch, erfinden sie neu, geben ihnen...
pylones.com
130 Pylones Geschenkartikel
10719
Berlin
Pylones stiftet Unruhe in der Welt der Geschenke: wir schütteln sie durch, erfinden sie neu, geben ihnen...
pylones.com
131 Pylones Geschenkartikel
10178
Berlin
Pylones stiftet Unruhe in der Welt der Geschenke: wir schütteln sie durch, erfinden sie neu, geben ihnen...
pylones.com
132 Agentur 247 Limousinenservice
10719
Berlin-Wilmersdorf
Wir bieten mit unserer Agentur Privatpersonen, Geschäftsleuten und Prominenten einen komfortablen Shuttle Service bzw. Limousinenservice an...
agentur247.de Berlin Agentur Uns Mobilitätslösungen Services Bieten Flughafentransfer Außerhalb
133 Edition Monhardt Verlag
12163
Berlin
Edition Monhardt ist ein neuer unabhängiger Berliner Verlag für Lyrik, kurze Prosa, Essayistik und Kunst. Gegenwartsliteratur aus...
monhardt.de Monhardt Berlin Edition Warenkorb Mein Striebel Buchhandel Bernhard
134 Klaviere Berlin Klaviergeschäft
10585
Berlin
Das Pianohaus Listmann ist seit vielen Jahren der Ansprechpartner rund um Klaviere in Berlin. Ein Klavier kaufen, Klavier...
pianohaus-berlin.com Berlin Klavier Klaviere Flügel Brandenburg Schimmel Listmann Pianohaus
135 Watershed Packaging DE Dienstleistung
10965
Berlin
Watershed DE produziert Schrumpfschlauchetiketten und bedruckte Verpackung. Sehen Sie sich unser wundervolles Portfolio von flexiblen Verpackungen an....
watershed-packaging.de/
136 Starklasers.com Laser
10115
Berlin
Starklasers.com ist eine professionelle Laserpointer-Shop, mit allen Arten von Laser-Ausrüstung: grüner Laser, roter Laser, blauer Laser, gelber...
starklasers.com/ Laserpointer Laser Mw Grün Blau Rot Nm €
137 Hipster Escape e.K. Unterhaltung
10247
Berlin
hipster-escape-berlin.de Escape Spiel Hipster Party Rätseln Games Wohnung Buchung
138 Partyservice Berlin Bauern-Kate.de Partyservice Berlin Bauern-Kate.de Partyservice Berlin
10589
Berlin
Partyservice Berlin Bauern-Kate.de Seit 1981 sind wir nun schon als erfahrener Dienstleister im Bereich Partyservice-Berlin und Catering in...
partyserviceberlin.org/ Büffet Berlin Partyservice Bauern Catering Kalte Rustikales Büffets
139 Krupa Sicherheitsdienst GmbH aus Berlin Sicherheitsdienst Security
12203
Berlin
Die Krupa Sicherheitsdienst GmbH aus Berlin ist Ihr seriöser, kompetenter und vertrauenswürdiger deutschlandweiter Partner. Dienstleistungen: Security, Wachschutz, Veranstaltungsschutz...
krupa-sicherheitsdienst.de Berlin Sicherheitsdienst Security Wachschutz Sanitter Brandwachen Krupa Sicherheit
140 jobtensor Jobbörse
10435
Berlin
Mit dem Ziel einer optimierten Online-Jobsuche dient die Internetplattform jobtensor als Vermittler zwischen Arbeitgebern und interessierten Bewerbern...
jobtensor.com Jobtensor Job Forschung Luft Finde Informatik Preise Linkedin
141 Immer aktuelle Schrottpreise bei Hein Schrotthandel Schrotthandel -
15566
Schöneiche bei Berlin
Sie bekommen bei Hein Schrotthandel GmbH stets faire und transparente Schrottpreise geliefert, sie sind tagesaktuell und wir...
hein-schrotthandel.de Schrotthandel Schrott Schrottpreise Entsorgung Ihrem Hein Ankauf Metallschrott
142 Müller & Kollegen Rechtsanwälte Anwalt
13595
Berlin
rechtsanwaelte-berlin.com Kollegen Müller Rechtsanwälte Berlin Arbeitsrecht Mietrecht Groß Hakenfelde
143 Rechtsanwalt Steffen Radlbeck Rechtsanwalt
12167
Berlin
Meine Kanzlei hat sich auf dem Gebiet des Immobilienrechts spezialisiert und hat über zehn Jahre erfolgreich Mandanten...
anwalt-radlbeck.de
144 Rechtsanwalt Steffen Radlbeck Rechtsanwalt
12167
Berlin
Meine Kanzlei hat sich auf dem Gebiet des Immobilienrechts spezialisiert und hat über zehn Jahre erfolgreich Mandanten...
anwalt-radlbeck.de
145 Research Personal Personalberatung
10405
BERLIN
Personalberatung in Berlin gesucht? Dann ist WPR der Spezialist . Das Unternehmen WPR bietet Unterstützung für Rekrutierungsmaßnahmen...
wpr-research.de Manager Wm Festanstellung Operations Research Jobs Real Department
146 Tiont Berlin Entrümpelungen
10117
Berlin
Entrümpelungen Tiont Berlin Komplett Service pauschal sofort Wohnungsauflösung Sperrmüll Haushaltsauflösungen zum Festpreis Keller Entrümpelung Dienst...
tiont.de Entrümpelung Berlin Tiont Notdienst Entrümpelungen Sperrmüll Keller Express
147 Rechtsanwalt Dr. Christopher Kasten Rechtsanwalt
10777
Berlin
anwalt-kasten.de/ Daten Google Berlin Familienrecht Kasten Fotoliacom Website Christopher
148 Sperrmüll Berlin Entsorgung
13347
BERLIN
Das Unternehmen Kraftzone ist der richtige Partner wenn es um die Wohnungsauflösung geht. Durch Erfahrung und Know-How...
kraftzone.de Partner Dip Aengevelt Berlin Vermittelt Sperrmüll Magdeburg Entrümpelung
149 Hager & Partner GbR Rechtsanwälte und Rechtsanwalt
10629
Berlin
Wer die Kanzlei Hager & Partner betritt, begegnet fünf erfahrenen Juristen. Was sie verbindet, ist ihre Leidenschaft...
kanzlei-hager.de/ Hager Partner Rechtsanwalt Berlin Erbrecht Kanzlei Team Georg
150 030 Datenrettung Berlin Datenrettung
13187
Berlin
Datenrettung und Datenwiederherstellung von Festplatte, NAS, RAID-Servern, SSD sowie Flash-Speichern und Handy....
030-datenrettung.de Datenrettung Festplatte Ssd Nas Festplatten Server Berlin Usb
151 List and Sell - Webdesign Marketing Webdesign Agentur
12439
Berlin
Ihrem Fullservice-Anbieter rund um eBay- und Amazon-Shops sowie eCommerce-Lösungen. Sie haben ein Produkt? Wir kümmern uns um...
listandsell.de Design Shop Amazon Webshops Leistungen Optimierung Beratung Ebay
152 Vedis Indisches Restaurant Cocktailbar Prenzlauer Berg Indische Restaurants
10437
Berlin
Seien Sie herzlich eingeladen, das romantische, exotische und warme Ambiente im Vedis zu genießen. Direkt in Berlin...
vedis.berlin Restaurant Vedis Berlin Indisches Prenzlauer Berg Indian Küche
153 Entrümpelung24 Berlin Entrümpelung Wohnungsauflöung
13347
Berlin
Als professionelle Firma für Entrümpelungen und Entsorgungen aus Berlin übernehmen für gerne für Sie Ihre Wohnungsauflösung sowie...
entruempelung24.berlin Entrümpelung Berlin Umzug Malerarbeiten Entsorgung Umzugsservice Aufbau Möbel
154 Eventfotografie Berlin | Valentin Paster Eventfotograf
12353
Berlin
Hinterlassen Sie eine Spur! Ein Event ist ein gut durchdachtes und sorgfältig geplantes Ereignis. Bei der Eventfotografie setzen...
berlin-eventfotograf.de/ Hochzeit Interieur Galerie Eventfotograf Events Europaweit Jobs Berlin
155 LoveMoments | Hochzeitsfotograf Valentin Paster aus Hochzeitsfotograf
12353
Berlin
Falls Ihr in Berlin oder Europa heiraten möchtet und gerade auf der Suche nach dem richtigen Hochzeitsfotografen seid, dann...
lovemoments.de Hochzeitsreportage Hochzeit Bilder Liebe Euch Berlin Hochzeitsfotograf Hochzeitsalbum
156 Hypnoanalyse Hypnosetherapie Gesundheit
13189
Berlin
Hypnoanalyse, die moderne Therapieform, die Hypnose und traditionelle Therapiemethoden vereint. Für schnelle und anhaltende Erfolge bei Depressionen...
lammerding-hypnose.de Hypnosetherapie Berlin | Hypnoanalyse Pankow Lebenskrisenkurzzeittherapie Depressionängsten Klientenzentrierte
157 http: www.maytoni.de Handel
10178
Berlin
Lampen & Leuchten Großhandel Verkauf vom Hersteller. Das umfassende Angebot an Kronleuchtern wird ständig durch neue Modelle...
maytoni.de Wholesale Chandeliers Crystal Lighting Modern Europe Street Classic
158 http: www.maytoni.de Handel
10178
Berlin
Lampen & Leuchten Großhandel Verkauf vom Hersteller. Das umfassende Angebot an Kronleuchtern wird ständig durch neue Modelle...
maytoni.de Wholesale Chandeliers Crystal Lighting Europe Modern Street Classic
159 Kopierladen Copyshop
10405
Berlin
Wir sind Dein Kopierladen. Preiswert, ­zu­verlässig und schnell. Du findest uns ­4 mal in Berlin oder im...
kopierladen-berlin.de/ Kopierladen Berlin Prenzlauer Berg Pankow Papier Aufkleber Sa–
160 Kopierladen Copyshop
10247
Berlin
Wir sind Dein Kopierladen. Preiswert, ­zu­verlässig und schnell. Du findest uns ­4 mal in Berlin oder im...
kopierladen-berlin.de/ Kopierladen Berlin Prenzlauer Papier Berg Pankow Aufkleber Kopien
161 Kopierladen Copyshop
13187
Berlin
Wir sind Dein Kopierladen. Preiswert, ­zu­verlässig und schnell. Du findest uns ­4 mal in Berlin oder im...
kopierladen-berlin.de/ Kopierladen Berlin Prenzlauer Pankow Berg Papier Buchbindungen Aufkleber
162 Copyshop Copyshop
13088
Berlin
Wir sind Dein Kopierladen. Preiswert, ­zu­verlässig und schnell. Du findest uns ­4 mal in Berlin oder im...
kopierladen-berlin.de/ Kopierladen Berlin Prenzlauer Papier Berg Pankow Weissensee Buchbindungen
163 orderbird - iPad-Kassensystem für die Gastronomie Software
10969
Berlin
orderbird ist das Nr. 1 iPad Kassensystem für die Gastronomie. Über 6500 Restaurants, Cafés, Bars und andere...
orderbird.com English Deutsch ✓ Kassensystem De Blog Ipad Presse
164 Classic55 Oldtimervermietung Oldtimervermietung
12527
Berlin
Wir vermieten mit Chauffeur perfekt restaurierte amerikanische Oldtimer der 50er Jahre. Diese werden gerne für Film, Hochzeiten...
classic55.de Berlin Oldtimer Hochzeitsauto Hochzeit Cadillac Jahre Wagen Hochzeitsfotograf
165 Rechtsanwaltskanzlei Kuletzki Rechtsanwalt
12187
Berlin
Rechtsanwalt Stephan Kuletzki und Rechtsanwältin Corinna Mnich der Rechtsanwaltskanzlei Kuletzki sind Ihre kompetenten Ansprechpartner in allen juristischen...
rechtsanwaltkuletzki.de Kuletzki Rechtsanwalt Arbeitsrecht Verkehrsrecht Vertragsrecht Berlin Rechtsanwältin Kanzlei
166 Hochzeitsfotograf in Berlin - Fotos Eurer Hochzeitsfotograf
12101
Berlin
Fotos Eurer Hochzeit – Euer Hochzeitsfotograf in Berlin für gefühlvolle Hochzeitsfotografie und emotionale Hochzeitsreportagen. Traumhafte Hochzeitsreportagen in Berlin...
fotos-eurer-hochzeit.de Hochzeitsreportage Berlin Hochzeitsfotograf Euch Trauung Boudoir Wedding Kleine
167 Berlin Entrümpelungen Entrümpelung Wohnungsauflöung
13347
Berlin
Für eine gründliche und reibungslose Entrümpelung stehen wir mit unserem Namen. Von Haushaltsauflösungen über Keller und Büroauflösungen...
berlin-entruempelungen.de/ Berlin Entrümpelungen Malerarbeiten Umzugsservice Umzüge Umzug Preise Haushaltsauflösung
168 Dr. med. Natalie Reytan Gesundheit
10117
Berlin
Ein umfassendes Spektrum bietet die private Praxis für Dermatologie Dr. Reytan in Berlin Mitte an. In der...
hautarztpraxisberlin.de – Hautarztpraxis Kosmetik Akne Allgemein Therapie Kindern Beratung
169 Hellsehen und Wahrsagen Esoterik
10969
Berlin
Sofortberatung unter: 09003 – 101016 (1, 52EUR/Min) Ich bin ein hellsichtiges Medium und arbeite schon langjährig als spirituelle...
orphina.de Kartenlegen Magie_ _hellsichtiges Phone ~dotdeb+ Jenseitskontakte Wahrsagen Esoterik
170 Fakten zum Thema Mineralwasser Nahrungsmittel
13086
Berlin
Auf der hier genannten Seite, werden Anbieter und Abfüller von Mineralwasserquellen vorgestellt und entsprechend bewertet....
mineralwasser-testsieger.de/ Mineralwasser Medium Gerolsteiner Testsieger Wasser Test Vergleich Stiftung
171 PEC Reinigungsmaschinen Berlin GmbH Reinigungsmaschinen
13055
Berlin
PEC Reinigungsmaschinen Berlin GmbH ist Ihr zuverlässiger Partner wenn es um die Vermietung und Kauf von Reinigungstechnik...
reinigungsmaschinen-berlin.de/ Berlin Reinigungsmaschinen Scheuersaugmaschinen Industriesauger Hochdruckreiniger Vermietung Reinigungstechnik Zubehör
172 MiAna GmbH & Co. KG Mode
10829
Berlin
Unser Onlineshop vertreibt Produkte der Marke GRETCHEN, welche als berliner Accessoire Brand gegründet wurde, mit dem Ziel...
mygretchen.com/shop/ Gretchen Gloves Berlin Anne Schmitt Summer Christin Purses
173 Die Vollkasko Heute Versicherung
13086
Berlin
Auf dieser Seite werden die Vorteile und mögliche Nachteile von Anbietern der Vollkaskoversicherung vorgestellt. Durch Testberichte und...
vollkasko-heute.de/ Vollkasko En Angeboten Langeempfehlung Möglichkeit Vollkaskoschutz Gelangen Mindern
174 MPU-Vorbereitung online bei mentavio.com Psychologie
12437
Berlin
mentavio bietet professionelle MPU-Vorbereitung und psychologische Beratung per Internet an. Mit nur wenigen Klicks können Sie bei...
mentavio.com/mpu-vorbereitung Z Y
175 Rechtsanwalt Jan Bartholl Rechtsanwalt
10629
Berlin
Der Anwalt für Reiserecht bietet Rechtsberatung in Fällen der Anspruchsverfolgung von Entschädigung bei Flugverspätung, Flugannullierung oder Flugänderung. Die...
rechtsanwalt-bartholl.de Bartholl Kanzlei Reiserecht Services Rechtsanwalt Lewandowski Legal Recht
176 Rechtsanwalt Jan Bartholl Rechtsanwalt
10629
Berlin
Der Anwalt für Reiserecht bietet Rechtsberatung in Fällen der Anspruchsverfolgung von Entschädigung bei Flugverspätung, Flugannullierung oder Flugänderung. Die...
rechtsanwalt-bartholl.de Bartholl Kanzlei Reiserecht Rechtsanwalt Services Lewandowski Legal Recht
177 Rechtsanwalt Jan Bartholl Rechtsanwalt
10629
Berlin
Der Anwalt für Reiserecht bietet Rechtsberatung in Fällen der Anspruchsverfolgung von Entschädigung bei Flugverspätung, Flugannullierung oder Flugänderung. Die...
rechtsanwalt-bartholl.de Bartholl Kanzlei Reiserecht Recht Services Lewandowski Legal Rechtsanwalt
178 Rechtsanwalt Jan Bartholl Rechtsanwalt
10629
Berlin
Der Anwalt für Reiserecht bietet Rechtsberatung in Fällen der Anspruchsverfolgung von Entschädigung bei Flugverspätung, Flugannullierung oder Flugänderung. Die...
rechtsanwalt-bartholl.de/ Bartholl Kanzlei Reiserecht Legal Rechtsanwalt Lewandowski Services Recht
179 Bergemann & Weidner Rechtsanwälte Bergemann & Weidner Rechtsanwälte Rechtsanwälte
13407
Berlin
Die Rechtsanwaltskanzlei Bergemann & Weidner wurde in den 70er Jahren im Norden Berlins gegründet. Seit 2001 ist...
bergemann-weidner.de
180 Steinkühler – Kanzlei für Arbeits- und Rechtsanwalt
10625
Berlin
Wir sind ein 6-köpfiges Team hochspezialisierter und erfahrener Anwälte. Dank bundesweiter und internationaler Mandate erweitern wir täglich...
steinkuehler-legal.com/ Reihe Platz Leistungen Steinkühler Kanzlei Gründer Arbeitnehmer Unternehmer
181 Pinkcube Werbeartikel Werbeartikel
10243
Berlin
Online Werbeartikel bestellen bei Pinkcube Wir sind Pinkcube. Wir liefern Ihnen Werbeartikel über sehr benutzerfreundliche Webshops. Wir machen...
pinkcube.de Logo ✔ Bedrucken Günstig Werbeartikel Werbemittel Berlin Artikel
182 Dolmetscher Dolmetscher
10179
Berlin
DOLMETSCHERSERVICE Konferenzdolmetschen, Gesprächs- und Begleitdolmetschen M.A. Konferenzdolmetscherin, Dolmetscherin und ermächtigte Übersetzerin am Landgericht Berlin für die Sprachen Englisch und...
dolmetscherservice.org Agb – Dolmetscherservice Honorar Deutsch Profil Leistungen Jeder
183 Digitale Beratung Digitalagentur
13359
Berlin
Erreichen Sie Ihre Kunden zielgenau im Internet: Wir optimieren und vermarkten Ihre Webpräsenz und machen Sie sichtbar...
digitaleberatung.com Kunden Digitale Mittelstand Beratung Agentur Leistungen Unternehmen Blog
184 A . Müller Umzug Berlin günstiger Umzüge
10117
Berlin
A . Müller ist Ihre Umzugsfirma, Umzugsunternehmen zum Umzugskosten sparen bei Umzug nach Berlin , bei Umzug...
tesu-umzug.berlin Umzug Berlin Lager München Packmaterial Hamburg Irland Frankfurt
185 Erfahrungen24.eu Bewertungen
13403
Berlin
Erfahrungen24 bietet ein intuitives System zum Lesen und Abgeben von Bewertungen für Online Shops, Dienstleister, Produkte und...
erfahrungen24.eu/ Test Erfahrungen Erfahrung Reviews Erfahrungsberichte Shops Bewertungen Preisvergleich
186 THE BRETTINGHAMS GmbH Internetagentur
10629
Berlin
Internetagentur für digitale Lösungen aus Berlin. Full-Service Digitalagentur für Strategie, Webdesign, TYPO3 Programmierung und Online Marketing....
brettingham.de Internetagentur Berlin Services Marketing Unternehmen Agentur Brettinghams Marken
187 Dudelsack Unterricht in Berlin Musikunterricht
10247
Berlin
Dudelsack Unterricht für Totalanfänger bis Fortgeschrittene, für Kinder (ab 10 Jahre), Jugendliche und Erwachsene in Berlin. > Professioneller...
dudelsackunterricht.jimdo.com Unterricht Berlin Dudelsack Info Z
188 Alex Entrümpelung Berlin Entrümpelung
10243
Berlin - Friedrichshain
Entrümpelung Berlin Die Entrümpelungs-Profis von Alex Entrümpelung Berlin helfen Ihnen schnell und unkompliziert bei Ihrer Entrümpelung in Berlin....
alex-entruempelung.de Berlin Entrümpelung Leistungen Ankauf Gartenpflege Wohnungsauflösung Uns Zuverlässig
189 CAPLAN & GREEN Executive-Search
13627
Berlin
Caplan & Green ist das Talent Management und Executive Search Unternehmen mit der größten Marktbreite. Unsere Berater unterstützen nationale...
caplangreen.com Executive Green Caplan Talent | Geht Partner Nächsten
190 CAPLAN & GREEN Talent Management
13627
Berlin
Caplan & Green ist das Talent Management und Executive Search Unternehmen mit der größten Marktbreite. Unsere Berater unterstützen nationale...
caplangreen.com Green Executive Caplan | Talent Geht Fach Managers
191 PRESTIGE Kosmetikakademie Kosmetikschule
10713
Berlin
Wir sind eine DEKRA zertifizierte Bildungsakademie und Mitglied beim BfD Bundesverband der Fachkosmetiker/-innen in Deutschland. Mit der DEKRA-...
prestige-akad.de Prestige Ausbildung Kosmetikakademie Wellness Dozenten Kosmetik Bildung Schulung
192 Apple Reparatur Berlin Apple Service
10707
Berlin
Ihr Mac oder iPhone macht mal wieder nicht das, was es soll? - Kein Problem, wir von...
apple-reparatur-berlin24.de/ Reparatur Berlin Apple Bewertungen Rufen Agb Joomla Falls
193 PC und Notebook Reparatur Berlin Pc und
10707
Berlin
Sie suchen einen kompetenten, kundenorientierten Service, der dazu noch preiswert ist? Dann sind wir, PC-Reparatur-Berlin24, Ihr Ansprechpartner...
pc-reparatur-berlin24.de/ Pc Reparatur Berlin Fachmann Hilfe Potsdam | Mac
194 Videoüberwachung Einbau Berlin & Umland Videoüberwachung
10707
Berlin
Wollen Sie wissen, wer ein- und ausgeht oder bei Ihnen klingelt? Wollen Sie von überall auf der...
xn--videoberwachung-berlin24-zsc.de/ Videoüberwachung Berlin Umland überwachungssysteme Ama Essen Kameraüberwachung Düsseldorf
195 DJ Sascha B DJ

Berlin
professioneller DJ Service in ganz Deutschland...
dj-sascha-b.de Sascha Dj | Professioneller Hochzeiten Events Anfrage Hochzeit
196 iSpodBerlin Webdesign
12349
Berlin
Professionelle und aktuelle Websites sind ein Muss für Gründer, Startups, Selbstständige und Unternehmen Ihre Web-, Blog - ...
ispod-webagentur.de/ | Website Erstellen Webagentur Anfang Texte Professionelle Fairen
197 iSpodBerlin Webdesign
12349
Berlin
Professionelle und aktuelle Websites sind ein Muss für Gründer, Startups, Selbstständige und Unternehmen Ihre Web-, Blog - ...
ispod-webagentur.de/ | Erstellen Website Webagentur Webdesign Websitescontent Firmenwebsite Socialmedia
198 Ratenkredits-Vergleiche Finanzen
13086
Berlin
Wir stellen unterschiedliche Anbieter von Darlehen und Krediten vor. So können Kreditnehmer das tatsächliche Leistungsniveau erkennen. Alle...
ratenkredits-vergleiche.de/ Vergleich Ratenkredit Vergleichen Aktuell Unserem Vergleichsportal Angebot Angebote
199 Waschmaschine Abholung Berlin Entrümpelung
10117
Berlin
Sperrmüll Abholung in Berlin Komplett Service Entrümpelungen aller Art sofort Möbel Sperrholz Waschmaschine Abholung Berlin Keller Entrümpelung...
xn--sperrmllabholung-berlin-hpc.org Berlin Sperrmüllabholung Sperrmüll Waschmaschine Abholung Möbel Berlinorg Elektrogeräte
200 Hochzeitsfotograf in Berlin - Fotos eurer
12101
Berlin
Fotos Eurer Hochzeit – Euer Hochzeitsfotograf in Berlin für gefühlvolle Hochzeitsfotografie und emotionale Hochzeitsreportagen. Traumhafte Hochzeitsreportagen in Berlin...
fotos-eurer-hochzeit.de Hochzeitsreportage Berlin Hochzeitsfotograf Trauung Boudoir Euch Preise Begleitung
201 Detektei AC online Detekteien
14057
Berlin
Ihr professionellen IT-Dienstleister - Detektei AC Lösungen für Verbesserungen Konkrete Lösungen zum einem erfolgreichen IT-Sicherheitsmanagement und Verbesserungen anzubieten, würde...
detektei-ac.de
202 Detektei AC online Detekteien
14057
Berlin
Ihr professionellen IT-Dienstleister - Detektei AC Lösungen für Verbesserungen Konkrete Lösungen zum einem erfolgreichen IT-Sicherheitsmanagement und Verbesserungen anzubieten, würde...
detektei-ac.de
203 Detektei AC online Detekteien
14057
Berlin
Ihr professionellen IT-Dienstleister - Detektei AC Lösungen für Verbesserungen Konkrete Lösungen zum einem erfolgreichen IT-Sicherheitsmanagement und Verbesserungen anzubieten, würde...
detektei-ac.de Detektei Privatdetektive Observationen Informationen Familie Consulting Ermittlungen Ermitteln
204 Detektei AC online Detekteien
14057
Berlin
Ihr professionellen IT-Dienstleister - Detektei AC Lösungen für Verbesserungen Konkrete Lösungen zum einem erfolgreichen IT-Sicherheitsmanagement und Verbesserungen anzubieten, würde...
detektei-ac.de Detektei Privatdetektive Informationen Wirtschaftsdetektei Preiswerte Ermittlungen Blog Preise
205 Detektei AC online Detekteien
14057
Berlin
Ihr professionellen IT-Dienstleister - Detektei AC Lösungen für Verbesserungen Konkrete Lösungen zum einem erfolgreichen IT-Sicherheitsmanagement und Verbesserungen anzubieten, würde...
detektei-ac.de Detektei Privatdetektive Recherche Preiswerte Ac | Observation Fingiertemermitteln
206 Detektei AC online Detekteien
14057
Berlin
Ihr professionellen IT-Dienstleister - Detektei AC Lösungen für Verbesserungen Konkrete Lösungen zum einem erfolgreichen IT-Sicherheitsmanagement und Verbesserungen anzubieten, würde...
detektei-ac.de
207 Detektei AC online Detekteien
14057
Berlin
Ihr professionellen IT-Dienstleister - Detektei AC Lösungen für Verbesserungen Konkrete Lösungen zum einem erfolgreichen IT-Sicherheitsmanagement und Verbesserungen anzubieten, würde...
detektei-ac.de Privatdetektive Detektei Ermitteln Privat | Wirtschaftsdetektei Familie Ermittlungen
208 Histavino Wein
10997
Berlin
Die Seite Histavino ist für Menschen interessant, die trotz ihrer Histaminintoleranz nicht auf einen guten Tropfen Wein...
histavino.com Lebensmittel Wein Histamingeprüfter Histamin Weine Histavino Gluten Essig
209 Zahnarzt für Zahnimplantate Berlin Mitte Zahnarzt Oralchirurgie
10785
Berlin
Zahnarzt für Zahnimplantate in Berlin Das Zahnarztzentrum am Potsdamer Platz in Berlin Mitte besteht aus einem erfahrenen Team...
zahnarzt-am-potsdamer-platz.de/ Berlin Prophylaxe Zahnarzt Zahnmedizin Invisalign Potsdamer Parodontitis Behandlung
210 KOR7 MEDIA Marketing
10587
Berlin
KOR7 MEDIA ist eine Agentur für digitales Marketing und Content Produktion. Wir steigern Ihren Unternehmens- und Markenwert...
kor7media.de Instagram Marketing Influencer Media Social Content Agentur Produktion
211 BU Sinnvollschutz Versicherung
13086
Berlin
Unsere Firma erklärt genau, ob und wann eine private Berufsunfähigekeitsversicherung sinnvoll ist. Wir stellen die Stärken und...
berufsunfaehigkeitsversicherungen-sinnvollschutz.de/ Berufsunfähigkeitsversicherung Sinnvoll Angebot Zum Sinnvollschutz Wann News Polizisten
212 Neue Dusch Oase an einem Tag Sanitär
10709
Berlin
Die Berliner Preis Revolution : Umbau Wanne zu Dusche - an einem Tag Preiswert und Fachgerecht :...
flache-dusche.de Z Y
213 Öltank-Service Tobias Obermann Tankentsorgung
13509
Berlin
Tankreinigung und Tankentsorgung zum Festpreis. Sauber, Schnell und Zuverlässig durch den Familienbetrieb aus Berlin. Mit Modernsten Maschinen...
oeltank-service.eu Demontage Preise Leistung öltank Tankdemontage Heizöltank Tobias Berlin
214 Entsorgo Containerdienst Entsorgung
12049
Berlin
Buche Deine Entsorgung oder Entrümpelung jetzt online! Bei Entsorgo.de kannst Du innerhalb von nur 3 Minuten die Kosten...
entsorgo.de/ Entrümpelung Haushaltsauflösung | ✓ Containerdienst Dresden Entsorgung Container
215 Schmuckankauf Berlin Lichterfelde Juwelier Haeger Juwelier
12207
Berlin
Möchten Sie Ihr Altgold verkaufen? Sind Sie im Besitz von altem Schmuck, Zahngold oder Industriegold? Dann überlegen...
juwelier-haeger.de/berlin Schmuck Gold Geschenke Diamanten Berlin Rolex Modi Vertrauen
216 Schmuckankauf Berlin Juwelier Haeger Juwelier
10711
Berlin
Sie möchten Platinschmuck veräußern? Sie wollen einen Ring verkaufen? Ihr alter Silberschmuck entspricht nicht mehr Ihrem Geschmack?...
juwelier-haeger.de/berlin Schmuck Gold Geschenke Diamanten Berlin Markenschmuck Freundschaftsringe Schmückendes
217 Schah Sedi und Schah Sedi Rechtsanwälte Rechtsanwalt
10719
Berlin
Schah Sedi und Schah Sedi ist eine der in Deutschland führenden Kanzleien auf dem Gebiet des Personenschadensrechts....
schah-sedi.de/ Schah Sedi Schmerzensgeld Büro Anfrage Navigation Kostenlose Rechtsanwälte
218 Fenster Reparaturen für Berlin und Brandenburg Fenster und
13403
Berlin Reinickendorf
Ihr Berliner Servicepartner für Fenster Reparaturen/Umbau/Neubau/Wartungen für den gesamten Berliner Raum und Brandenburg. Seit nunmehr über 20...
fensterdurchblick.com Berlin Fenster Reparatur Fensterbau Tren Sonnenschutz Markisen Montage
219 Entrümpelung Berlin Entrümpelung
13089
Berlin
Entrümpelung vornehmen lassen – Ihr Ansprechpartner in Berlin Wir übernehmen sogar die Entrümpelung Ihres Grundstücks und sind jederzeit...
aflex.berlin Berlin Entrümpelung Aflex Entsorgung Wohnungsauflösung Dachboden Wohnung Sperrmüll
220 Antiquitäten Schmuck und Altgold Ankauf Berlin Antiquitäten
12207
Berlin
Antique Galerie: Hier können Sie Antiquitäten, Altgold, Schmuck und Diamanten in Berlin Lichterfelde verkaufen. Der Schmuckankauf der...
antiquegalerie.de/standorte/antiquitaeten-berlin-lichterfelde Antiquitäten Kurfürstendamm Berlin Händler Verkauf Ankauf Info@antiquegaleriede Finden
221 Antiquitäten Schmuck und Altgold Ankauf Berlin Antiquitäten
10711
Berlin
Antique Galerie: Hier können Sie Antiquitäten, Altgold, Schmuck und Diamanten in Berlin am Kurfürstendamm verkaufen. Der Schmuckankauf...
antiquegalerie.de/standorte/antiquitaeten-berlin Z Y
222 Pia Gabel Beratung Unternehmensberatung
14974
Ludwigsfelde (Berlin)
Generalist unter den Beratern: Strategie, Organisation und Marketing. Beratungsthemen richten sich auf Wachstum, Innovation und Unternehmensgründung, Corporate...
piagabel.com Strategie Marketing Kundenfokussierte News Beratung Innovation Gabel Angebotsanfrage
223 Naturheilpraxis Anke Bentler Heilpraktikerin
10555
Berlin
Schöne Naturheilpraxis im Westphälischen Viertel von Moabit, in der Nähe vom Hansaplatz. Seit 2010 biete ich Akupunktur...
ahk-berlin.de Bentler Anke Naturheilpraxis Berlin Kynotherapie Homopathie Akupunktur Homöopathie
224 Vergleichs-Berichte Versicherung
13086
Berlin
Wir stellen auf dieser Seite unterschiedliche Vergleichs-Berichte und Tests von Versicherungen und Policen vor. Alle Tests können...
vergleichs-berichte.de/ Berichte Rente Vergleichs Gewerbe Riester Baufinanzierung Berufshaftpflicht Versicherungsvergleich
225 Augencremes-Testsieger Beauty
13086
Berlin
Wir stellen unterschiedliche Cremes von Hersteller für die Region der Augen vor. Erkennen Sie, welche Leistungsvariationen bestehen....
augencremes-testsieger.de/ Augencreme Anti Cream Augen Platz Augenpflege Falten Eye
226 Heiko Nusche Bauausführung GmbH Baugewerbe
12557
Berlin
Meisterbetrieb für Betonbau-, Maurer-, und Fliesenlegerarbeiten im Südosten der Hauptstadt Berlin. Ob Neubau, Umbau, Instandsetzung oder Modernisierung...
bauausfuehrung-berlin.de Berlin Bauausführungen Betonbauarbeiten Maurerarbeiten Bauausführung Fliesenlegerarbeiten Maurer Maurermeister
227 Container online sicher und günstig bestellen Containerservice
10315
Berlin
Containerdienst.de ist Ihr zuverlässiger Containerdienst und Containerservice zum Container mieten und Container bestellen bundesweit. Hier finden Sie...
containerdienst.de Container Entsorgen Holz Bauschutt Erdaushub Entsorgung Dachpappe Verpackungen
228 ml seodesign - mobile seo website Webdesign Mobile
13469
Berlin
Prof. Webdesign, Mobile SEO Website in Responsive Design, Google PageSpeed Test auf Mobile SEO-Optimierung für Mobilgeräte, Website Relaunch -...
mobile-seo.website/ Mobileseo Website Webdesign Oben Optimierung Seo Responsive Design
229 Saubere Tankreinigung und Demontage von Heizöltanks Tankschutz
13509
Berlin
Tankreinigung und Demontagen zum Festpreis. Sauber, Schnell und Zuverlässig durch den Familienbetrieb aus Berlin. Mit Modernsten Maschinen...
oeltank-service.eu Preise Leistung Tankdemontage Ablauf öltankreinigung Tankreinigung Demontage Tobias
230 der weg zur wunschyacht Beratung
88662
überlingen
Mit der richtigen Anwendung der Kybernetik finden sie ihren persönlichen weg zur passenden Yacht auch ohne Vorkenntnisse....
segelyacht-auswahl-berater.de Weg Yacht Code Wunschyacht Navigation Personal Rom Ermittelt
231 Sightseeing Point GmbH Stadtführungen
10117
Berlin
Es werden über 60 Stadtführungen zu Fuß, per Bus, Rad und Schiff in Berlin und Potsdam angeboten....
sightseeing-point-berlin.de
232 Fach- und Rechtsanwältin Gabriele Brandenburg Fach- und Rechtsanwältin Gabriele Brandenburg Rechtsanwalt
12161
Berlin
Anwaltskanzlei für Arbeitsrecht, Sozialversicherungsrecht, Steuerrecht und Gesellschaftsrecht in Berlin Friedenau-Steglitz direkt am U-Bahnhof Walther Schreiber-Platz. Rechtsanwältin Gabriele...
rabrandenburg.de Arbeitsrecht Sozialrecht Gesellschaftsrecht Steuerrecht Rechtsgebiete Unfallrecht Rechtsanwalt Brandenburg
233 Vollnarkose Zahnbehandlung Zahnklinik Zahnarzt
10117
Berlin
BERLIN-KLINIK ist ein staatlich zugelassenes Berliner Krankenhaus für die Fachbereiche MKG Mund- Kiefer- Gesichtschirurgie und Plastische Operationen....
berlin-klinik.de Berlin Klinik Master Implantologie Zahnarzt Gesellschaft Spezialist Klinik®
234 Eventschiff für Feier Party Incentive Tagung Schiffahrt
12161
Berlin
Berlin : Sightseeing | Feiern | Party | Tagung auf dem Wasser ! Herzlich willkommen an Bord zu...
eventschiff.eu Berlin Potsdam Bord Ahoi Boot Yachting Wasser Feier
235 argo.berlin Werbeagentur
10439
Berlin
Wir entwickeln mit Ihnen gemeinsam günstige Werbung für Ihr Unternehmen, die wirklich funktioniert. Facebookwerbung ...
werbung.argo.berlin/werbeagentur
236 Diamanten Ankauf Haeger Berlin Lichterfelde Juwelier
12207
Berlin
diamanten-haeger.de/diamantenankauf-berlin-lichterfelde Diamanten Ankauf Haeger Ertes Formular Leben Wie Schönen
237 Diamanten Ankauf Haeger Berlin Kurfürstendamm Juwelier
10711
Berlin
diamanten-haeger.de/diamantenankauf-berlin-kurfuerstendamm Diamanten Ankauf Haeger Edelmetalle Familie Diamantengroßhandel Wie Generationen
238 Versicherung 24 7 Finance
12045
Berlin
KFZ-Versicherung-Vergleich: Alle Angebote auf einen Blick Ihre jetzige Versicherung kostet Ihnen zuviel und bietet Ihnen nicht die Versicherungs-Leistungen...
versicherung-online-vergleich.net/ Versicherungen Garantieversicherung Grundsicherung Rente Versicherung Neuwagen Kfz Beiträge
239 Physiotherapie Myoreflextherapie Lymphdrainage Rückenschule Schwindeltherapie Atlastherapie Physiotherapie Krankengymnastik
12309
Berlin
Ich habe mich als Physiotherapeut selbstständig gemacht um mir Zeit für Sie zu nehmen. Mit einem individuell...
praxis-minarski.de Inhalte Seiten Gesundheit Daten Johannes Minarski Betreiber Behandlung
240 Fahrrad Flöckner am Alex - Cube Fahrradhandel
10178
Berlin
fahrrad-flöckner.de
241 Haeger GmbH Goldankauf Berlin Lichterfelde Goldankauf
12207
Berlin
Die beiden Filialen von Goldankauf Haeger in der Hauptstadt stehen Ihnen jederzeit offen, wenn Sie Barren aus...
goldankauf-haeger.de/berlin Z Y
242 Franziska Oehler - DirektSEO Online Marketing
10119
Berlin
Bei DirektSEO in Berlin berate ich Sie individuell zu den Themen Suchmaschinenoptimierung (SEO), Suchmaschinenmarketing (SEM), zur Gestaltung...
direktseo.de/ Suchmaschinenoptimierung Marketing Social Media Suchmaschinenwerbung Analyse Beratung Webseite
243 Franziska Oehler - DirektSEO Online Marketing
10119
Berlin-Mitte
Bei DirektSEO in Berlin berate ich Sie individuell zu den Themen Suchmaschinenoptimierung (SEO), Suchmaschinenmarketing (SEM), zur Gestaltung...
direktseo.de/ Suchmaschinenoptimierung Marketing Media Social Suchmaschinenwerbung Beratung Analyse Design
244 MANZEL Unternehmensentwicklung GmbH Unternehmensberatung
10629
Berlin
Die MANZEL Unternehmensentwicklung GmbH berät, begleitet und unterstützt aktiv mittelständische Unternehmen bei Gründung, bei Wachstum, strategischer Neuausrichtung...
manzel.de/ Berlin Unternehmensentwicklung Seminare Unternehmen Manzel Personalentwicklung Trainings Unternehmensberatung
245 F + S Software GmbH Software
10707
Berlin
Die F + S Software GmbH gilt als Spezialist für die Softwareentwicklung im Bereich Werkzeugverwaltung, Werkzeugmanagement und...
f-s.de/ Software Werkzeugverwaltung Lagerverwaltung Mobile Lösungen Werkzeugmanagement Logistik Management
246 Detektei
13509
Berlin
Detektei für den Raum Berlin....
detektei-aplus.de/dependancen/detektei-berlin.htm Berlin Detektei Plus Detektiv Detektive Ermittlungen Wirtschaftsdetektei Einsatzort
247 Messi Wohnung entrümpeln Entrümpelungen
10117
Berlin
Messi Wohnung entrümpeln lassen in Berlin Messie Haushaltsauflösungen sofort Räumungen Entrümpelungen....
whgreumung.de/ Berlin Wohnung Entrümpelung Messi Möbel Sperrmüll Preis Entrümpeln
248 Produktfotografie Berlin Fotografie
13187
Berlin
Photos4shops ist eine Full Service Foto Agentur in Berlin. Hier erhalten Unternehmen für Ihre Onlinepräsentation und für...
photos4shops.com Produktfotografie Glasware Chromware Lesen Packshot Legeware Berlin Agentur
249 Zauberkünstler Berlin Zauberer
12247
Berlin
Zauberei für Groß und Klein bietet der Zauberkünstler Fabian Schneekind aus Berlin. Der Zauberkünstler kann für folgendes gebucht...
fabianschneekind.de Google Website Berlin Analytics Erfassung Ip Daten Zauberer
250 DYWAG Projekt- u. Wohnungsbauverwaltungsgesellschaft mbH & DYWAG Projekt- u. Wohnungsbauverwaltungsgesellschaft mbH & Bauunternehmen
10117
Berlin
Wir bieten Ihnen einen zuverlässigen Baupartner Service im Neubau, in der Sanierung, im Bestand und in der...
dywag.de Bauunternehmen Wohnungsbau
251 beleuchtungdirekt.de Leuchtmittel Onlinehandel
10969
Berlin
Wenn man hochwertige und energiesparende LED Leuchtmittel benötigt, sollte man zuerst im Onlineshop von beleuchtungdirekt.de nachsehen. Wir...
beleuchtungdirekt.de/ Lampen Philips Leuchtstofflampen Lieferung Osram Email Energiesparlampen Led
252 Produktfotografie Berlin Fotografie
13187
Berlin
Photos4shops Berlin bietet deutschlandweit professionelle Produktfotografie für diverse Unternehmen im Bereich E-Commerce. Hier erhalten Sie qualitativ hochwertige...
photos4shops.com Packshot Glasware Berlin Hollow Agentur Produktfotografie Kleider Legeware
253 George & Partner mbB Rechtsanwälte Gesellschaftsrecht Rechtsanwalt
10623
Berlin
Die Kanzlei George&Partner ist Ihr Partner für Gesellschaftsrecht. Wir stehen Ihnen mit Rat und Tat zur Seite...
georgepartner.de/ Kanzlei George Gesellschaftsrecht = Fachanwalt Klienten Berlin Niels
254 Auto Ankauf und Export Berlin Auto Ankauf und Export Berlin Auto
12045
Berlin
Autoexport Berlin und Bundesweit Bei uns sind Sie auf der richtigen und sicheren Seite! Sie wollen Ihr...
ps-autoexport.de Auto Verkaufen Autoexport Ankauf Fahrzeuge Berlin Anbieten Probiere
255 Landsiedel NLP Training Berlin Bildung
10405
Berlin
NLP Ausbildung in Berlin, Weiterbildung, Erwachsenenbildung, Seminare zum Thema Persönlichkeitsentwicklung und Kommunikation mit NLP...
landsiedel-seminare.de/nlp/nlp-in-berlin.html Nlp Coach Tage Berlin Ausbildung Coaching Trainer Master
256 Hochzeitsfotograf in Berlin - Fotos eurer Hochzeitsfotograf in Berlin - Fotos eurer Hochzeitsfotograf
12101
Berlin
Hochzeitsfotograf in Berlin – Fotos Eurer Hochzeit Fotos Eurer Hochzeit – Der Hochzeitsfotograf in Berlin für gefühlvolle Hochzeitsfotos...
fotos-eurer-hochzeit.de Berlin Hochzeitsfotograf Hochzeit Galerie Preise Leistungen Hochzeitsblog Fotos
257 Pilch Dachbau GmbH Dachdeckerei
13435
Berlin
PILCH DACHBAU Ihr Dachdecker-Meisterbetrieb aus Berlin Wir lieben Dächer, wir lieben unsere Arbeit. Und so machen wir sie auch....
pilch-dachbau.de Berlin Einblasdämmung Pilch Dachdecker Dachbau Dachdeckerei Flachdachabdichtung Dachbegrünung
258 Heiraten in Dänemark — leicht und Hochzeitsplannung
10965
Berlin
Agentur Konstannta begleitet Kunden auf dem Weg zur schönen Heirat in Dänemark. Wir bieten schnelle Termine und...
konstannta.de/ Dänemark Heiraten Schnell Leicht Anerkennung Standesamt Legalisierung Deutschland
259 ATI Umzüge Umzugsunternehmen Berlin Umzugsfirma Berlin
13357
Berlin
ATI Umzüge Umzugsunternehmen aus Berlin. Wir führen kostengünstige Umzüge europaweit durch. Unsere Umzugsfirma bietet Ihnen faire Festpreisangebote...
ati-umzuege.de Berlin Info@ati Umzuegede Umzugsmaterial Halteverbot Zahlung Bestellen Entsorgung
260 Umzugshelfer Berlin | Das Original Umzug
10715
Berlin
Die Umzugshelfer Berlin sind Ihre familiengeführte und zuverlässige Umzugsfirma aus Berlin-Charlottenburg. Wir führen private und gewerbliche Umzüge...
umzugshelfer-berlin.de/ Berlin Umzugshelfer Umzugshilfe Seit ✔ ♥ Professionelles Rufen
261 Kristall Umzüge Berlin - Umzugsfirma Berlin Umzug
13409
Berlin
Sie benötigen ein professionelles Umzugsunternehmen in Berlin, welches sich rund um den Umzug, Lagerung und Entrümpelung in...
kristall-umzuege.de Berlin Umzug Umzüge Umzugsmaterial Wohnungsauflösung Umzugshelfer % Umzugsunternehmen
262 Ipilum Websolutions E- Commerce
10247
Berlin
Unser Kerngeschäftsfeld ist seit über 14 Jahren die Entwicklung unseres modularen Ipilum Shop Systems anhand der Bedürfnisse...
ipilum.com Commerce Shopsystem Ipilum Webdesign Hosting Re Solutions Folgen
263 Sperrmüllabholung Entrümpelungen Haushaltsauflösungen
10117
Berlin
Sperrmüllabholungen Recycling Dienst Lemt sofort Entsorgunsdienst Eilservice Müll Entrümpelungen Haushaltsauflösungen....
lemt.de/ Recycling Entrümpelung Lemt Berlin Müll Eilservice Sperrmüllabholung Keller
264 BellaVital Kosmetikstudio Berlin Kosmetikstudio
10707
Berlin
Kosmetikstudio Berlin: Unweit vom Kurfürstendamm werden Sie von Kopf bis Fuß verwöhnt. Bei BellaVital, dem Kosmetikstudio in...
bellavital.de Laser Kosmetikstudio Berlin Wellness Kosmetik Bellavital Kudamm Termin
265 Anwalt Familienrecht Berlin - Schulz & Anwalt Familienrecht
10247
Berlin
Anwalt Familienrecht Berlin - Schulz & Deutschmann: Rechtsberatung bei Scheidung, Sorgerecht und Unterhaltszahlungen! Sie haben einen Notfall...
anwalt-scheidung-familienrecht.de Familienrecht Anwalt Berlin Scheidung Sozialrecht Sorgerecht Kostenlose Scheidung Rechtsgebietefamilienrecht
266 EMS-Training in der fitbox Weissensee Personal Training
13088
Berlin
Die fitbox Weissensee ist der Partner den du gesucht hast. Direkt an der Tram Haltestelle Albertinenstraße. kannst...
fitbox.de Training Ems Artikel Personal Vorverkauf Trainer Fragen Trainingsablauf
267 Flink Umzüge und Lagerung Umzugsunternehen
10827
Berlin
Flink Umzüge aus Berlin ist für Sie zur Stelle, ob beim Umzug oder Transport von und nach...
flink-umzuege.de/ Umzüge Umzug Umzugsunternehmen Umzugshelfer Entrümpelung Umzugsmaterial Einlagerung Entsorgung
268 Heilpraktiker Marzahn-Hellersdorf Heilpraktiker
12619
Berlin
Die Heilpraktikerin Sabrina Pfützner sogrt wieder für Wohlbefinden durch alternative Behandlungsmöglichkeiten: Autoimmunerkrankungen, Burn-Out Symptomatiken, rheumatische Erkrankungen, Magen-Darm-Erkrankungen und...
gesundes-menschenleben.de Behandlung Naturheilpraxis Ernährung Homöopathie Sabrina Nns Pfützner Miasmatik
269 Steuerkanzlei Merla Steuerberater
10789
Berlin
Ihr Steuerberater in Berlin Charlottenburg-Wilmdersdorf - Steuerliche Beratung von Unternehmen - Steuerliche Beratung von Privatpersonen - Internationales Steuerrecht - Existenzgründerberatung...
steuerkanzlei-merla.de Berlin Steuerberater Merla Steuerkanzlei Charlottenburg Kanzlei Wilmersdorf Wilmdersdorf
270 Schachshop in Berlin Schach und
12101
Berlin
Seit 1980 von Heide Ketterling geführtes Spezialgeschäft für Schachbedarf, Schachfiguren, Schachbretter, Schachbücher, Schachcomputer, Schachprogramme, Schachsoftware...
elektroschach.de Elektroschach Schachuhren Eröffnung Mittelspiel Endspiel Schachcomputer Alte Neuheiten
271 Schachshop in Berlin Schach und
12101
Berlin
Seit 1980 von Heide Ketterling geführtes Spezialgeschäft für Schachbedarf, Schachfiguren, Schachbretter, Schachbücher, Schachcomputer, Schachprogramme, Schachsoftware...
elektroschach.de Elektroschach Endspiel Schachuhren Mittelspiel Eröffnung Pokale Literatur Pc
272 BW Bestwert Immobilien GmbH Immobilienmakler
10719
Berlin
Die BW Bestwert Immobilien GmbH ist Ihr kompetenter Partner in Sachen Denkmalimmobilien. Wir bieten Ihnen das volle...
bestwert.de Vertriebspartner Bestwertde Kapitalanlage Denkmalimmobilien Uns Lukrativen Bestwert Objekte
273 Steuerkanzlei Merla Steuerberater
10789
Berlin
Ihr Steuerberater in Berlin Charlottenburg Sie suchen einen Steuerberater in Berlin zur Unterstützung bei Ihrer Buchhaltung, Ihrer Steuererklärung...
steuerkanzlei-merla.de Berlin Steuerberater Merla Steuerkanzlei Kanzlei Charlottenburg Steuerberatung Erstgespräch
274 Zäune aus Polen Garten

Berlin
Die Firma Ampanel gehört zu den erfahrensten polnischen Herstellern von hochwertigen Zäunen jeder Art. Seit mehreren Jahren...
ampanel.de Panel Zaun Moderne Zaunsysteme Zaunfelder Zäune Preisen Schreiben
275 Goldankauf Berlin Goldankauf Haeger GmbH Goldankauf
10711
Berlin
Der Goldankauf in Berlin: In vielen Haushalten schlummern Werte, die ihren Besitzern gar nicht bekannt sind. Möglich...
goldankauf-haeger.de/berlin Berlin Ankauf Goldmünzen Goldankauf Kaufen Verkaufen Anfahrt Goldbarren
276 Haushaltsauflösung und Entrümpelung Berlin Haushaltsauflösung
12619
Berlin
Entsorgungen und Wohnungsauflösungen mit der Haushaltsauflösung und Entrümpelung Berlin. Faire Preise und eine hohe Kompetenz zeichnet das...
haushaltsaufloesung-entruempelung-berlin.de Berlin Haushaltsauflösung Entrümpelung Zeit Entsorgung Denn Berlin * Berg
277 Jakob Bauer Infomarketing GbR DROHNE ZERFETZT
10785
Berlin
Jetzt Drohnen Versicherung abschliessen ➜ 100% Versicherungs-Schutz nach dt. Luftfahrt Gesetzgebung. JETZT Drohne oder Quadrocopter versichern....
versicherungdrohne.de/ Drohne Drohnen Versicherung Versichertedrohnede Haftpflichtversicherung Kaufen Nutzung Schaden
278 MOBIX mobile Diskothek Diskjockey
12279
Berlin
Mobix mobile Diskothek ist die mobile Disco mit professionellem DJ für jeden Anlass in Berlin und Brandenburg....
mobix-diskothek.de Berlin Dj Mobile Hochzeit Disco Diskothek Party Hochzeits
279 Dudelsack Unterricht in Berlin Musikunterricht
10247
Berlin
Dudelsack Unterricht für Totalanfänger bis Fortgeschrittene, für Kinder (ab 10 Jahre), Jugendliche und Erwachsene in Berlin Friedrichshain -...
facebook.com/dudelsackunterricht.berlin Erstellen Karriere Seiten Uns Registrieren Werbeanzeige Orte Lite
280 Mit Videocoaching IHK Wirtschaftsfachwirt werden Wirtschaftsfachwirt
10245
Berlin
Willkommen bei den Onlinelehrvideos von Dr. Marius Ebert - Mit effektiven Schnell-Lern-Systeme Prüfungen besser bestehen. Wir bieten...
wirtschaftsfachwirt-in-ihk.de Wirtschaftsfachwirt Lehrgang Wirtschaftsfachwirtin Geprüfter Videos Staatlich Ihk Prfung
281 KOSMETIK STUDIO CARISMA Kosmetik
10717
Berlin
Kosmetik Behandlungen mit wertvollen Wirkstoffen zur Hautbildverbesserung für Damen & Herren abgestimmt auf Ihre hautspezifischen Bedürfnisse....
kosmetik-institut-berlin.com Kosmetik Carisma Preise Maniküre Kosmetikbehandlungen Salon Fußpflege Kosmetikprodukte
282 Travestie Show Berlin Alleinunterhalter Partyservice

Berlin
Sie möchten Ihre Gäste gekonnt unterhalten? Sie suchen das Besondere? Damit Ihre Veranstaltung ein voller Erfolg wird...
travestie-berlin.com/ Travestiekünstler Veranstaltung Moderation Izora Montaniere Live De Travestie
283 Velonest c o TenMedia UG (haftungsbeschränkt) Fahrrad
25
Berlin
Velonest bietet einen Marktplatz für Fahrradfreunde. Auf dem Portal können Händler und Privatpersonen ihre Fahrräder kostenfrei inserieren....
velonest.com Fahrrad Fahrräder Gebrauchte Forum Gebraucht Markt Kaufen Hilfe
284 iPhone Handy Reparatur Berlin IPhone Handy
13089
Berlin
Möchten Sie Ihr iPhone reparieren lassen? Wir bieten Ihnen eine schnelle und zuverlässige Handy Reparatur. Günstig reparieren...
handy-reparatur-berlin.com Apple Iphone Samsung Galaxy Ipad Reparatur Sony Xperia
285 Autoreinigung Noack Autoreinigung
13089
Berlin
Möchten Sie Ihren PKW reinigen oder pflegen lassen? Wir bieten Ihnen die günstige Autoreinigung in Berlin. Unser...
autoreinigung-noack.de Berlin Nanoversiegelung Autopflege Fahrzeugaufbereitung Autoreinigung Noack Scheibenversiegelung Innenreinigung
286 Ausbildung Berlin Ausbildung Weiterbildung
10365
Berlin
Berufliche Veränderung gefällig? Wir bieten Ihnen Ausbildung, Weiterbildung und Umschulung, die unter anderem auch gefördert werden kann. In...
dub-berlin.de Berlin Ausbildung Bildung Umschulung Sozialassistent Uhr Frau Einzelhandel
287 Sperrmüll Berlin Entrümpelung
13409
Berlin
Benötigen Sie eine Entrümpelung und Entsorgung von Sperrmüll? Wir übernehmen die Entrümpelung aus Büro, Keller, Wohnungen und...
sperrmuell-entsorgung-entruempelung.de Berlin Sperrmüll Entrümpelung Entsorgung Messi Möbeltaxi Keller Firma
288 Sperrmüll Berlin Entrümpelung
13409
Berlin
Preiswert Sperrmüll in Berlin. Benötigen Sie eine Entrümpelung und Entsorgung von Sperrmüll? Wir übernehmen die Entrümpelung aus...
preiswert-sperrmuell-berlin.de Berlin Sperrmüll Entrümpelung Entsorgung Sperrmüllentsorgung Firma Kellerauflösung Sperrmüllabholung
289 Möbeltaxi Berlin Möbeltaxi
13409
Berlin
Ihr Möbeltaxi in Berlin für Möbeltransporte jeder Art. Die Firma Flitzer-Möbeltaxi steht Ihnen für Kleintransporte, Möbeltransporte, Miniumzüge...
moebeltaxi-moebeltransport-berlin.com Berlin Möbeltaxi Flitzer Möbeltransport Entrümpelung Entsorgung Möbeltransporte Kleintransporte
290 Möbeltaxi Berlin Möbeltaxi
10719
Berlin
Ihr Möbeltaxi in Berlin für Möbeltransporte jeder Art. Die Firma Flitzer-Möbeltaxi steht Ihnen für Kleintransporte, Möbeltransporte, Miniumzüge...
moebeltaxi-moebeltransport-berlin.com Berlin Möbeltaxi Flitzer Entrümpelung Möbeltransport Entsorgung Transport Kleintransporte
291 Kinderarzt Berlin Gesundheit
10719
Berlin
Der Kinderarzt Dr.Zia steht unseren jungen Patienten mit Kompetenz und Erfahrung zur Seite. Impfungen, Grippe, Vorsorge. Der...
kinderarzt-berlin-zia.de Berlin Kinderarztpraxis Kinderarzt Charlottenburg Jahre Monate Wilmersdorf Impfung
292 Kinderarzt Berlin Gesundheit
10719
Berlin
Der Kinderarzt Dr.Zia steht unseren jungen Patienten mit Kompetenz und Erfahrung zur Seite. Impfungen, Grippe, Vorsorge. Der...
kinderarzt-berlin-zia.de Berlin Kinderarztpraxis Kinderarzt Charlottenburg Jahre Monate Navigation Impfung
293 X Parking Flugreisen
13405
Berlin
Wer eine Flugreise von Berlin Tegel aus plant und einen Parkplatz benötigt, ist bei der Firma X...
flughafen-berlin-parkplatz.de Tegel Flughafen Parkplatz Berlin Parken Airport Reservierung Preise
294 United Leonidas Objektschutz &
13347
Berlin
Das Sicherheitsunternehmen aus Berlin, steht Ihnen für Ihren Objektschutz gerne zu Ihrer Verfügung. Ob Hotel, Gebäude, Ladenflächen...
security-objektschutz.com Objektschutz Berlin Sicherheitsunternehmen Brandschutz Erfüllt Objektschutzaufgaben Stunden Professionell
295 AGAS Hotel Berlin Hotel Berlin
12681
Berlin
Das Agashotel in Berlin, hat seinen Sitz in Berlin - Lichtenberg. Das Hotel verfügt über komfortable Hotelzimmer...
agashotel.de Berlin Hotel Agas Hauptstadt Buchen Urlaub Lichtenberg Aufenthalt
296 Steuerberater Berlin Steuerberater
10179
Berlin
Der Steuerberater in Berlin Lars Franke, ist ein zuverlässiger Steuerberater für Ihr Unternehmen. Ob Existenzgründer, Einzelunternehmen oder...
stb-franke.de Steuerberater Berlin Steuerbüro Steuerberatung Buchführung Steuerrecht Veranstaltungen Charlottenburg
297 Tempo Umzüge Berlin Umzugsfirma
13587
Berlin
Das Umzugsunternehmen Tempo Umzüge aus Berlin, ist ein kleines, noch junges, dennoch professionelles Umzugsunternehmen für Umzüge und...
tempo-umzuege.de Umzug Umzüge Berlin Deutschland Möbeltransporte Umzugsunternehmen Kleintransporte Büroumzug
298 Umzugsfirma Berlin Stark Umzüge
12059
Berlin
Stark Umzüge Berlin. Wer einen Umzug plant, oder durchführen lassen möchte, kann sich auf Stark Umzüge Berlin...
umzugsfirma-stark.de Umzug Berlin Uns Umzugsunternehmen Selbstverständlich Dass Blog Umzugsdecken
299 Lotjonn Transporte Düsseldorf Umzug &
40239
Berlin
Lotjonn Transporte in Düsseldorf, ist Ihr zuverlässiges Umzugsunternehmen, wenn Sie einen Umzug nach Düsseldorf, aus Düsseldorf nach...
lotjonn-transporte.de Umzug Unternehmensauflösungen Direkt Antiquitätentransporte Ihr Firmenumzug Gartenentsorgungen Wohnungsauflösungen
300 Igel Umzüge Berlin Umzugsfirma
13409
Berlin
Igel Umzüge Berlin. Die Umzugsfirma aus Berlin, verfügt über einen professionellen Umzugsservice. Für Umzüge jeder Art, ist...
igel-umzuege.de Umzüge Berlin Umzug Uns Besuchen Umzugsunternehmen Entsorgung Info@igel

Kleinanzeigen, Kommentare und Mitfahrgelegenheit Berlin

+ Kommentar oder Kleinanzeige für Berlin eintragen!

301 Home Augenarztpraxis im
10783
Berlin
Augenarztpraxis im Ärzte Centrum Bülowstraße
aerzte-buelowstrasse.de
302 Albers DAS SPORTRESTAURANT Albers Wettboerse GmbH Albers
10783
Berlin
Großzügig konzipiert ist das Albers Sportrestaurant der Treffpunkt aller Besucher des Pferdesportparks BerlinKarlshorst. Der aufmerksame
albers-restaurant.de Albers Berlin Restaurant
303 Home
10783
Berlin
Kultur FREIES MUSEUM BERLIN
artfactory-berlin.de
304 Weihnachtsmarkt auf dem Winterfeldtplatz Berlin
10783
Berlin
Der traditionelle Weihnachtsmarkt auf dem Winterfeldtplatz ist einzigartig und an den Adventssonntagen geöffnet.
weihnachtsmarkt-winterfeldtplatz.de Berlin Weihnachtsmarkt Winterfeldtplatz
305 Formular.de Tipps Formular.de ist ein Angebot der Formblitz AG
10783
Berlin
Auf Formular.de finden Sie umfangreiche Informationen zu juristischen Themen wie Mietvertrag Arbeitsvertrag Patientenverfügung
formular.de
306 Cafe Peri Start
10783
Berlin
Homepage of Cafe Peri
cafe-peri.de
307 Czollek consult Willkommen! Leah
10783
Berlin
Diversity Dialoge Mediatorin Trainerin Dozentin Konflikte produktiv und zufriedenstellend lösen Kommunikation Dialog Unternehmen Kommunikationskultur
czollek-consult.de Leah Carola Czollek
308 PROFORMA Corporate Design Gesellschaft für Unternehmenskommunikation mbH & Co. KG Design
10783
Berlin
Corporate Design Agentur Berlin Agentur für Unternehmenskommunikation WebEntwicklungen und Beratung. Für Unternehmen
proforma.de Design Gestaltung Corporate
309 Business Development Germany German
10783
Berlin
We bring your business on the German market ? contact us today!
businessdevelopmentgermany.de German Companies German Marketing
310 DJ Frank DJService DJ
10783
Berlin
Dj Frank Berlin DJService für Partys Feste Hochzeiten ...
dj-frank-berlin-brandenburg.de DJ Berlin Brandenburg Party Hochzeit
311 Berlin Taekwondo Willkommen Berlinsan Taekwondo Sportverein e.V. Adnan
10783
Berlin
Olympic Sports Center Berlinsan Taekwondo e.V. Adnan Karabulut
berlintaekwondo.de Adnan Karabulut Taekwondo Berlin
312 Wohnungsauflösung Berlin 030 wohnungsauflösung
10783
Berlin
Wohnungsauflösung Berlin günstig und schnell von Complett Räumung 030 261 01 714
berlin-wohnungsaufloesung.de Wohnungsauflösung Berlin Wohnungsauflösungen Entrümpelung Entrümpelungen
313 RAe Böhm MeyerDulheuer §§
10783
Berlin
Rechtsanwälte Rechtsanwalt Matthias Böhm Notar Helmuth MeyerDulheuer RA RAe §
boehmmeyerdulheuer.de §§ § Rechtsanwälte
314 Astrid Elisabeth Stebich
10783
Berlin
Astrid Elisabeth Stebich Make up Artist Friseurmeisterin aus Berlin. Make up Haare
elice-beth.de
315 Home www.berlinevangelisch.de Gesellschaft für Unternehmenskommunikation mbH & Co. KG Abgeltungssteuer
10783
Berlin
www.berlinevangelisch.de ? Das ServicePortal der Evangelischen Kirche in Berlin.
berlin-evangelisch.de Abgeltungssteuer Advent Austritt Bach Berlin
316 Berlin Apartments Potsdamer Str Berlin
10783
Berlin
Apartments in Berlin nähe Potsdamer Platz für Gruppenreisen Gruppenunterkunft
berlin-aparts.de Berlin Apartments Berlin Gruppenreise
317 Bar Voyage barvoyages bar
10783
Berlin
Bar Café Kleinkunstbühne
barvoyage.de Bar Berlin Kleinkunst Berlin
318 Home ? Kunstsaele Berlin Kunstsaele
10783
Berlin
Die Kunstsaele Berlin verbinden Galerie Sammlung und Kulturprojekte an einem Ort. Neben den wechselnden
kunstsaele.de Kunstsaele Oehmen Bergmeier
319 WerbeartikelAgentur für Fahrradsattelbezüge
10783
Berlin
Kultkeks ist Ihr Partner für individuelle Werbemittel und Werbegeschenke. Unser Sortiment reicht von der Handysocke
kultkeks.de
320 TRIO PALMERA Salsa
10783
Berlin
Seit nunmehr 26 Jahren ist das TRIO PALMERA unterwegs um landesweit und über die Landesgrenzen
josefinol.de Salsa Cumbia Merengue
321 Home Labbow Personalleasing e.K.
10783
Berlin
Personalberatung und dienstleistungen
labbow-personalleasing.de
322 Marian Kiss Marian
10783
Berlin
Marian Kiss Film Berlin Filmemacherin Filmmaker Regiesseurin Director
mariankiss.de Marian Kiss Film
323 Marianne Rosenberg | RoseWeb Public Image GmbH Marianne
10783
Berlin
Die offizielle Website von Marianne Rosenberg mit aktuellen Infos SongDownloads Biografie Diskografie
rosenberg.de Marianne Rosenberg Pop
324 MännerMinne e.V. Erster schwuler choir
10783
Berlin
MännerMinne e.V. Erster schwuler Männerchor Berlin gegründet 1987 Mitglied im Berliner Sängerbund.
maennerminne.de Choir Chorus Gay
325 | MARTINA DOEHRING | c/o Formblitz AG Martina
10783
Berlin
Dies ist die offizielle Website der Sopranistin Martina Doehring
martinadoehring.de Martina Doehring Sängerin
326 EVA GmbH EVA GmbH
10783
Berlin
KFZ Reparatur oder Ausfuhrversicherung:sofort in unserem OnlineShop. Auch Gebrauchtwagengarantie und Finanzierung für Privatpersonen und Händler
eva-evb.de
327 Diversitygendertraining.de joomla
10783
Berlin
Joomla! dynamische PortalEngine und ContentManagementSystem
energydeal.de Joomla Joomla
328 :: Keding / ESS Keding / ESS Elektronische Sicherheitssysteme GmbH / Keding GmbH & Co. KG sicherheitssystem
10783
Berlin
ESS GMBH Planung Lieferung Montage Inbetriebnahme von elektronischen Signal und Anzeigeanlagen
ess-sicherheit.de Sicherheitssysteme Alarmanlagen Brandmeldetechnik Brandmelder Brandmeldeanl
329 Hauptstadtplan | interaktiver stadtplan Adler & Schmidt GmbH Bundeshauptstadt
10783
Berlin
Interaktiver häusergenauer Stadtplan der Berliner Innenstadt. Suchmöglichkeit nach den Kategorien Sehenswürdigkeiten Kultur Regierungsbauten
hauptstadtplan.de Bundeshauptstadt Berlin Hauptstadt Bundesregierung Reichstag
330 Home GmbH & Co. KG ML4
10783
Berlin
Personalleasing ML4 Personalmanagement GmbH Co.
ml4-dienstleistungen.de ML4 ML4Personalmanagement ML4
331 Keding GmbH Co.KG Integral
10783
Berlin
IntegralSecurity Integralsecurity Integral Security Integral Security Antennentechnik und Sicherheitstechnik Alarmanlagen Brandmeldeanlagen Einbruchmeldeanlagen Videoüberwachung und mehr)
keding.de Integral Security IntegralSecurity Integralsecutity Integral
332 Start Kauffeld und
10783
Berlin
Kauffeld und Jahn
kauffeldundjahn.de
333 Willkommen bei Pascha Grill joomla
10783
Berlin
Joomla! dynamische PortalEngine und ContentManagementSystem
pascha-grill.de Joomla Joomla
334 PartytechnikBerlin Verleih von Berlin
10783
Berlin
Partytechnik Berlin verleiht Lichttechnik und Tontechnik für Eure Party/Veranstaltung
partytechnik-verleih-berlin.de Berlin Partytechnik Verleih Party Verleih
335 Home
10783
Berlin
Tierärzte Tierarztpraxis Marianne Gass
petstation.de
336 Willkommen bei perko profundus! Perko
10783
Berlin
perko profundus
perko-profundus.de Perko Gudrun Profundus Wissenschaftscoach Education
337 Ludger Jungnitz Men's Maenner
10783
Berlin
Ludger Jungnitz Men's Care Men's Studies
mensstudies.de Maenner Lebensqualitaet Gesundheit
338 Berlin Apartments Potsdamer Str Berlin
10783
Berlin
Apartments in Berlin nähe Potsdamer Platz für Gruppenreisen Gruppenunterkunft
cityapartsberlin.de Berlin Apartments Berlin Gruppenreise
339 HumanistischSystemische Beratung Frank systemisch
10783
Berlin
Erkennen und Auflösen von Verstrickungen Familienstellen Psychodrama Gestaltherapie Trauma
frankstamer.de Systemisch Familienstellen Aufstellung
340 Flowers of life Flowers
10783
Berlin
Flowers of life richtet sich an alle Menschen die Begleitung Gesellschaft oder eine persönliche
flowers-of-life.de Flowers Of Life Brigitte
341 INTEGRAL SECURITY Sicherheitstechnik Keding GmbH & Co. KG IntegralSecurity
10783
Berlin
Sicherheitstechnik von Integral Security dem deutschlandweiten Firmenverbund für Sicherheitstechnik (Alarmanlagen Brandmeldeanlagen Einbruchmeldeanlagen
integralsecurity.de IntegralSecurity Sicherheitstechnik Integral
342 IJam.de ? mediendesign Webdesign
10783
Berlin
10 Schritte zur eigenen Website | iJam.de Mediendesign
ijam.de Webdesign Mediendesign Homepage
343 Startseite » Gesine Palmer » Herzlich Willkommen auf Gesine
10783
Berlin
Dr. Gesine Palmer leitet das Berliner Büro für besondere Texte. Die Religionsphilosophin bietet Kommunikationsberatung und
gesine-palmer.de Gesine Palmer Redenschreiben
344 Politikmanagement mit Gitta Stieber Politikmanagement
10783
BERLIN
Gitta Stieber Berlin Politikmanagement Qualifizierung und Weiterbildung die Sie in sozialen
gittastieber.de Politikmanagement Kommunikation SoftSkills
345 Gift Music Gift Music GmbH Weltmusik
10783
Berlin
Ein kleines Weltmusiklabel aus Berlin
giftmusic.de Weltmusik Label Berlin
346 GEAG Immobilienverwaltung Berlin:Wir verwalten GEAG Immobilienverwaltungs GmbH Wirtschaft
10783
Berlin
GEAG Immobilienverwaltungs GmbH: kompetente Verwaltung und Betreuung von Immobilien in Berlin Brandenburg Sachsen
geag-berlin.de Wirtschaft Immobilien Immobilienverwaltung
347 Business Development Germany German
10783
Berlin
We bring your business on the German market ? contact us today!
business-development-germany.de German Companies German Marketing
348 Moritz Tilman Achelis | rechtsanwalt
10783
Berlin
Rechtsanwalt Arbeitsrecht Achelis Baurecht Architektenrecht Grundstücksrecht Wohnungseigentumsrecht Medizinrecht
ra-achelis.de Rechtsanwalt Arbeitsrecht Achelis
349 RDM: Startseite Landesverband Berlin und Brandenburg e.V. rdm
10783
Berlin
RDM Ring Deutscher Makler Landesverband Berlin und Brandenburg e.V.
rdm-berlin-brandenburg.de Rdm Ring Deutscher
350 Startseite Willkommen
10783
Berlin
Willkommen:  
hd-computer24.de
351 Rita Leinenweber · Astrologie Astrologie
10783
Berlin
Ich freue mich Ihnen meine Kenntnisse in Astrologie Massage energetischen Heilweisen
ritaleinenweber.de Astrologie Horoskop Geburtshoroskop
352 GEAG Immobilienverwaltung Berlin:Wir verwalten GEAG Immobilienverwaltungs GmbH Wirtschaft
10783
Berlin
GEAG Immobilienverwaltungs GmbH: kompetente Verwaltung und Betreuung von Immobilien in Berlin Brandenburg Sachsen
sabinespehr.de Wirtschaft Immobilien Immobilienverwaltung
353 Rundum Ich Ihr massage
10783
Berlin
Massage Ernährungsberatung Fitness und Personal Training Hypnosetherapie in Berlin für Privatkunden
rundum-ich.de Massage Ernährung Hypnose
354 Astrologische Gesundheits und Lebensberatung Astrologie
10783
Berlin
Astrologische Gesundheits und Lebensberatung Yvonne v. Bechtolsheim: Astrologie Reiki Ernährungsberatung und Radionik in
schwarzer-second-hand-shop.de Astrologie Reiki Ernährungsberatung
355 Roger Thilo EDV Service Roger
10783
Berlin
Wir bieten ITLösungen im Businessbereich für alle Branchen und Unternehmensgrößen. innovativ zuverlässig
rthilo.de Roger Thilo EDV Service
356 PROBase easy PROFORMA GmbH & Co. KG CMS
10783
Berlin
Mit PROBase easy erstellen wir individuell hochwertige Webauftritte Sie brauchen nur noch die Texte
pro-base-easy.de CMS ContendManagemnetSystem Contend
357 Sm hope ick Kindermode
10783
berlin
Die Teilnahme am Wettbewerb ?Meine Heimat? auf der Kreativplattform Dawanda.de war Anlass Designs zu
smhope.de Kindermode
358 LOOK22 Home LOOK22 LOOK22
10783
Berlin
LOOK22 MediaService ~ zielgruppenoptimiertes Webdesign ~ aussagekräftige Fotografie ~ perfekte Grafik ~ treffsichere Texte ~
look22.de LOOK22 MediaService Internet Fotografie Grafik
359 Raumdesignerin .Silke Smida. kunst
10783
Berlin
Art by Silke Smida composed drawings find new places!
raumdesignerin.de Kunst Design Graffiti Wandtattoos Acryl
360 BEGINE Treffpunkt und Frauen
10783
Berlin
Interkulturelles Frauenkulturzentrum Künstlerinnenförderung Konzerte Ausstellungen Potsdamer Str. 139 BerlinSchöneberg
begine.de Frauen Lesben Frauencafé
361 Complett Räumung | Wohnungsauflösung wohnungsauflösung
10783
Berlin
Wohnungsauflösung Berlin günstig und schnell von Complett Räumung 030 261 01 714
complett-berlin.de Wohnungsauflösung Berlin Wohnungsauflösungen Entrümpelung Entrümpelungen
362 Contravision breaking news contra medienwerkstatt e.v. ContraVision
10783
berlin
short film festival in berlin germany march 20th to march 28th
contravision.de ContraVision Cinema Contra
363 Doktus.de Dokumente uploaden FORMBLITZ AG doktus
10783
Berlin
Hier findet man Dokumente zu allen Themen und kann Dokumente suchen verwalten
doktus.de Doktus
364 | MARTINA DOEHRING | c/o Formblitz AG Martina
10783
Berlin
Dies ist die offizielle Website der Sopranistin Martina Doehring
martina-doehring.de Martina Doehring Sängerin
365 Wolfgang Kommerell | kommerell.de Wolfgang
10783
Berlin
Website von Wolfgang Kommerell: Segeln Fotografie.
kommerell.de Wolfgang Kommerell Fotografie
366 Marianne Rosenberg | RoseWeb Public Image GmbH Marianne
10783
Berlin
Die offizielle Website von Marianne Rosenberg mit aktuellen Infos SongDownloads Biografie Diskografie
roseclub.de Marianne Rosenberg Pop
367 Linux auf CD/DVDR linux
10783
Berlin
LinuxDistributionen auf CDR und DVDR tuxpost.de Shop
tuxpost.de Linux Iso Shop
368 Home Texts and Birgit
10783
Berlin
Dr. Birgit Hollenbach brings language and science together. Her university studies of translation and biochemistry
textsandtranslations.de Birgit Hollenbach Translation
369 .:|Stadtrundfahrten|Originelle Alternative Stadtrundfahrt|Berliner Dialekt Berlin
10783
Berlin
| BerlinerSchnauze Stadtrundfahrten | Alternative Stadtrundfahrt im Berliner Dialekt | Mundart sehr Orginelles Geschenk
berliner-schnauze.de Berlin Stadtrundfahrt Stadtrundfahrten Information Private
370 Übersetzer Deutsch Rumänisch Rumänisch
10783
Berlin
Übersetzungen Deutsch Rumänisch Dolmetscher für Rumänisch in Berlin profesionelle Übersetzung kundenorientiert
turbatu-translations.de Rumänisch Übersetzer Deutsch Rumänisch
371 Home / tausendschwarz.de Angebot
10783
Berlin
HomepageTitel Berlin
tausendschwarz.de Angebot Kompetenz Beratung
372 Subversionen.de | praeludium
10783
Berlin
??? Beuys + Agnoli
subversionen.de
373 Betreutes Wohnen in Demenz betreutes
10783
Berlin
Der FAW e.V. begleitet und verwaltet ambulant betreute Wohngemeinschaften für Menschen mit Demenz.
verein-faw.de Betreutes Wohnen Demenz Wg
374 TRIO PALMERA Salsa
10783
Berlin
Seit nunmehr 26 Jahren ist das TRIO PALMERA unterwegs um landesweit und über die Landesgrenzen
trio-palmera.de Salsa Cumbia Merengue
375 Astrologische Gesundheits und Lebensberatung Astrologie
10783
Berlin
Astrologische Gesundheits und Lebensberatung Yvonne v. Bechtolsheim: Astrologie Reiki Ernährungsberatung und Radionik in
sternen-klar.de Astrologie Reiki Ernährungsberatung
376 Italienische Weine Online Weine
10783
Berlin
Vinila Weine aus Italien. Wer via eCommerce in Deutschland die besten italienischen Weine online
vinila.de Weine Wein Aus Italien
377 NAS Planung Baumanagement Nas Planung & Baumanagement GmbH & Co. KG Berlin
10783
Berlin
NAS Planung Baumanagement GmbH Co. KG Telefon +49 (0)30. 216 95 45
xn--nas-planungsbro-cwb.de Berlin Ahmet Nas
378 AllmendeKontor Gemeinschaftsgarten Allmende-Kontor e.V.
10783
Berlin
Allmende = Gemeingut = Commons: Berliner AllmendeKontor Gemeinschaftsgarten und eine der größten Hochbeetanlagen der
allmende-kontor.de
379 Beste Hunde: OnlineMagazin für
10783
Berlin
Das Online Hundemagazin mit aktuellen Artikeln zu Gesundheit Ernährung Erziehung und Verhalten
bestehunde.de
380 Berliner Schlagerfest 2012 berliner
10783
Berlin
Das Berliner Schlagerfest geht in die 2. Runde.
berliner-schlagerfest.de Berliner Schlagerfest 2012 Schlagerfest Berlinmitte
381 Birgit Schlieps Birgit
10783
Berlin
Urban Sculpture. Die Künstlerin Birgit Schlieps arbeitet mit dem urbanen Raum als Phantom Mythos
birgitschlieps.de Birgit Schlieps Kunst
382 Startseite Willkommen
10783
Berlin
Willkommen:  
ep-store.de
383 Business Development Germany German
10783
Berlin
We are the leading German Marketing Company bringing your business on the German market. Our
cockpit-germany.de German Companies German Marketing
384 Coworkingberlinsquarehaus.de coworkingberlinsquarehaus Webseite! Square Haus am Nollendorfplatz GmbH
10783
Berlin
SquareHaus work meet share collaborate coworking büros konferenzraum
coworking-berlin-squarehaus.de
385 Business Development Germany German
10783
Berlin
We are the leading German Marketing Company bringing your business on the German market. Our
dashboard-germany.de German Companies German Marketing
386 Herzlich Willkommen Willkommen Forner + Forner GbR
10783
Berlin
Als kreatives und innovatives Unternehmen für Beratung und Kommunikation möchten wir Sie als vertrauensvoller Partner
ff-beratung.de
387 Home SchwarzweißFotogr
10783
Berlin
Neue Wege Neue Sichten Neue Fotografien Du möchtest besser wahrnehmen und kreativ sein
fotografisch-sehen-lernen.de SchwarzweißFotografie Konzeptfotografie Fotografisch
388 Fotostudio Altman. Hochzeit Wettbewerb Studioalex.de
10783
Berlin
Suchen Sie einen professionellen Fotografen mit über 25 Jahre Erfahrung in der Fotografie? Dann sind
fotostudioalex.de Studioalex.de Hochzeit Wettbewerb Meine Traumhochzeit!
389 DIF | Dit is mirapodo ? operated by myToys.de GmbH
10783
Berlin
DAS Berliner Modeblog zu Fashiontrends und Modesünden Parties und Veranstaltern Designern und Kollektionen
dit-is-fashion.de
390 Heilpraxis Susanne Weis Heilpraxis
10783
Berlin
Heilpraxis Susanne Weis
heilpraxisweis.de Heilpraxis KLANGTHERAPIE HOMÖOSYNERGETIK AUSLEITUNG ERNÄRUNG
391 BAKUNAPOLI BakuNapoli
10783
Berlin
BAKUNAPOLI.Aserbaidschanische und italienische Küche.
baku-napoli.de BakuNapoli Restaurant Berlin Aserbaidschanische Küche
392 Kristina Jacoby Startseite Ghostwriter
10783
Berlin
Kristina Jacoby unterstützt Autoren bei der Erstellung ihrer Bücher
kristinajacoby.de Ghostwriter Ghostwriting Wissenschaftliches
393 Startseite Klinisches Krebsregister Klinisches Krebsregister für Brandenburg und Berlin gGmbH Klinisches
10783
Berlin
Informationen zur klinischen Krebsregistrierung in Brandenburg
kkrbb.de Klinisches Krebsregister Brandenburg
394 Kniggeinberlin.de Willkommen bei Knigge
10783
Berlin
Gesellschaftlicher Schliff selbstsicheres und stilvolles Auftreten ist heute wichtiger denn je. Jeder kann Benehmen
knigge-in-berlin.de Knigge Seminare KniggeSeminare Benehmen Benimmkurse
395 PROJECT318 photography
10783
Berlin
Homepage für die Vernissage / Ausstellung PROJECT318 der SRH Hochschule der populären Künste (hdpk).
project318.de Photography Design Motion
396 Ludger Jungnitz Prozessbegleitung Prozessbegleitung
10783
Berlin
Prozessbegleitung Berlin Ludger Jungnitz
prozessbegleitung-berlin.de Prozessbegleitung Coaching Projekte
397 SPAM Magazin SPAM
10783
Berlin
SPAM Magazin Ausgabe 01
spam-music.de SPAM; Magazin Musik
398 Text Julia Richter
10783
Berlin
Erstklassige Unternehmenskommunikation Texte und Konzepte in Berlin
text-juliarichter.de
399 ReBuy der einfache An reBuy reCommerce GmbH gebraucht
10783
Berlin
An und Verkauf für gebrauchte Handys Tablets Videopiele Filme CDs
rebuy.de Gebraucht Kaufen Gebraucht Verkaufen
400 Pasta e Più Startseite Frische
10783
Berlin
Frische Pasta in Berlin
pasta-e-piu.de Frische Pasta Berlin Raviolli Ghnochi
401 Aktuelles Bürgerinitiative
10783
Berlin
Stadtplanung von unten Stadtentwicklung TempelhofSchoeneberg Berlin
stadtplanung-von-unten.de Bürgerinitiative Bürgerbegehren Bürgerentscheid Anwohnerversammlung Gleisdr
402 Taxi Bildungscenter Berlin Treffpunkt Bildung GmbH Taxischein
10783
Berlin
Wir schulen seit 18 Jahren erfolgreich auf die Ortskundeprüfung mit eigenem ständig aktuellem
taxi-bildungscenter.de Taxischein PSchein Taxifahrer Fahrgastbeförderung Ortskundeprüfung
403 Studio NiMa Produktion Mode Kauffeld und Jahn GbR
10783
Berlin
Vom Entwurf bis zur Produktion. Mode und Textil. Studio NiMa ist in der Bekleidungsindustrie
studionima.de
404 Schuhe Online Shop myToys, mirapodo und ambellis - Shops der myToys.de GmbH
10783
Berlin
Schöner Schuhe shoppen ? riesige Auswahl für Damenschuhe ? Herrenschuhe ? und Kinderschuhe ? Bestellen
mirapodo.de
405 Yoga in Kreuzberg Yoga
10783
Berlin
Yoga in Berlin an Ihrem Arbeitsplatz oder besuchen Sie YogaKurse in Berlin Kreuzberg mit
yoga-und-massage.de Yoga Am Arbeitsplatz Yoga
406 MyToys | Alles für myToys, mirapodo und ambellis - Shops der myToys.de GmbH
10783
Berlin
myToys Ihr OnlineShop für Spielzeug Kindermode Babyausstattung und vieles mehr. Über 100.000
mytoys.de
407 Werbung auf dem Sattelschoner|
10783
Berlin
Sattelschützer als Werbemittel: Bedrucken Sie Sattelbezüge mit Ihrem Logo. Individuelle Gestaltungsmöglichkeiten Lieferung nach drei
kultsattel.de
408 Finest Whisky Shop Whisky
10781
Berlin
Unsere Philosophie ist es hochwertige seltene und alte Flaschen der verschiedensten Destillen und Abfüller
finestwhisky.de Whisky Verkauf Berlin
409 Black meadow music production Martin Klein und Christian Kociolek GbR
10781
Berlin
black meadow music production is a label situated in Berlin.
black-meadow.de
410 Immocollect.de by Portal Financecollect Immocollect.de by Portal Financecollect GmbH Immocollect.de
10781
Berlin
Immobilienangebote von Immocollect.de by Portal Financecollect GmbH
immocollect.de Immocollect.de By Portal Financecollect GmbH
411 Simply : pr + simply
10781
Berlin
simply : die PR und Marketing Agentur für erklärungsbedürftige Produkte! fon +49 (0) 30. 21
agentur-simply.de Simply Public Relation
412 Ashtanga Yoga Schule Berlin Ashtanga
10781
Berlin
Ashtanga Yoga Schule in Berlin Schöneberg am Winterfeldtplatz Pallasstr. 89 10781 Berlin
ashtangayogaschoeneberg.de Ashtanga Yoga Berlin Schöneberg
413 Rosenscharf und Edelsüß Catering ZOE
10781
Berlin
Restaurant ZOE Berlin. Asiatische und mediterrane Küche zwischen Hackeschem Markt und Alexanderplatz in Berlin Mitte.
aromamanufaktur.de ZOE Restaurant Lounge
414 Online Marketing: Wissen
10781
Berlin
Endlich von Online Marketing profitieren. Portal Ratgeber für erfolgreiches Internetmarketing mit Grundlagen Tipps
omkt.de
415 :: NATURKOSMETIK CALLA
10781
Berlin
Fachgeschäft für Naturkosmetik und Naturwaren. Kosmetische Behandlungen nach Dr. Hauschka und M.Gebhardt.
calla-naturkosmetik.de
416 Architektur Planung Beratung
10781
berlin
Architekten Hannover Berlin Architekturplanung Bauberatung Projektentwicklung Wertermittlung Architektur architectura nova
chocmoc.de
417 ChristianErdmann.de Christian
10781
Berlin
Willkommen auf der privaten Site von Christian Erdmann. Erfahren Sie mehr über meine Dozententäigkeit und
christian-erdmann.de Christian Erdmann Dozent Verwaltungsrecht Doppik.kom.bb
418 Christine Ordnung | Home xxxxx
10781
Berlin
xxxxx
christine-ordnung.de Xxxxx
419 CORINO 4 MEN CorinoArt
10781
Berlin
Photographer for beauty nude art fashion faces lingerie interieur
corino4men.de CorinoArt Photography Fotografie
420 Claudia Scholl Aktuelle Claudia
10781
Berlin
Claudia Scholl Buchkonzeption Gestalterische Konzepte Kinderkunstprojekte Illustration und Corporate Design
claudia-scholl.de Claudia Scholl Berlin Kartonzauber Grafikdesign
421 URBANIS Startseite URBANIS GmbH URBANIS
10781
Berlin
Herzlich willkommen bei der URBANIS GmbH
bvg-holding.de URBANIS Berlin Unternehmen
422 Home Chatwins Chatwin
10781
Berlin
CHATWINS: Bücher rund ums Reisen gibt es hier nach Ländern und Kontinenten sortiert. Reisen heißt:
chatwins.de Chatwin Chatwins Bruce Chatwin A
423 52. DeutschFranzösisches Volksfest Schaustellerverband Berlin e.V. Deutsch
10781
Berlin
Das mit Abstand größte jährliche Volksfest in Berlin Willkommen auf über 40.000m² Erlebnisfläche!
deutsch-franzoesisches-volksfest.de Deutsch Französisches Volksfest Laune
424 Beateberlin AGENTUR FÜR EVENTS beateberlin
10781
Berlin
beateberlin Agentur für Events und Stadterlebnisse in Berlin und Umgebung
beateberlin.de Beateberlin Agentur Agency
425 Berliner Berufsverband der Gesundheitsaufseher/Hygieneinspektoren BBGH
10781
Berlin
Der Berliner Berufsverband der Gesundheitsaufseher/Hygieneinspektoren stellt sich vor und bietet Informationsmaterial rund um den öffentlichen
bbghev.de BBGH BVH Hygiene
426 Organisationsberater Berater für Bio
10781
Berlin
Unternehmensberater für Ökologische Landwirtschaft (Biolandbau) und Biomarkt (Biohandel) ? Experte für Bio Lebensmittel und Biolandbau
bio-projektmanagement.de Bio Lebensmittel Bioprodukte
427 BeGreen Netzwerk für nachhaltiges beGreen Netzwerk für nachhaltiges Wirtschaften e.V. Verein
10781
Berlin
Alles Wissenswerte von der Historie über Ergebnisse Veranstaltungen und neueste Trends bis hin zur
begreen-net.de Verein Mitgliedschaft Beitrittserklärung
428 IOB Internationale OmnibusBetreibergesellschaft ZOB
10781
Berlin
ZOB Zentraler Omnibusbahnhof Berlin an Funkturm und Messegelände:
berlinzob.de ZOB Zentraler Omnibusbahnhof Berlin APC
429 Blauwerke verlag # groschenhefte blauwerke
10781
Berlin
Verlag aus Berlin fuer konkrete Literatur und konkrete Wissenschaft. Gebrauchstexte für die Westentasche.
blauwerke-berlin.de Blauwerke Blauwerke Berlin
430 Werbe und Vertriebsmangement GSW
10781
Berlin
Die “ FIGARO news” sind das GSW Club Magazin für die Mieter der GSW Immobilien
effektivwerbung24.de GSW Club Figaro News
431 Elena nehrmann promotion
10781
Berlin
Kultur Kommunikation
elenanehrmann.de Promotion P.r. Pr
432 MACKE Boutique Berlin
10781
Berlin
Mode ist Kultur Entsprechend diesem Motto bieten wir Ihnen stil und anspruchsvolle Mode und
macke-berlin.de
433 DigitalphotoBerlin Foto
10781
Berlin
Phototechnik Fehling Fotografie Bearbeitung Entwicklung Vergrößerung von Diabildern Digitalfotografien
digitalphoto-berlin.de Foto Fotografie Photo
434 Diethard Küster Regisseur
10781
Berlin
Diethard K¸ster Regisseur Produzent Autor Regie Produktion
diethard-kuester.de
435 HOME MEDIATION
10781
Berlin
ALEXANDER STAUBACH | MEDIATION | STAUBACHBERATUNG
staubach-beratung.de MEDIATION | KONFLIKT | KONFLIKTKLÄRUNG
436 BEOBOOKS Bücher aus Bücher
10781
Berlin
BEOBOOKS Bücher aus Serbien Katarina Belovukovic
beo-books.de Bücher Serbien
437 Bettina Willumeit | Styling bettina
10781
Berlin
innovatives kundenorientiertes Fashion Styling für die Bereiche Werbung Editorialproduktionen und Onlinevermarktung
bettina-willumeit.de Bettina Willumeit Stylistin
438 HOME
10781
Berlin
HOME
kunsttherapieraum.de
439 Joomla Toplist Hauptseite joomla
10781
Berlin
Dies ist die deutsche JoomlaTopseitenliste. Hier finden Sie die wahrscheinlich besten Seiten die mit
joomla-toplist.de Joomla Toplist Best
440 Jugendhilftweiter.de Jugend
10781
Berlin
Modellprojekt Jugendräte: Eine Homepage von den Jugendräten des Modellprojekts Jugendräte von Berlin SchönebergNord
jugend-hilft-weiter.de Jugend Hilft Weiter
441 LumpenPrinzessin ... Kinderkleidung Kinderkleidung
10781
Berlin
Die LumpenPrinzessin bietet seit über 15 Jahren Alles für Baby und Kind in gut erhaltener
lumpenprinzessin.de Kinderkleidung Kindermode Kinderschuhe
442 Herzlich Willkommen auf LittleThailand.de thai
10781
Berlin
Die neuesten und beliebtesten ThaiMassagen ThaiRestaurants Shops und mehr Mit vielen Bewertungen
little-thailand.de Thai Verzeichnis übersetzer Shops Restaurants
443 Evelyn Bornemann Berlin Berlin
10781
Berlin
Evelyn Bornemann in Berlin Physiotherapie Psychotherapie (HPG) Coach nach der TippingMethode hilft
evelyn-bornemann.de Berlin Physiotherapie Psychotherapie
444 ||| EuroKaukAsia     EuroKaukAsia e.V.
10781
Berlin
KaukasischEuropäischer Kultur und Wissenschaftsverin e.V.
eurokaukasia.de
445 Excelle.consulting | Produktions und excelle.consultin
10781
Berlin
excelle.consulting bietet kundenindividuelle Lösungen zu Fragen der strategischen Unternehmensentwicklung und der Gestaltung operativer Leistungsstrukturen sowie
excelle-consulting.de Excelle.consulting Excelle Excelle.de
446 F/21 Büro für Nora
10781
Berlin
f/21 Büro für Zukunftsfragen ist Beratungsinstitut und Denkfabrik. f/21 beobachtet die Gegenwart identifiziert
f-21.de Nora Stampfl Nora S. Stampfl
447 MEHR ALS STERNE |
10781
Berlin
Natalia Domagala
mehr-als-sterne.de
448 Investieren wie die Superreichen Investieren
10781
Berlin
Wie auch Sie schnell und einfach die Investments der Superreichen finden die nur ein
superreichtum.de Investieren Geld Anlegen
449 Mediation in Diversity Mediation
10781
Berlin
Mediation in Konfliktfällen Preisgünstige Mediationsausbildung nach anerkannten Standards von Bundesverbänden oder erfahrene Mediatoren? Kontaktieren
meddiv.de Mediation Berlin Mediationsausbildung Berlin
450 Jura Service Berlin | kaffeevollautomat
10781
Berlin
Jura Service Berlin| Kaffeemaschine u. Kaffeeautomat ReparturWartung u. Kundendienst in Berlin.Reparaturen von Kaffeemaschinen u.
jura-service-berlin.de Kaffeevollautomaten Reparatur Jura Service Kaffeemaschinen
451 Kanzlei Klaus Koblitzek homepage
10781
Berlin
homepage dokument webpage page web netz
kanzlei-koblitzek.de Homepage Dokument Webpage Page Web
452 Kanzlei Rechtsanwalt Böcker joomla
10781
Berlin
Joomla! dynamische PortalEngine und ContentManagementSystem
kanzleiboecker.de Joomla Joomla
453 Rechtsanwaltskanzlei und Notariat Michael Rechtsanwalt
10781
Berlin
Rechtsanwaltskanzlei und Notariat Michael Müller Rechtsanwalt und Notar Michael Müller in Berlin Schöneberg berät
kanzlei-mmueller.de Rechtsanwalt Notar Berlin
454 Schauspieler Coaching Berlin Karin
10781
Berlin
Mit dem KarriereTraining für Schauspieler durchstarten und dranbleiben. Die eigene Karriere lustvoll und aktiv gestalten.
karin-kleibel.de Karin Kleibel PR
455 LumpenPrinzessin ... Kinderkleidung Kinderkleidung
10781
Berlin
Die LumpenPrinzessin bietet seit über 15 Jahren Alles für Baby und Kind in gut erhaltener
kind-in-berlin.de Kinderkleidung Kindermode Kinderschuhe
456 Claudia Scholl Aktuelle Claudia
10781
Berlin
Claudia Scholl Buchkonzeption Gestalterische Konzepte Kinderkunstprojekte Illustration und Corporate Design
kartonzauber.de Claudia Scholl Berlin Kartonzauber Grafikdesign
457 Krups | Siemens | aeg
10781
Berlin
Krups | Siemens | AEG | ReparaturServiceWartung und Kundendienst in Berlin.Kaffeemaschinen und Kaffeevollautomaten
kaffeemaschine-reparatur.de Aeg Krups Siemens Kaffeevollautomaten Kaffeemaschinen
458 Home
10781
Berlin
Elzers Seiten zum Wohnungseigentumsrecht
oliverelzer.de
459 Patwork
10781
Berlin
Feinmechanik
pat-work.de
460 Peter Bruns Homepage Peter
10781
Berlin
Homepage von Peter Bruns
peterbruns.de Peter Bruns Cello
461 Rechtsanwälte PfaffHofmann u. Lee Rechtsanwalt
10781
Berlin
Die Rechtsanwaltskanzlei PfaffHofmann u. Lee legal Rechtsanwaltsgesellschaft bietet eine und zielorientierte Beratung. Schwerpunkt Wirtschaftsrecht z.B.
phl-legal.de Rechtsanwalt Rechtsanwaltskanzlei Arbeitsrecht
462 ..::Phoenix Lounge::.. Phoenix
10781
Berlin
Phoenix Lounge. Bar Restaurant Cafe in Schöneberg.
phoenix-lounge.de Phoenix Lounge Phoenix
463 Physimetron Elektronische Messtechnik Transimpedanzvers
10781
Berlin
Rauscharme analoge und digitale elektronische Messtechnik
physimetron.de Transimpedanzverstärker Pikoamperemeter Vorverstärker
464 Mobilienberlin.de living
10781
Berlin
mobilien: die schönen dinge zum leben wohnen und arbeiten! besuchen sie uns in berlinschöneberg...
mobilien-berlin.de Living Wohnen Wohnaccessoires
465 Otto Events Veranstaltungstechnik veranstaltungstec
10781
Berlin
Otto Events organisiert Ihre Veranstaltung in Berlin Brandenburg und Potsdam. Wir vermieten Veranstaltungstechnik
ottoevents.de Veranstaltungstechnik Berlin Potsdam
466 Naturheilpraxis im Hofbogen behandlung
10781
Berlin
Naturheilkunde Praxis Hofbogen Heilung Anwendung Rheuma Therapie Heilpraktiker
heilpraktikerin-schoeneberg.de Behandlung Therapie Körper
467 HALBE STUNDEN // HALF Kurzfilm
10781
Berlin
Film
halbestunden.de Kurzfilm Leere Familie
468 Flamencomeetsclassic flamenco
10781
Berlin
flamencomeetsclassic ist ein Tanztheater aus Berlin das klassische Texte Flamencomusik und Tanz zu
flamenco-meets-classic.de Flamenco Tanz Tanztheater
469 Flats Co. Flats & Co. GmbH Waldmannstr.
10781
Berlin
Eigentumswohnungen Waldmannstr. 3 BerlinLankwitz
flatsandco.de Waldmannstr. 3
470 Praxis für integrale Medizin Integral
10781
Berlin
Arztpraxis Dr. Martin Bosch BerlinSchöneberg
integralmedicine.de Integral Medicine Arztpraxis
471 Startseite
10781
Berlin
Anwälte Steuerberater PSInkasso
inkasso-in-berlin.de
472 Gerd Brendel | Journalist Gerd
10781
Berlin
Gerd Brendel Journalist
gerdbrendel.de Gerd Brendel Journalist
473 Autorin Martina Gneist CBT
10781
Berlin
Autorin Martina Gneist Projekte und Philosophie
gn-konzepte.de CBT WBT Lernkonzepte
474 Startseite hanslux Open
10781
Berlin
Beratung und Dienstleistungen für Computer Netze und ITSicherheit unter Verwendung von OpenSource Produkten
hanslux.de Open Source Freie Software
475 Theater Hans Wurst Nachfahren Grüffelo
10781
Berlin
Hans Wurst Nachfahren Theater für Kinder und Erwachsene in BerlinSchöneberg zeigt Spielplan
hasn-wurst-nachfahren.de Grüffelo Puppentheater Berlin
476 Organisationsberater Berater für Bio
10781
Berlin
Unternehmensberater für Ökologische Landwirtschaft (Biolandbau) und Biomarkt (Biohandel) ? Experte für Bio Lebensmittel und Biolandbau
handel-und-wandel.de Bio Lebensmittel Bioprodukte
477 Fachanwalt für Arbeitsrecht Berlin Fachanwalt
10781
Berlin
Fachanwalt für Arbeitsrecht Erbrecht und Versicherungsrecht in Berlin sowie Notar Berlin. Kanzlei Gäbelein
gaebelein-veith.de Fachanwalt Arbeitsrecht Versicherungsrecht
478 DFRV Regionalgruppe Berlin
10781
Berlin
| Website der Regionalgruppe Berlin des Deutschen Fundraising Verbands
fundraisingverband-berlin.de
479 Fußballwörterbuch in 7 Sprachen
10781
Berlin
FußballWörterbuch in 7 Sprachen: Homepage des Buches von Kaya Yildirim
fussballwoerterbuch.de
480 Felicitas Jacobs Theaterpädagogin Theater
10781
Berlin
Ich biete vielfältige theaterpädagogische Qualifikationen als Ausbildung oder Fortbildung initiiere theatrale Prozesse und entwickle
felicitasjacobs.de Theater Pädagogik Spiel
481 Organisationsberater Berater für Bio
10781
Berlin
Unternehmensberater für Ökologische Landwirtschaft (Biolandbau) und Biomarkt (Biohandel) ? Experte für Bio Lebensmittel und Biolandbau
conradthimm.de Bio Lebensmittel Bioprodukte
482 Startseite constant balance Fußpflege
10781
Berlin
Heilsame Behandlungen für Körper Geist und Seele Fußpflege Massagen und Heilarbeit
constant-balance.de Fußpflege Wellness Entspannung
483 Organisationsberater Berater für Bio
10781
Berlin
Unternehmensberater für Ökologische Landwirtschaft (Biolandbau) und Biomarkt (Biohandel) ? Experte für Bio Lebensmittel und Biolandbau
consultantfororganictrade.de Bio Lebensmittel Bioprodukte
484 Querschnitt Weine
10781
Berlin
Querschnitt Weine Weinhandlung in BerlinSchöneberg
querschnitt-weine.de
485 Startseite
10781
Berlin
Rechtsanwältin Sylvia PfaffHofmann: Ihr Recht in guten Händen! Spezialgebiete: Europarecht Einbuergerungsrecht und Asylverfahrensrecht
rechtsanwaeltinpfaff-hofmann.de
486 Praya ThaiMassage Startseite Massage
10781
Berlin
Praya ThaiMassage Ihre Praxis in Berlin bietet professionelle Physiotherapie und Massagen als therapeutisches
prayathai.de Massage Praxis
487 Startseite
10781
Berlin
Anwälte Steuerberater PSInkasso
ps-inkasso-berlin.de
488 Kanzlei Rechtsanwalt Böcker joomla
10781
Berlin
Joomla! dynamische PortalEngine und ContentManagementSystem
rechtsanwaltskanzlei-24.de Joomla Joomla
489 Fachanwalt Strafrecht Rechtsanwalt Fachanwalt
10781
Berlin
Fachanwalt Strafrecht Rechtsanwalt Feldkamp Berlin
rechtsanwaltskanzlei24.de Fachanwalt Strafrecht Rechtsanwalt
490 Reinigung360.de | Professionelle Gebäudereinigung Reinigung
10781
Berlin
Gebäudereinigung Büroreinigung Bauendreinigung Glassreinigung Laborreinigung Praxisreinigung Spezialreinigung Teppichreinigung
reinigung360grad.de Reinigung Reinigung Berlin
491 REISEDIENST WITTER: Tolle Reisen. Witter
10781
Berlin
REISEDIENST WITTER: Tolle Reisen. Viel Vergnügen!
reisedienst-witter.de Witter Reisedienst REISEDIENST
492 Schiek Sports Germany Bodybuilding Schiek
10781
Berlin
Offizieller Distributor Schiek Sports in Deutschland erhältlich Schiek Sports Schiek Sport Handschuhe
schiek-store.de Schiek Sport Handschuhe
493 Schiek Sports Germany offizieller Schiek
10781
Berlin
Offizieller Distributor von Schiek Produkten in Deutschland Fitness Bodybuilding Zubehör Fitnesshandschuhe Zughilfen Handgelenkschutz Bandagen
schiek-germany.de Schiek Fitnesshandschuhe Trainingsgürtel
494 HOME
10781
Berlin
Schulshirt Schulkleidung Schuluniform TShirts PoloShirts Sweatshirts Kapuzenshirts Kleidung Uniform Schule Freizeit Caps
scoolchic.de
495 Senioren Beratung Berlin Seniorenberatung
10781
Berlin
Seniorenberatung Berlin
senioren-beratung-berlin.de Seniorenberatung Pflegeheimberatung Neue
496 Datenschutzanalyse externer Datenschutzbeauftragter PrivCom Datenschutz GmbH Datenschutz
10781
Berlin
Wir organisieren als externe Datenschutzbeauftragte mit DatenschutzAudits Schulungen und Sicherheitstests datenschutzkonforme und sichere Prozesse.
privcom.de Datenschutz Audits Datensicherheit
497 PROMINENTENBAU© Prominentenbau
10781
Berlin
Erwachsene bauen mit LEGO Elementen für Kinder
prominenten-bau.de Prominentenbau Prominent DAI Lego Hellweg
498 PME PME
10781
Berlin
PME ProBau Management und Entwicklungsgesellschaft mbH
pme-gmbh.de PME ProBau Management Entwicklungsgesellschaft
499 Startseite
10781
Berlin
Rechtsanwältin Sylvia PfaffHofmann: Ihr Recht in guten Händen! Spezialgebiete: Europarecht Einbuergerungsrecht und Asylverfahrensrecht
recht24-berlin.de
500 IOB Internationale OmnibusBetreibergesellschaft ZOB
10781
Berlin
ZOB Zentraler Omnibusbahnhof Berlin an Funkturm und Messegelände:
iob-berlin.de ZOB Zentraler Omnibusbahnhof Berlin APC
501 Nina Petrick ? Autorin Nina
10781
Berlin
Nina Petrick freie Autorin für Kinder und Jugendbücher Belletristik und Kurzgeschichten. Ihr Jugendbuch
nina-petrick.de Nina Petrick Autorin
502 Digital Innovation Facilitator GuentherLange GmbH digitale
10781
Berlin
Mit Design Thinking systematisch zu kreativen Problemlösungen für das InternetBusiness: Jens Otto Lange moderiert Ideen
jensottolange.de Digitale Innovation Kreativität
503 Berlinatnight.de :: Stadtmagazin für Musikkalender
10781
Berlin
NightlifeGuide für Berlin: Clubs Bars Parties Tickets Kinoprogramm Konzerte
berlinatnight.de Musikkalender Movie Genießen
504 Www.djembeberlin.de
10781
Berlin
Du möchtest die westafrikanische Trommel Djembe spielen lernen. Hier findest du eine Liste von Lehrern
djembe-berlin.de
505 Naturheilpraxis im Hofbogen behandlung
10781
Berlin
Naturheilkunde Praxis Hofbogen Heilung Anwendung Rheuma Therapie Heilpraktiker
hofbogen.de Behandlung Therapie Körper
506 Theater Hans Wurst Nachfahren Grüffelo
10781
Berlin
Hans Wurst Nachfahren Theater für Kinder und Erwachsene in BerlinSchöneberg zeigt Spielplan
hans-wurst-nachfahren.de Grüffelo Puppentheater Berlin
507 Berliner Berufsverband der Gesundheitsaufseher/Hygieneinspektoren BBGH
10781
Berlin
Der Berliner Berufsverband der Gesundheitsaufseher/Hygieneinspektoren stellt sich vor und bietet Informationsmaterial rund um den öffentlichen
hygieneinspektoren.de BBGH BVH Hygiene
508 Kanzlei Rechtsanwalt Böcker joomla
10781
Berlin
Joomla! dynamische PortalEngine und ContentManagementSystem
kanzlei-boecker.de Joomla Joomla
509 ..::Phoenix Lounge::.. Phoenix
10781
Berlin
Phoenix Lounge. Bar Restaurant Cafe in Schöneberg.
phoenixlounge.de Phoenix Lounge Phoenix
510 Rosenscharf und Edelsüß Catering ZOE
10781
Berlin
Restaurant ZOE Berlin. Asiatische und mediterrane Küche zwischen Hackeschem Markt und Alexanderplatz in Berlin Mitte.
rosenscharf-edelsuess.de ZOE Restaurant Lounge
511 Tucanu Webseiten leicht Jürgen
10781
Berlin
tucanu der Weg zur eigenen Homepage leicht zu haben einfach zu bedienen
tucanu.de Jürgen Kubens Beratung
512 Nicolai Thärichen Komponist Arrangeur Thärichens
10781
Berlin
Nicolai Thärichen Komponist Arrangeur Pianist Aktuelles 2009 Thärichens Tentett Konzerte
thaerichen.de Thärichens Tentett Konzerte Myspace
513 Felicitas Jacobs Theaterpädagogin Theater
10781
Berlin
Ich biete vielfältige theaterpädagogische Qualifikationen als Ausbildung oder Fortbildung initiiere theatrale Prozesse und entwickle
theaterpaedagogische-kunst.de Theater Pädagogik Spiel
514 URBANIS Startseite URBANIS GmbH URBANIS
10781
Berlin
Herzlich willkommen bei der URBANIS GmbH
urbanis-berlin.de URBANIS Berlin Unternehmen
515 Ihre Website erstellen
10781
Berlin
Alles rund um die Website. Vorkonfiguriert oder maßgeschneidert für lokale Unternehmen aus Dienstleistung Handwerk
spreelink.de
516 Studio la voce Sängerin
10781
Berlin
Stefania Erzmoneit Habsburgerstrasse 5 10781 Berlin fon: 03021 99 68 23 fax:
studiolavoce.de Sängerin Sängerin Klang
517 Home Andrea Schlinkert Queer
10781
Berlin
Dies ist die Seite von Andrea Schlinkert Tanzlehrerin und Djane in Berlin.
tangoschlampen.de Queer Tango Queer Argentino
518 Willkommen auf der Startseite Tango
10781
Berlin
Tango Rueda eine Begegnung in vier Takten in Berlin
tangorueda.de Tango Rueda Berlin
519 VIEV | NEW
10781
Berlin
VIEV ? das sind Wagner Werner ein deutschchilenisches Designerkollektiv aus Berlin.
viev.de
520 Excelle.consulting | Produktions und excelle.consultin
10781
Berlin
excelle.consulting bietet kundenindividuelle Lösungen zu Fragen der strategischen Unternehmensentwicklung und der Gestaltung operativer Leistungsstrukturen sowie
excelle.de Excelle.consulting Excelle Excelle.de
521 Wanderreisen Pierolt Wanderreisen
10781
Berlin
Wanderreisen Pierolt Wandern im Spreewald Hüttenwanderung in den Lienzer Dolomiten Wandern rund
wanderreisen-pierolt.de Wanderreisen Pierolt Wandern Im
522 SammlungsVerkauf coupon
10781
Berlin
Webdealscout Suche deine Gutscheine Deals und Rabatte
webdealscout.de Coupon Gutschein Geschenk
523 Theo G. Gilbers Sexualpädagoge
10781
Berlin
Sexualpädagogische Fortbildung für pädagogische und psychosoziale Fachkräfte
theogilbers.de Sexualpädagoge Und Sexualtherapeut
524 Schmuckmanufaktur Berlin Goldschmiedin Schmuckmanufaktur
10781
Berlin
Schmuckmanufaktur Berlin Goldschmiedin Schmuck Trendart
schmuckmanufaktur-berlin.de Schmuckmanufaktur Berlin Goldschmiedin
525 LumpenPrinzessin ... Kinderkleidung Kinderkleidung
10781
Berlin
Die LumpenPrinzessin bietet seit über 15 Jahren Alles für Baby und Kind in gut erhaltener
schuhchen.de Kinderkleidung Kindermode Kinderschuhe
526 Robert Berghoff Berlin robert
10781
Berlin
Mit einfachem Blick auf die Dinge: Bildgestaltender Kameramann Director Of Photography Cinematographer
robertberghoff.de Robert Berghoff Filme
527 Schuldnerberatung Berlin Schuldenberatung Berlin Schuldnerberatung
10781
Berlin
? Schuldnerberatung Berlin vom Anwalt Privatinsolvenz Restschuldbefreiung Verbraucherinsolvenz Schuldenberatung Verbraucherinsolvenzverfahren. Rechtsanwalt Pillig Berlin
restschuldbefreiung.de Schuldnerberatung Berlin Privatinsolvenz Restschuldbefreiung Schuldenberatu
528 HOME
10781
Berlin
Schulshirt Schulkleidung Schuluniform TShirts PoloShirts Sweatshirts Kapuzenshirts Kleidung Uniform Schule Freizeit Caps
schulschick.de
529 Home ? Goldschmiede Schmuckbotschaften
10781
Berlin
Goldschmiede Schmuckbotschaften aus Berlin entwirft individuellen Schmuck!
schmuck-gewecke.de
530 Startseite
10781
Berlin
Anwälte Steuerberater PSInkasso
schygulla-inkasso.de
531 Gabriele Steiner Praxis für Ärztin
10781
Berlin
Gabriele Steiner Praxis für Homöopathie am Winterfeldtplatz in BerlinSchöneberg Ärztin für Allgemeinmedizin
steiner-gabriele.de Ärztin Homöopathie Homoeopathie
532 Stephan Szasz Startseite Über
10781
Berlin
Ich bin Stephan Szasz aus Berlin und erzähle euch auf dieser Webseite ein paar Geschichten
stephan-szasz.de Über Mich Hobby
533 Patwork
10781
Berlin
Feinmechanik
viosk.de
534 52. DeutschFranzösisches Volksfest Schaustellerverband Berlin e.V. Deutsch
10781
Berlin
Das mit Abstand größte jährliche Volksfest in Berlin Willkommen auf über 40.000m² Erlebnisfläche!
volksfest-berlin.de Deutsch Französisches Volksfest Laune
535 Apartment Dr. Claudia Malzfeldt
10781
Berlin
Startseite
westerlandapartment.de
536 Wirtschaftsmediatoren Berlin Wirtschaftsmediat
10781
Berlin
Wirtschaftsmediatoren Berlin
wirtschaftsmediatoren-berlin.de Wirtschaftsmediator Mediator Madiation Spannagel Eckolt
537 Home Musik
10781
Berlin
Kinderlieder Wir Kinder vom Kleistpark gute Musik für Kinder Konzerte für Kinder
wirkindervomkleistpark.de Musik Für Kinder Kinderkonzerte
538 Ölmühle Berlin Olivenöl
10781
Berlin
Olivenöl aus der ölmühle Berlin Schöneberg. Bei uns finden Sie ein Sortiment von über 60 meist
xn--lmhleberlin-qfb4f.de Olivenöl Olivenholz Balsamico
539 Home
10781
Berlin
Sachverständiger von der Handwerkskammer Berlin öffentlich bestellter und vereidigter Sachverständiger für das Dachdeckerhandwerk Steildacheindeckungen
xn--stutenbumer-heinz-wqb.de
540 Brautkleider alles für Kalamov und Kalamova GbR
10781
Berlin
Bei uns finden Sie moderne und günstige Brautkleider Abendmode Accessoires Dessous. Schneller
weddingssecrets.de
541 Anke Sevenich | Schauspielerin
10781
berlin
Anke Sevenich gehört zu den besten wenn auch eher unauffälligen Schauspielerinnen des deutschen Fernsehens
anke-sevenich.de
542 Restaurant AltÖsterreich Startseite Restaurant
10781
Berlin
Restaurant AltÖsterreich heißt: Echtes Wiener Schnitzel duftende Frittatensuppe eine ordentliche Portion Kaiserschmarrn oder
alt-oesterreich.de Restaurant AltÖsterreich Alt
543 Startseite Queer
10781
Berlin
Musikversierte und begeisterte Djane mit breitgefächertem Musikrepertoire für jegliche Anlässe buchbar. Ob Standard und Lateinmusik
andrea-schlinkert.de Queer Tango Queer Argentino
544 Welcome to Berlin Gym aktiv
10781
Berlin
Auf diesen Seiten findet Ihr alle Informationen rund um den Verein Berlin Gym ? Verein
berlin-gym.de Aktiv Fitness Kampfsporttraning
545 Berliner Berufsverband der Gesundheitsaufseher/Hygieneinspektoren BBGH
10781
Berlin
Der Berliner Berufsverband der Gesundheitsaufseher/Hygieneinspektoren stellt sich vor und bietet Informationsmaterial rund um den öffentlichen
bhbbev.de BBGH BVH Hygiene
546 Bing Ma Communication China
10781
Berlin
Neue Seite
bingma.de China Business Marketing
547 Schreibcoaching in Berlin Schreibcoaching
10781
Berlin
Schreibcoaching: Sie schreiben gerade an einer wissenschaftlichen Abschlußarbeit? Bringen Sie sich mit Schreibcoaching wieder in
faden-verloren.de Schreibcoaching Wissenschaftliche Abschlussarbeit
548 Ferienhaus Wittingen
10781
Berlin
Ferienhaus Wittingen
ferienhaus-wittingen.de
549 Organisationsberater Berater für Bio
10781
Berlin
Unternehmensberater für Ökologische Landwirtschaft (Biolandbau) und Biomarkt (Biohandel) ? Experte für Bio Lebensmittel und Biolandbau
consultantorganictrade.de Bio Lebensmittel Bioprodukte
550 Home
10781
Berlin
Brandenburger Tor Variationen mit FotoGalerie TorVariationen Brandenburg Berlin Logo
brandenburger-torheiten.de
551 Floorwalker.de Einfach. Schnell. floorwalker
10781
Berlin
Ein Floorwalker bietet nicht nur bei der Einführung neuer Software effektiven Support sondern auch
floorwalker.de Floorwalker Floorwalking Office
552 FHING Aktuell Werbung
10781
Berlin
für heute ist nichts geplant
fhing.de Werbung Postkarte Schwul
553 Restaurant AltÖsterreich Startseite Restaurant
10781
Berlin
Restaurant AltÖsterreich heißt: Echtes Wiener Schnitzel duftende Frittatensuppe eine ordentliche Portion Kaiserschmarrn oder
diodata-restaurant.de Restaurant AltÖsterreich Alt
554 Startseite House of House of Queer Sisters e.V. Queer
10781
Berlin
Wir sind Sisters und Guards die Gutes tun und dies überall wo wir gebraucht
house-of-queer-sisters.de Queer Sisters Schwulen
555 OnlineShop Bastelkits. Made
10781
Berlin
Wir haben ein Kit entwickelt mit dem man gleich loslegt in dem gute
bastelkits.de
556 Linda Sixt Linda
10781
Berlin
Linda Sixt
linda-sixt.de Linda Sixt
557 Lofts Co. Lofts & Co. GmbH lofts
10781
Berlin
Lofts Co. Best in Lofts!
loftsandco.de Lofts Berlin Dachwohnung Berlin
558 Antiquariat Mertens und Pomplun Antiquariat Mertens & Pomplun GbR Antiquariat
10781
Berlin
Antiquariat antiquarische Bücher OriginalPhotographien Fotografie Plakate Landkarten Luxuspapier
mp-rarebooks.de Antiquariat Antiquarische Bücher
559 MR Patterns Willkommen Nähen
10781
Berlin
Mr Patterns das Schnittstudio fuer SelberMacher
mrpatterns.de Nähen Schnittmuster Schnittkurs
560 Psychotherapie und Coaching in
10781
Berlin
Sie suchen einen Psychotherapeuten oder Coach in Berlin? Sie sind in einer schwierigen privaten oder
monika-holz.de
561 Gaastra Napapijri Diesel online Markenmode
10781
Berlin
Fashiontex 24 Online Shop. Ihr Designer Online Shop mit Markenbekleidung wie Gaastra Jacke Poloshirt
fashiontex24.de Markenmode Gaastra Napapijri
562 Heilpraktikerin in Berlin Schöneberg Homöopathie
10781
Berlin
Isabel Blume Heilpraktikerin Klassische Homöopathie und Shiatsu in Berlin
isabel-blume.de Homöopathie Klassische Homöopathie
563 Http://www.KinderladenKonfetti.de
10781
Berlin
Mitten im Schöneberger Winterfeldtkiez in Berlin liegt der kleine bunte Kinderladen Konfetti. Zwei Erzieherinnen
kinderladen-konfetti.de
564 MUTTER RESTAURANT BAR BERLIN thai
10781
Berlin
Die MUTTER in Berlin Schöneberg bietet vom Frühstück im Außenbereich thailändischer Küche und Cocktails
mutter-berlin.de Thai Bar Berlin Thaifood Frühstück
565 Zuhause Mundgerecht Magazin Save
10781
Berlin
MUNDGERECHT ist mehr als nur ein Magazin. Eigentlich sind wir ein soziales Startup mit einer
mundgerecht-magazin.de Save Food Nachhaltiges Essen
566 Home Siebergraphic Siebergraphic Berlin
10781
Berlin
siebergraphic macht die Grafik für Sie in Berlin Nürnberg und Umgebung. Egal was
siebergraphic.de Berlin Grafik Illustration
567 Schlüsseldienst Tempelhof Endpreise direkt Schlüsseldienst
10781
Berlin
Günstiger Schlüsseldienst für Tempelhof. Probleme mit Ihrem Türschloss? Kein Problem. Wir helfen kostengünstig schnell
schluesseldienst-tempelhof-berlin.de Schlüsseldienst Tempelhof Ihr Schlüsseldienst
568 StoppRitalin | Die ScherretMethode Wachstumsstörunge
10781
Berlin
Bei immer mehr Kindern und Jugendlichen in Deutschland stellen Ärzte Aufmerksamkeits und Hyperaktivitätsstörungen fest.
stopp-ritalin.de Wachstumsstörungen ADHS Ritalin StoppRitalin ScherretMethode
569 HOME
10781
Berlin
HOME
ulrikespeyerer.de
570 Wellfina Wellness Fitness Naturheilkunde
10781
Berlin
Angebot: Personal Training Ernährungsberatung Mesotherapie (Anti Aging) Kinesiologie Neuraltherapie Schröpfen
wellfina.de Naturheilkunde Heilpraktiker Personaltraining
StadtBranche.de Orts-Portrait von Berlin in Berlin. Die Themenseite zu Neueröffnungen, verkaufsoffene Sonntage, Gutscheine und Coupons in Berlin erhält 4 StadtBranche Punkte - Bewertet wird die Anzahl der Besucher dieser Themenseite. Stand: + Kontakt

Berlin
Berlin ist die Bundeshauptstadt der Bundesrepublik Deutschland und zugleich eines ihrer Länder. Die Stadt Berlin ist mit rund 3,5 Millionen Einwohnern die bevölkerungsreichste und mit 892 Quadratkilometern die flächengrößte Gemeinde Deutschlands sowie nach Einwohnern die zweitgrößte der Europäischen Union. Sie bildet das Zentrum der Metropolregion Berlin/Brandenburg und der Agglomeration Berlin . Der Stadtstaat unterteilt sich in zwölf Bezirke. Neben den Flüssen Spree und Havel befinden sich im Stadtgebiet kleinere Fließgewässer sowie zahlreiche Seen und Wälder.

LandkreisKreisfreie Stadt Berlin
BundeslandBerlin
Postleitzahl10785
Vorwahl030
BahnhofBerlin Potsdamer Platz
Finanzamt
Berlin Kreisfreie Stadt Berlin Berlin